2WPTA

The crystal structure of im2 in complex with colicin e9 dnase
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
82
structure length
82
Chain Sequence
KHSISDYTEAEFLEFVKKIARAEGATECDDNKLVREFERLTEHPDGSDLIYYPRDDREDSPEGIVKEIKEWRAANGKSGFKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structural and Energetic Basis for High Selectivity in a High-Affinity Protein-Protein Interaction.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Immune system
molecule keywords COLICIN-E2 IMMUNITY PROTEIN
total genus 31
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2009-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01320 Colicin_Pyocin Colicin immunity protein / pyocin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.20 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Colicin E immunity protein 2wptA00
7CEIA 3GJNA 2GYKA 2VLOA 1IMPA 1EMVA 1CEIA 1UJZA 3U43A 2GZFA 2VLPA 1MZ8A 1UNKA 2K5XA 5EW5E 1BXIA 4QKOA 1AYIA 2JBGA 2GZJA 1IMQA 2GZIA 2GZEA 1FR2A 2JB0A 1GXGA 1ZNVA 4F37A 3GKLC 2GZGA 1E0HA 2ERHA 2K0DX 4UHPB 2NO8A 2JAZA 1GXHA 2VLNA 2WPTA 2VLQA
chains in the Genus database with same CATH superfamily
3DS3A 4XFXA 5F2NA 2VLOA 1UJZA 1VQMP 2GZFA 1W2BO 1JJ2O 1D1DA 5HGLA 2GZIA 3CCLP 1ZNVA 2XV6A 1EIAA 2QA4P 2KORA 1YJNP 2LOLA 4U0CA 4GR2A 2M8PA 3RG6C 2E1MA 3DS4A 3CMEP 1EOQA 3HYBA 3EJBA 2M8LA 2PY8A 2K93A 1VQNP 2KGAA 5EW5E 4U0EA 4H2WC 5HGOA 1YITP 3DS5A 3CMAP 3VRLC 2QEXP 3DPHA 1M6EX 1L0HA 1S72P 3NY7B 4COPA 3CXCO 4MRTC 2N6ZA 3CCSP 1KC8Q 1MZ8A 1VQ4P 1RO2A 3CPWO 2LTEA 1N8RQ 1L0IA 1A43A 2CG5B 1Q82Q 2Z45A 1K9MQ 2AFDA 4COCA 2K92A 2MF4A 3WBHA 2GDYA 2VLQA 4U0FA 2KODA 1YI2P 4IZ6A 1VQPP 2N5IA 2KGCA 1VQ5P 1ACPA 1K30A 5HV8A 1VQLP 2FAEA 3CCRP 4M0IA 2KR5A 2PEQA 3GJNA 2PNGA 5KP6B 3DS0A 3Q20A 4DG9A 1KD1Q 1AUMA 1VQ8P 2FACA 3G0VA 5JPAA 3DTJA 2CGQA 2EHTA 2JU2A 2JU1A 2M8NA 4PH0A 2K0YA 4XFYA 2LPKA 5HGMA 2L0QA 2L4BA 1AYIA 2PEOA 3E2DA 3CC2P 2MVUA 1VQKP 5HGNA 4R0MA 2EFJA 3G6EP 1E0HA 2ERHA 2XXMA 2LF4A 1RO0A 2KW2A 1OR5A 2KGDA 2VLNA 2MY5A 2L6EA 2MR8A 3U43A 2VLPA 1VKUA 2LIWA 2PENA 4NEOA 2KOSA 1NQ4A 1VQ9P 2M5RA 4UHPB 1GXHA 1QRJA 3DS1A 2KG9A 3G4SP 2L22A 2PEMA 3MGEA 1K73Q 5KP8B 4U0BA 2K5XA 3RG2A 2K0XA 4QKOA 1QVFO 2FQ2A 2GZGA 2KOPA 5HVCA 2N6YA 2FVEA 2OTLP 2EHSA 4BPFA 1YJ9P 2N5HA 2P9XA 4IPYA 2ROQA 1IMQA 1Q7YQ 2JB0A 2PEIA 1GXGA 1VQ7P 4H2XC 3GKLC 2BUOA 1M90Q 5F2KA 2XZ0D 3G29A 5EJDA 2EIAA 3M1MA 1T8KA 3EJEA 2JQ4A 4PH1A 2KG8A 4HKGA 1ZMBA 3CC4P 3H0DA 1VQOP 1Z6MA 3CCMP 3CCJP 5CZDB 3G1IA 2JYGA 1YJWP 2FHSC 2CWOA 2ONTA 3GZLA 4H2YC 1E6JP 4BPHA 2X2BA 3P05A 2OTJP 1KLPA 4F37A 2CQ8A 3CCQP 1QVGO 1RNIA 2FVFA 2LKIA 3CC7P 4XFZA 4XRQA 3I56P 2WPTA 5BS2A 7CEIA 3LMOA 2Z46A 3B4QA 1F80D 1Q81Q 2Z44A 5KP7B 1NJIQ 2N50A 4CA3A 5BS1A 1VHNA 2FVAA 3CE7A 3G71P 5F2OA 1HY8A 1YHQP 2JGPA 3EJDA 1M74A 3G21A 1CEIA 3DS2A 3B5IA 1VQ6P 2L9FA 2XZ1C 3LRYA 1FR2A 4WYMA 2MD9A 2VSQA 2MVVA 1GPJA 1M1KQ 2JYLA 2GDXA 1A8OA 3GZMA 4U0AA 2KOOA 2LL8A 2GDWA 1DV5A 2K94A 2K2QA 2XT1A 2FADA 2PEJA 3H47A 2EG5A 3G26A 1DNYA 2LIUA 3NTEA 1KQSO 2K0DX 5I4TG 2QNWA 2FQ1A 2KOQA 2DNWA 1Q86Q 3I55P 2KWLA 2MR7A 3CCVP 2AVAA 2FQ0A 2CNRA 2JO0A 1EMVA 4U0DA 3CCUP 1YIJP 1UNKA 3CD6P 2BHVA 2PEKA 1HQBA 2GZJA 1AF8A 1IUQA 1BAJA 3HZQA 2AFEA 1M6NA 4PWVB 3OW2O 2OARA 2LMLA 2KGEA 4BPGA 3H4EA 1X3OA 2GYKA 4PXHB 1IMPA 2AF8A 4GR6A 2N98A 1BXIA 4XROA 2JBGA 2DGYA 2GZEA 5DCKA 2KG6A 3G1GA 1K8AQ 3CCEP 2NO8A 2JAZA 3G28A 4QNBA
chains in the Genus database with same CATH topology
7CEIA 3GJNA 2GYKA 2VLOA 1IMPA 1EMVA 1CEIA 1UJZA 3U43A 2GZFA 2VLPA 1MZ8A 1UNKA 2K5XA 5EW5E 1BXIA 4QKOA 1AYIA 2JBGA 2GZJA 1IMQA 2GZIA 2GZEA 1FR2A 2JB0A 1GXGA 1ZNVA 4F37A 3GKLC 2GZGA 1E0HA 2ERHA 2K0DX 4UHPB 2NO8A 2JAZA 1GXHA 2VLNA 2WPTA 2VLQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 7CEI A;  3GJN A;  2GYK A;  2VLO A;  1IMP A;  1EMV A;  1CEI A;  1UJZ A;  3U43 A;  2GZF A;  2VLP A;  1MZ8 A;  1UNK A;  2K5X A;  5EW5 E;  1BXI A;  4QKO A;  1AYI A;  2JBG A;  2GZJ A;  1IMQ A;  2GZI A;  2GZE A;  1FR2 A;  2JB0 A;  1GXG A;  1ZNV A;  4F37 A;  3GKL C;  2GZG A;  1E0H A;  2ERH A;  2K0D X;  4UHP B;  2NO8 A;  2JAZ A;  1GXH A;  2VLN A;  2WPT A;  2VLQ A; 
#chains in the Genus database with same CATH topology
 3DS3 A;  4XFX A;  5F2N A;  2VLO A;  1UJZ A;  1VQM P;  2GZF A;  1W2B O;  1JJ2 O;  1D1D A;  5HGL A;  2GZI A;  3CCL P;  1ZNV A;  2XV6 A;  1EIA A;  2QA4 P;  2KOR A;  1YJN P;  2LOL A;  4U0C A;  4GR2 A;  2M8P A;  3RG6 C;  2E1M A;  3DS4 A;  3CME P;  1EOQ A;  3HYB A;  3EJB A;  2M8L A;  2PY8 A;  2K93 A;  1VQN P;  2KGA A;  5EW5 E;  4U0E A;  4H2W C;  5HGO A;  1YIT P;  3DS5 A;  3CMA P;  3VRL C;  2QEX P;  3DPH A;  1M6E X;  1L0H A;  1S72 P;  3NY7 B;  4COP A;  3CXC O;  4MRT C;  2N6Z A;  3CCS P;  1KC8 Q;  1MZ8 A;  1VQ4 P;  1RO2 A;  3CPW O;  2LTE A;  1N8R Q;  1L0I A;  1A43 A;  2CG5 B;  1Q82 Q;  2Z45 A;  1K9M Q;  2AFD A;  4COC A;  2K92 A;  2MF4 A;  3WBH A;  2GDY A;  2VLQ A;  4U0F A;  2KOD A;  1YI2 P;  4IZ6 A;  1VQP P;  2N5I A;  2KGC A;  1VQ5 P;  1ACP A;  1K30 A;  5HV8 A;  1VQL P;  2FAE A;  3CCR P;  4M0I A;  2KR5 A;  2PEQ A;  3GJN A;  2PNG A;  5KP6 B;  3DS0 A;  3Q20 A;  4DG9 A;  1KD1 Q;  1AUM A;  1VQ8 P;  2FAC A;  3G0V A;  5JPA A;  3DTJ A;  2CGQ A;  2EHT A;  2JU2 A;  2JU1 A;  2M8N A;  4PH0 A;  2K0Y A;  4XFY A;  2LPK A;  5HGM A;  2L0Q A;  2L4B A;  1AYI A;  2PEO A;  3E2D A;  3CC2 P;  2MVU A;  1VQK P;  5HGN A;  4R0M A;  2EFJ A;  3G6E P;  1E0H A;  2ERH A;  2XXM A;  2LF4 A;  1RO0 A;  2KW2 A;  1OR5 A;  2KGD A;  2VLN A;  2MY5 A;  2L6E A;  2MR8 A;  3U43 A;  2VLP A;  1VKU A;  2LIW A;  2PEN A;  4NEO A;  2KOS A;  1NQ4 A;  1VQ9 P;  2M5R A;  4UHP B;  1GXH A;  1QRJ A;  3DS1 A;  2KG9 A;  3G4S P;  2L22 A;  2PEM A;  3MGE A;  1K73 Q;  5KP8 B;  4U0B A;  2K5X A;  3RG2 A;  2K0X A;  4QKO A;  1QVF O;  2FQ2 A;  2GZG A;  2KOP A;  5HVC A;  2N6Y A;  2FVE A;  2OTL P;  2EHS A;  4BPF A;  1YJ9 P;  2N5H A;  2P9X A;  4IPY A;  2ROQ A;  1IMQ A;  1Q7Y Q;  2JB0 A;  2PEI A;  1GXG A;  1VQ7 P;  4H2X C;  3GKL C;  2BUO A;  1M90 Q;  5F2K A;  2XZ0 D;  3G29 A;  5EJD A;  2EIA A;  3M1M A;  1T8K A;  3EJE A;  2JQ4 A;  4PH1 A;  2KG8 A;  4HKG A;  1ZMB A;  3CC4 P;  3H0D A;  1VQO P;  1Z6M A;  3CCM P;  3CCJ P;  5CZD B;  3G1I A;  2JYG A;  1YJW P;  2FHS C;  2CWO A;  2ONT A;  3GZL A;  4H2Y C;  1E6J P;  4BPH A;  2X2B A;  3P05 A;  2OTJ P;  1KLP A;  4F37 A;  2CQ8 A;  3CCQ P;  1QVG O;  1RNI A;  2FVF A;  2LKI A;  3CC7 P;  4XFZ A;  4XRQ A;  3I56 P;  2WPT A;  5BS2 A;  7CEI A;  3LMO A;  2Z46 A;  3B4Q A;  1F80 D;  1Q81 Q;  2Z44 A;  5KP7 B;  1NJI Q;  2N50 A;  4CA3 A;  5BS1 A;  1VHN A;  2FVA A;  3CE7 A;  3G71 P;  5F2O A;  1HY8 A;  1YHQ P;  2JGP A;  3EJD A;  1M74 A;  3G21 A;  1CEI A;  3DS2 A;  3B5I A;  1VQ6 P;  2L9F A;  2XZ1 C;  3LRY A;  1FR2 A;  4WYM A;  2MD9 A;  2VSQ A;  2MVV A;  1GPJ A;  1M1K Q;  2JYL A;  2GDX A;  1A8O A;  3GZM A;  4U0A A;  2KOO A;  2LL8 A;  2GDW A;  1DV5 A;  2K94 A;  2K2Q A;  2XT1 A;  2FAD A;  2PEJ A;  3H47 A;  2EG5 A;  3G26 A;  1DNY A;  2LIU A;  3NTE A;  1KQS O;  2K0D X;  5I4T G;  2QNW A;  2FQ1 A;  2KOQ A;  2DNW A;  1Q86 Q;  3I55 P;  2KWL A;  2MR7 A;  3CCV P;  2AVA A;  2FQ0 A;  2CNR A;  2JO0 A;  1EMV A;  4U0D A;  3CCU P;  1YIJ P;  1UNK A;  3CD6 P;  2BHV A;  2PEK A;  1HQB A;  2GZJ A;  1AF8 A;  1IUQ A;  1BAJ A;  3HZQ A;  2AFE A;  1M6N A;  4PWV B;  3OW2 O;  2OAR A;  2LML A;  2KGE A;  4BPG A;  3H4E A;  1X3O A;  2GYK A;  4PXH B;  1IMP A;  2AF8 A;  4GR6 A;  2N98 A;  1BXI A;  4XRO A;  2JBG A;  2DGY A;  2GZE A;  5DCK A;  2KG6 A;  3G1G A;  1K8A Q;  3CCE P;  2NO8 A;  2JAZ A;  3G28 A;  4QNB A; 
#chains in the Genus database with same CATH homology
 7CEI A;  3GJN A;  2GYK A;  2VLO A;  1IMP A;  1EMV A;  1CEI A;  1UJZ A;  3U43 A;  2GZF A;  2VLP A;  1MZ8 A;  1UNK A;  2K5X A;  5EW5 E;  1BXI A;  4QKO A;  1AYI A;  2JBG A;  2GZJ A;  1IMQ A;  2GZI A;  2GZE A;  1FR2 A;  2JB0 A;  1GXG A;  1ZNV A;  4F37 A;  3GKL C;  2GZG A;  1E0H A;  2ERH A;  2K0D X;  4UHP B;  2NO8 A;  2JAZ A;  1GXH A;  2VLN A;  2WPT A;  2VLQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...