2WPTA

The crystal structure of im2 in complex with colicin e9 dnase
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
82
structure length
82
Chain Sequence
KHSISDYTEAEFLEFVKKIARAEGATECDDNKLVREFERLTEHPDGSDLIYYPRDDREDSPEGIVKEIKEWRAANGKSGFKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structural and Energetic Basis for High Selectivity in a High-Affinity Protein-Protein Interaction.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Immune system
molecule keywords COLICIN-E2 IMMUNITY PROTEIN
total genus 31
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2009-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01320 Colicin_Pyocin Colicin immunity protein / pyocin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.20 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Colicin E immunity protein 2wptA00
2JBGA 1BXIA 2GZEA 1GXHA 2GZJA 1CEIA 2ERHA 4F37A 1FR2A 2VLQA 3GJNA 2GZIA 1AYIA 1E0HA 2GZGA 1UJZA 2VLOA 5EW5E 1IMQA 1UNKA 2K5XA 2VLPA 1IMPA 1GXGA 2WPTA 3GKLC 7CEIA 4UHPB 2NO8A 2GYKA 2JB0A 2GZFA 1MZ8A 2JAZA 1EMVA 4QKOA 1ZNVA 2VLNA 3U43A 2K0DX
chains in the Genus database with same CATH superfamily
3CCRP 2EHSA 2N5IA 4U0AA 3CCJP 2KORA 1VQKP 2MF4A 5F2KA 3NTEA 3CXCO 2PNGA 1UJZA 3CCQP 4XFZA 2CQ8A 1L0IA 5F2OA 5HVCA 5I4TG 4H2YC 2KGDA 3CC7P 2L0QA 2GDYA 4U0EA 2XV6A 4PWVB 1K73Q 1AUMA 2K0DX 2KOSA 1VQNP 3WBHA 3G28A 1JJ2O 2P9XA 1AYIA 2K94A 3G26A 1KD1Q 2KOPA 4U0CA 1M6EX 1EMVA 3CCUP 4PH1A 2PEQA 2M5RA 2ERHA 1BAJA 2LIUA 2ROQA 5EW5E 3OW2O 5HGMA 2PEOA 3DS5A 3GZLA 2KGEA 2PENA 1ZNVA 3LRYA 1F80D 2K92A 3CD6P 2M8NA 2GZEA 2PEIA 2GDWA 3G1GA 2GZJA 1CEIA 4F37A 3DTJA 1YHQP 2LMLA 2ONTA 1YJNP 2MD9A 1N8RQ 7CEIA 3G0VA 1VQ4P 3EJDA 1VQ7P 2JQ4A 3CCEP 2FVEA 2PEMA 2KWLA 2L9FA 4U0FA 2KG9A 2VLQA 2N5HA 3DPHA 2JGPA 2Z44A 3G6EP 1GXGA 1D1DA 1ZMBA 2NO8A 1RNIA 1VHNA 2LF4A 3DS1A 3G4SP 1HQBA 4IPYA 2XXMA 3U43A 2JBGA 4DG9A 2XZ0D 2JU2A 2KGCA 4H2XC 2Z46A 2CG5B 4IZ6A 1VQ5P 1YJWP 1Z6MA 3G71P 2CWOA 2MVVA 2KOOA 2KG8A 2XZ1C 2K5XA 2JU1A 2DGYA 4GR6A 2JB0A 1VQ8P 2K93A 2K0YA 1NQ4A 1KC8Q 3LMOA 1VQOP 1M74A 2L6EA 1IUQA 2GZIA 1DV5A 3H47A 5HGNA 1YJ9P 2L22A 3NY7B 2WPTA 2BUOA 1K9MQ 2OARA 2Z45A 4XROA 3DS2A 2GZFA 2N98A 1MZ8A 1E6JP 2BHVA 2MVUA 4COPA 1VQ6P 2LPKA 1VQMP 2FQ0A 2EFJA 2FADA 4M0IA 2FVFA 1Q7YQ 4PH0A 2AF8A 3DS3A 3HYBA 1Q86Q 3RG2A 1VKUA 2N50A 1Q81Q 2K2QA 1A43A 5BS2A 2FQ2A 1A8OA 2EIAA 1HY8A 3I56P 4R0MA 2EG5A 2KODA 2QNWA 4H2WC 3I55P 2GZGA 2VLOA 4PXHB 1W2BO 3CC4P 5HV8A 2KW2A 2PEKA 2QA4P 3VRLC 1GPJA 3Q20A 2JO0A 3EJBA 2FHSC 1X3OA 2FAEA 4U0DA 2AVAA 2E1MA 3CPWO 1VQ9P 2FQ1A 4COCA 5F2NA 2LIWA 2VSQA 1K8AQ 5CZDB 1M1KQ 1EIAA 4HKGA 2JAZA 2EHTA 2LKIA 4GR2A 5EJDA 2XT1A 3CMAP 4XFYA 1QVFO 2PY8A 1Q82Q 2PEJA 3CMEP 4BPGA 2X2BA 3B4QA 2K0XA 2CNRA 3CCMP 1EOQA 2KR5A 2KG6A 2L4BA 2KOQA 4WYMA 3E2DA 1T8KA 2MR8A 3G29A 1E0HA 4XFXA 4MRTC 4U0BA 1DNYA 4BPFA 1IMQA 4CA3A 5KP8B 2N6ZA 2M8PA 4UHPB 1ACPA 1NJIQ 2VLNA 2CGQA 3CE7A 3P05A 5HGLA 4XRQA 2LTEA 1QVGO 3GJNA 2QEXP 2JYLA 3CCVP 1UNKA 5KP6B 1IMPA 2OTJP 2MY5A 1RO0A 3GKLC 5HGOA 2AFEA 5JPAA 1YITP 5BS1A 1YI2P 1YIJP 3G1IA 3RG6C 1AF8A 3MGEA 2N6YA 4QKOA 4QNBA 1RO2A 2AFDA 1K30A 1L0HA 1FR2A 1VQLP 1OR5A 3CC2P 2VLPA 3DS0A 2MR7A 3CCLP 5KP7B 3EJEA 3H0DA 2M8LA 1M6NA 2JYGA 3M1MA 3H4EA 3GZMA 1BXIA 2KGAA 3G21A 1VQPP 2LL8A 2DNWA 1GXHA 2FVAA 2FACA 2LOLA 3HZQA 1S72P 1KLPA 3CCSP 3DS4A 4BPHA 3B5IA 2GYKA 1KQSO 4NEOA 5DCKA 2GDXA 1QRJA 1M90Q 2OTLP
chains in the Genus database with same CATH topology
2JBGA 1BXIA 2GZEA 1GXHA 2GZJA 1CEIA 2ERHA 4F37A 1FR2A 2VLQA 3GJNA 2GZIA 1AYIA 1E0HA 2GZGA 1UJZA 2VLOA 5EW5E 1IMQA 1UNKA 2K5XA 2VLPA 1IMPA 1GXGA 2WPTA 3GKLC 7CEIA 4UHPB 2NO8A 2GYKA 2JB0A 2GZFA 1MZ8A 2JAZA 1EMVA 4QKOA 1ZNVA 2VLNA 3U43A 2K0DX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JBG A;  1BXI A;  2GZE A;  1GXH A;  2GZJ A;  1CEI A;  2ERH A;  4F37 A;  1FR2 A;  2VLQ A;  3GJN A;  2GZI A;  1AYI A;  1E0H A;  2GZG A;  1UJZ A;  2VLO A;  5EW5 E;  1IMQ A;  1UNK A;  2K5X A;  2VLP A;  1IMP A;  1GXG A;  2WPT A;  3GKL C;  7CEI A;  4UHP B;  2NO8 A;  2GYK A;  2JB0 A;  2GZF A;  1MZ8 A;  2JAZ A;  1EMV A;  4QKO A;  1ZNV A;  2VLN A;  3U43 A;  2K0D X; 
#chains in the Genus database with same CATH topology
 3CCR P;  2EHS A;  2N5I A;  4U0A A;  3CCJ P;  2KOR A;  1VQK P;  2MF4 A;  5F2K A;  3NTE A;  3CXC O;  2PNG A;  1UJZ A;  3CCQ P;  4XFZ A;  2CQ8 A;  1L0I A;  5F2O A;  5HVC A;  5I4T G;  4H2Y C;  2KGD A;  3CC7 P;  2L0Q A;  2GDY A;  4U0E A;  2XV6 A;  4PWV B;  1K73 Q;  1AUM A;  2K0D X;  2KOS A;  1VQN P;  3WBH A;  3G28 A;  1JJ2 O;  2P9X A;  1AYI A;  2K94 A;  3G26 A;  1KD1 Q;  2KOP A;  4U0C A;  1M6E X;  1EMV A;  3CCU P;  4PH1 A;  2PEQ A;  2M5R A;  2ERH A;  1BAJ A;  2LIU A;  2ROQ A;  5EW5 E;  3OW2 O;  5HGM A;  2PEO A;  3DS5 A;  3GZL A;  2KGE A;  2PEN A;  1ZNV A;  3LRY A;  1F80 D;  2K92 A;  3CD6 P;  2M8N A;  2GZE A;  2PEI A;  2GDW A;  3G1G A;  2GZJ A;  1CEI A;  4F37 A;  3DTJ A;  1YHQ P;  2LML A;  2ONT A;  1YJN P;  2MD9 A;  1N8R Q;  7CEI A;  3G0V A;  1VQ4 P;  3EJD A;  1VQ7 P;  2JQ4 A;  3CCE P;  2FVE A;  2PEM A;  2KWL A;  2L9F A;  4U0F A;  2KG9 A;  2VLQ A;  2N5H A;  3DPH A;  2JGP A;  2Z44 A;  3G6E P;  1GXG A;  1D1D A;  1ZMB A;  2NO8 A;  1RNI A;  1VHN A;  2LF4 A;  3DS1 A;  3G4S P;  1HQB A;  4IPY A;  2XXM A;  3U43 A;  2JBG A;  4DG9 A;  2XZ0 D;  2JU2 A;  2KGC A;  4H2X C;  2Z46 A;  2CG5 B;  4IZ6 A;  1VQ5 P;  1YJW P;  1Z6M A;  3G71 P;  2CWO A;  2MVV A;  2KOO A;  2KG8 A;  2XZ1 C;  2K5X A;  2JU1 A;  2DGY A;  4GR6 A;  2JB0 A;  1VQ8 P;  2K93 A;  2K0Y A;  1NQ4 A;  1KC8 Q;  3LMO A;  1VQO P;  1M74 A;  2L6E A;  1IUQ A;  2GZI A;  1DV5 A;  3H47 A;  5HGN A;  1YJ9 P;  2L22 A;  3NY7 B;  2WPT A;  2BUO A;  1K9M Q;  2OAR A;  2Z45 A;  4XRO A;  3DS2 A;  2GZF A;  2N98 A;  1MZ8 A;  1E6J P;  2BHV A;  2MVU A;  4COP A;  1VQ6 P;  2LPK A;  1VQM P;  2FQ0 A;  2EFJ A;  2FAD A;  4M0I A;  2FVF A;  1Q7Y Q;  4PH0 A;  2AF8 A;  3DS3 A;  3HYB A;  1Q86 Q;  3RG2 A;  1VKU A;  2N50 A;  1Q81 Q;  2K2Q A;  1A43 A;  5BS2 A;  2FQ2 A;  1A8O A;  2EIA A;  1HY8 A;  3I56 P;  4R0M A;  2EG5 A;  2KOD A;  2QNW A;  4H2W C;  3I55 P;  2GZG A;  2VLO A;  4PXH B;  1W2B O;  3CC4 P;  5HV8 A;  2KW2 A;  2PEK A;  2QA4 P;  3VRL C;  1GPJ A;  3Q20 A;  2JO0 A;  3EJB A;  2FHS C;  1X3O A;  2FAE A;  4U0D A;  2AVA A;  2E1M A;  3CPW O;  1VQ9 P;  2FQ1 A;  4COC A;  5F2N A;  2LIW A;  2VSQ A;  1K8A Q;  5CZD B;  1M1K Q;  1EIA A;  4HKG A;  2JAZ A;  2EHT A;  2LKI A;  4GR2 A;  5EJD A;  2XT1 A;  3CMA P;  4XFY A;  1QVF O;  2PY8 A;  1Q82 Q;  2PEJ A;  3CME P;  4BPG A;  2X2B A;  3B4Q A;  2K0X A;  2CNR A;  3CCM P;  1EOQ A;  2KR5 A;  2KG6 A;  2L4B A;  2KOQ A;  4WYM A;  3E2D A;  1T8K A;  2MR8 A;  3G29 A;  1E0H A;  4XFX A;  4MRT C;  4U0B A;  1DNY A;  4BPF A;  1IMQ A;  4CA3 A;  5KP8 B;  2N6Z A;  2M8P A;  4UHP B;  1ACP A;  1NJI Q;  2VLN A;  2CGQ A;  3CE7 A;  3P05 A;  5HGL A;  4XRQ A;  2LTE A;  1QVG O;  3GJN A;  2QEX P;  2JYL A;  3CCV P;  1UNK A;  5KP6 B;  1IMP A;  2OTJ P;  2MY5 A;  1RO0 A;  3GKL C;  5HGO A;  2AFE A;  5JPA A;  1YIT P;  5BS1 A;  1YI2 P;  1YIJ P;  3G1I A;  3RG6 C;  1AF8 A;  3MGE A;  2N6Y A;  4QKO A;  4QNB A;  1RO2 A;  2AFD A;  1K30 A;  1L0H A;  1FR2 A;  1VQL P;  1OR5 A;  3CC2 P;  2VLP A;  3DS0 A;  2MR7 A;  3CCL P;  5KP7 B;  3EJE A;  3H0D A;  2M8L A;  1M6N A;  2JYG A;  3M1M A;  3H4E A;  3GZM A;  1BXI A;  2KGA A;  3G21 A;  1VQP P;  2LL8 A;  2DNW A;  1GXH A;  2FVA A;  2FAC A;  2LOL A;  3HZQ A;  1S72 P;  1KLP A;  3CCS P;  3DS4 A;  4BPH A;  3B5I A;  2GYK A;  1KQS O;  4NEO A;  5DCK A;  2GDX A;  1QRJ A;  1M90 Q;  2OTL P; 
#chains in the Genus database with same CATH homology
 2JBG A;  1BXI A;  2GZE A;  1GXH A;  2GZJ A;  1CEI A;  2ERH A;  4F37 A;  1FR2 A;  2VLQ A;  3GJN A;  2GZI A;  1AYI A;  1E0H A;  2GZG A;  1UJZ A;  2VLO A;  5EW5 E;  1IMQ A;  1UNK A;  2K5X A;  2VLP A;  1IMP A;  1GXG A;  2WPT A;  3GKL C;  7CEI A;  4UHP B;  2NO8 A;  2GYK A;  2JB0 A;  2GZF A;  1MZ8 A;  2JAZ A;  1EMV A;  4QKO A;  1ZNV A;  2VLN A;  3U43 A;  2K0D X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...