2WPTA

The crystal structure of im2 in complex with colicin e9 dnase
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
82
structure length
82
Chain Sequence
KHSISDYTEAEFLEFVKKIARAEGATECDDNKLVREFERLTEHPDGSDLIYYPRDDREDSPEGIVKEIKEWRAANGKSGFKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COLICIN-E2 IMMUNITY PROTEIN
publication title The Structural and Energetic Basis for High Selectivity in a High-Affinity Protein-Protein Interaction.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Immune system
total genus 31
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2009-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01320 Colicin_Pyocin Colicin immunity protein / pyocin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.20 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Colicin E immunity protein 2wptA00
1CEIA 1IMQA 2GZEA 1ZNVA 4QKOA 3U43A 4F37A 2VLPA 1E0HA 2JAZA 7CEIA 2GZFA 2GYKA 2ERHA 2GZJA 5EW5E 1AYIA 2VLQA 2VLOA 4UHPB 1UJZA 1EMVA 1GXHA 1FR2A 2JBGA 1BXIA 1GXGA 2NO8A 2VLNA 2GZGA 3GJNA 2K0DX 2JB0A 2K5XA 2GZIA 1MZ8A 3GKLC 1UNKA 2WPTA 1IMPA
chains in the Genus database with same CATH superfamily
5DCKA 3CCEP 2GZJA 2JGPA 1AYIA 2CNRA 4UHPB 1QVFO 2DGYA 2KGAA 4R0MA 2L6EA 1AF8A 1K8AQ 1VKUA 2MR8A 1IUQA 2N98A 3NY7B 4PWVB 4CA3A 4COCA 2JBGA 5I4TG 1NJIQ 2MVUA 4XFXA 1KC8Q 4U0FA 3P05A 5F2KA 1KLPA 2GDXA 1HQBA 4QKOA 4DG9A 3CC2P 4U0CA 2KGCA 2JO0A 2JU2A 2KOQA 1ACPA 3DS0A 2EG5A 2KOOA 3DS4A 3GZMA 3CMEP 4XROA 1VQ9P 2MY5A 1GXGA 4COPA 4XRQA 2JB0A 2WPTA 2CG5B 2FACA 2EHSA 2KGEA 3H47A 5KP8B 3RG2A 3OW2O 5HVCA 2MR7A 2PEIA 3CXCO 1N8RQ 2VLOA 1GXHA 1VQLP 3CCQP 2FVAA 2EHTA 3CCLP 2L22A 3CCRP 1IMPA 1VQ6P 1QRJA 1VQ5P 3G6EP 2OTLP 1D1DA 1GPJA 4MRTC 2M5RA 4H2XC 1AUMA 3G29A 4GR2A 2LOLA 2L9FA 1Q86Q 2KW2A 2KGDA 4H2WC 1QVGO 1M1KQ 3G1GA 2AFDA 4BPFA 4F37A 2GZEA 2EIAA 2Z45A 3NTEA 1L0HA 3CCJP 1S72P 2OARA 1VQKP 4IZ6A 2CQ8A 3G4SP 1RO0A 1DNYA 2JYGA 2NO8A 2XXMA 4XFYA 2LKIA 1K30A 3EJDA 3GKLC 2FVFA 2BHVA 1K9MQ 2JAZA 2GZFA 5HGNA 2E1MA 5HGMA 2MVVA 3DTJA 3CC7P 2FVEA 2AFEA 2VLNA 3GZLA 4NEOA 2N6ZA 4PH1A 1RO2A 5F2OA 2QA4P 4U0AA 4GR6A 2VLPA 3DS2A 2L4BA 1VHNA 3LMOA 2LL8A 2KR5A 2LIWA 2KOSA 3RG6C 1M90Q 2CWOA 4U0BA 3B5IA 1YJNP 1RNIA 3G21A 1CEIA 2GDYA 2FQ0A 2KOPA 2ONTA 2PEQA 2VSQA 3CE7A 3EJBA 2VLQA 2BUOA 3G0VA 1YJ9P 1L0IA 3B4QA 3G71P 3GJNA 4XFZA 2K5XA 3H4EA 3CCUP 1IMQA 1YHQP 1VQMP 1VQPP 2KG9A 1YI2P 2PNGA 1EMVA 1Q7YQ 5EJDA 2OTJP 3G28A 2K94A 2FAEA 1OR5A 2N6YA 1DV5A 3CCMP 2FQ1A 1YIJP 4PXHB 2KG6A 2LTEA 4QNBA 2JYLA 2PEJA 1FR2A 1A8OA 2PENA 2FADA 2GDWA 1KQSO 1VQ7P 1UNKA 3I55P 5CZDB 2AF8A 2FQ2A 3DS5A 4BPGA 2N5IA 2Z44A 3Q20A 2ERHA 5EW5E 3MGEA 2LPKA 3CPWO 1Z6MA 1BAJA 5HGOA 1M6EX 5JPAA 2PY8A 3E2DA 2GZGA 2LIUA 3DS3A 3H0DA 2DNWA 2MD9A 1VQNP 2MF4A 2XZ1C 3U43A 2QEXP 2K93A 3EJEA 3CD6P 7CEIA 1HY8A 2QNWA 4PH0A 2K2QA 2N50A 2PEKA 1KD1Q 3DPHA 1Q81Q 1VQOP 1YJWP 2PEOA 4H2YC 1F80D 2K0DX 3CCSP 3HYBA 1Q82Q 2EFJA 4HKGA 5BS1A 1MZ8A 5KP7B 5BS2A 1ZMBA 4U0DA 2KWLA 2M8LA 3G1IA 3LRYA 1EIAA 1T8KA 2K0XA 2ROQA 3WBHA 1JJ2O 5F2NA 2GZIA 5HV8A 3CMAP 4U0EA 4BPHA 3HZQA 2KODA 1ZNVA 1X3OA 3CC4P 1E0HA 2M8PA 2JQ4A 2GYKA 1A43A 4M0IA 3G26A 2Z46A 3CCVP 3I56P 1EOQA 2JU1A 4IPYA 5KP6B 1UJZA 2XT1A 2XZ0D 3M1MA 2K0YA 1NQ4A 2CGQA 2XV6A 2LF4A 2X2BA 1M6NA 4WYMA 1E6JP 5HGLA 1W2BO 2KORA 2L0QA 2P9XA 1M74A 2AVAA 2PEMA 3DS1A 1VQ4P 1VQ8P 1YITP 2FHSC 2K92A 2N5HA 1BXIA 2M8NA 2KG8A 2LMLA 1K73Q 3VRLC
chains in the Genus database with same CATH topology
1CEIA 1IMQA 2GZEA 1ZNVA 4QKOA 3U43A 4F37A 2VLPA 1E0HA 2JAZA 7CEIA 2GZFA 2GYKA 2ERHA 2GZJA 5EW5E 1AYIA 2VLQA 2VLOA 4UHPB 1UJZA 1EMVA 1GXHA 1FR2A 2JBGA 1BXIA 1GXGA 2NO8A 2VLNA 2GZGA 3GJNA 2K0DX 2JB0A 2K5XA 2GZIA 1MZ8A 3GKLC 1UNKA 2WPTA 1IMPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CEI A;  1IMQ A;  2GZE A;  1ZNV A;  4QKO A;  3U43 A;  4F37 A;  2VLP A;  1E0H A;  2JAZ A;  7CEI A;  2GZF A;  2GYK A;  2ERH A;  2GZJ A;  5EW5 E;  1AYI A;  2VLQ A;  2VLO A;  4UHP B;  1UJZ A;  1EMV A;  1GXH A;  1FR2 A;  2JBG A;  1BXI A;  1GXG A;  2NO8 A;  2VLN A;  2GZG A;  3GJN A;  2K0D X;  2JB0 A;  2K5X A;  2GZI A;  1MZ8 A;  3GKL C;  1UNK A;  2WPT A;  1IMP A; 
#chains in the Genus database with same CATH topology
 5DCK A;  3CCE P;  2GZJ A;  2JGP A;  1AYI A;  2CNR A;  4UHP B;  1QVF O;  2DGY A;  2KGA A;  4R0M A;  2L6E A;  1AF8 A;  1K8A Q;  1VKU A;  2MR8 A;  1IUQ A;  2N98 A;  3NY7 B;  4PWV B;  4CA3 A;  4COC A;  2JBG A;  5I4T G;  1NJI Q;  2MVU A;  4XFX A;  1KC8 Q;  4U0F A;  3P05 A;  5F2K A;  1KLP A;  2GDX A;  1HQB A;  4QKO A;  4DG9 A;  3CC2 P;  4U0C A;  2KGC A;  2JO0 A;  2JU2 A;  2KOQ A;  1ACP A;  3DS0 A;  2EG5 A;  2KOO A;  3DS4 A;  3GZM A;  3CME P;  4XRO A;  1VQ9 P;  2MY5 A;  1GXG A;  4COP A;  4XRQ A;  2JB0 A;  2WPT A;  2CG5 B;  2FAC A;  2EHS A;  2KGE A;  3H47 A;  5KP8 B;  3RG2 A;  3OW2 O;  5HVC A;  2MR7 A;  2PEI A;  3CXC O;  1N8R Q;  2VLO A;  1GXH A;  1VQL P;  3CCQ P;  2FVA A;  2EHT A;  3CCL P;  2L22 A;  3CCR P;  1IMP A;  1VQ6 P;  1QRJ A;  1VQ5 P;  3G6E P;  2OTL P;  1D1D A;  1GPJ A;  4MRT C;  2M5R A;  4H2X C;  1AUM A;  3G29 A;  4GR2 A;  2LOL A;  2L9F A;  1Q86 Q;  2KW2 A;  2KGD A;  4H2W C;  1QVG O;  1M1K Q;  3G1G A;  2AFD A;  4BPF A;  4F37 A;  2GZE A;  2EIA A;  2Z45 A;  3NTE A;  1L0H A;  3CCJ P;  1S72 P;  2OAR A;  1VQK P;  4IZ6 A;  2CQ8 A;  3G4S P;  1RO0 A;  1DNY A;  2JYG A;  2NO8 A;  2XXM A;  4XFY A;  2LKI A;  1K30 A;  3EJD A;  3GKL C;  2FVF A;  2BHV A;  1K9M Q;  2JAZ A;  2GZF A;  5HGN A;  2E1M A;  5HGM A;  2MVV A;  3DTJ A;  3CC7 P;  2FVE A;  2AFE A;  2VLN A;  3GZL A;  4NEO A;  2N6Z A;  4PH1 A;  1RO2 A;  5F2O A;  2QA4 P;  4U0A A;  4GR6 A;  2VLP A;  3DS2 A;  2L4B A;  1VHN A;  3LMO A;  2LL8 A;  2KR5 A;  2LIW A;  2KOS A;  3RG6 C;  1M90 Q;  2CWO A;  4U0B A;  3B5I A;  1YJN P;  1RNI A;  3G21 A;  1CEI A;  2GDY A;  2FQ0 A;  2KOP A;  2ONT A;  2PEQ A;  2VSQ A;  3CE7 A;  3EJB A;  2VLQ A;  2BUO A;  3G0V A;  1YJ9 P;  1L0I A;  3B4Q A;  3G71 P;  3GJN A;  4XFZ A;  2K5X A;  3H4E A;  3CCU P;  1IMQ A;  1YHQ P;  1VQM P;  1VQP P;  2KG9 A;  1YI2 P;  2PNG A;  1EMV A;  1Q7Y Q;  5EJD A;  2OTJ P;  3G28 A;  2K94 A;  2FAE A;  1OR5 A;  2N6Y A;  1DV5 A;  3CCM P;  2FQ1 A;  1YIJ P;  4PXH B;  2KG6 A;  2LTE A;  4QNB A;  2JYL A;  2PEJ A;  1FR2 A;  1A8O A;  2PEN A;  2FAD A;  2GDW A;  1KQS O;  1VQ7 P;  1UNK A;  3I55 P;  5CZD B;  2AF8 A;  2FQ2 A;  3DS5 A;  4BPG A;  2N5I A;  2Z44 A;  3Q20 A;  2ERH A;  5EW5 E;  3MGE A;  2LPK A;  3CPW O;  1Z6M A;  1BAJ A;  5HGO A;  1M6E X;  5JPA A;  2PY8 A;  3E2D A;  2GZG A;  2LIU A;  3DS3 A;  3H0D A;  2DNW A;  2MD9 A;  1VQN P;  2MF4 A;  2XZ1 C;  3U43 A;  2QEX P;  2K93 A;  3EJE A;  3CD6 P;  7CEI A;  1HY8 A;  2QNW A;  4PH0 A;  2K2Q A;  2N50 A;  2PEK A;  1KD1 Q;  3DPH A;  1Q81 Q;  1VQO P;  1YJW P;  2PEO A;  4H2Y C;  1F80 D;  2K0D X;  3CCS P;  3HYB A;  1Q82 Q;  2EFJ A;  4HKG A;  5BS1 A;  1MZ8 A;  5KP7 B;  5BS2 A;  1ZMB A;  4U0D A;  2KWL A;  2M8L A;  3G1I A;  3LRY A;  1EIA A;  1T8K A;  2K0X A;  2ROQ A;  3WBH A;  1JJ2 O;  5F2N A;  2GZI A;  5HV8 A;  3CMA P;  4U0E A;  4BPH A;  3HZQ A;  2KOD A;  1ZNV A;  1X3O A;  3CC4 P;  1E0H A;  2M8P A;  2JQ4 A;  2GYK A;  1A43 A;  4M0I A;  3G26 A;  2Z46 A;  3CCV P;  3I56 P;  1EOQ A;  2JU1 A;  4IPY A;  5KP6 B;  1UJZ A;  2XT1 A;  2XZ0 D;  3M1M A;  2K0Y A;  1NQ4 A;  2CGQ A;  2XV6 A;  2LF4 A;  2X2B A;  1M6N A;  4WYM A;  1E6J P;  5HGL A;  1W2B O;  2KOR A;  2L0Q A;  2P9X A;  1M74 A;  2AVA A;  2PEM A;  3DS1 A;  1VQ4 P;  1VQ8 P;  1YIT P;  2FHS C;  2K92 A;  2N5H A;  1BXI A;  2M8N A;  2KG8 A;  2LML A;  1K73 Q;  3VRL C; 
#chains in the Genus database with same CATH homology
 1CEI A;  1IMQ A;  2GZE A;  1ZNV A;  4QKO A;  3U43 A;  4F37 A;  2VLP A;  1E0H A;  2JAZ A;  7CEI A;  2GZF A;  2GYK A;  2ERH A;  2GZJ A;  5EW5 E;  1AYI A;  2VLQ A;  2VLO A;  4UHP B;  1UJZ A;  1EMV A;  1GXH A;  1FR2 A;  2JBG A;  1BXI A;  1GXG A;  2NO8 A;  2VLN A;  2GZG A;  3GJN A;  2K0D X;  2JB0 A;  2K5X A;  2GZI A;  1MZ8 A;  3GKL C;  1UNK A;  2WPT A;  1IMP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...