2WPTA

The crystal structure of im2 in complex with colicin e9 dnase
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
82
structure length
82
Chain Sequence
KHSISDYTEAEFLEFVKKIARAEGATECDDNKLVREFERLTEHPDGSDLIYYPRDDREDSPEGIVKEIKEWRAANGKSGFKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords COLICIN-E2 IMMUNITY PROTEIN
publication title The Structural and Energetic Basis for High Selectivity in a High-Affinity Protein-Protein Interaction.
pubmed doi rcsb
source organism Escherichia coli
total genus 31
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2009-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01320 Colicin_Pyocin Colicin immunity protein / pyocin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.20 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Colicin E immunity protein 2wptA00
7CEIA 1FR2A 2JB0A 1MZ8A 3U43A 2GZFA 1EMVA 1UJZA 1IMPA 2GZIA 2GYKA 2K5XA 1E0HA 2GZGA 2WPTA 2ERHA 5EW5E 2VLOA 1IMQA 1CEIA 2JAZA 1UNKA 3GKLC 2GZJA 2VLPA 1GXGA 2K0DX 1BXIA 1ZNVA 2VLNA 1GXHA 2NO8A 1AYIA 4UHPB 2GZEA 4F37A 4QKOA 3GJNA 2JBGA 2VLQA
chains in the Genus database with same CATH superfamily
1K30A 3CCLP 4M0IA 3B4QA 4U0AA 3DS1A 1QRJA 1VQ8P 1L0IA 3CC7P 4PH0A 1VHNA 2VLPA 2K0DX 2L4BA 4BPHA 3H4EA 3CCVP 2L9FA 3H47A 5HGMA 5KP7B 3I56P 1Q82Q 2K92A 2VSQA 4XFXA 1DV5A 1RO0A 2XZ0D 2N50A 3Q20A 2CNRA 1UNKA 3G28A 4HKGA 2FADA 1M6EX 1ZNVA 2K0XA 4U0BA 1Z6MA 2L0QA 2GZFA 1M74A 2PEKA 2GDWA 3OW2O 2PEOA 2JAZA 2N98A 1M1KQ 3CPWO 1F80D 1YJ9P 4CA3A 2VLNA 2ONTA 2AVAA 3LRYA 1VQ9P 1VQMP 3DS0A 4GR2A 2GDXA 5F2OA 5I4TG 2MD9A 3RG2A 1VQ4P 4XRQA 2OTJP 2WPTA 3G4SP 3CCUP 3G6EP 1KC8Q 1A8OA 2EHSA 2FAEA 2CQ8A 1HQBA 3NY7B 3CCEP 2FQ2A 3I55P 2JBGA 3DS5A 4H2WC 2DGYA 1UJZA 5KP8B 4MRTC 2N6YA 4IZ6A 3GKLC 1YI2P 2EG5A 2XV6A 1BXIA 5DCKA 1VQNP 2MY5A 1MZ8A 2LKIA 1IUQA 1X3OA 2LTEA 1KD1Q 2N5IA 2Z46A 2PNGA 2M8PA 3EJEA 1VKUA 2M8NA 1Q86Q 5HGLA 2JU1A 3CCRP 4UHPB 2OTLP 4H2XC 3HYBA 1HY8A 2JU2A 2EHTA 1NJIQ 4PH1A 4U0FA 2KGEA 1Q7YQ 2E1MA 1DNYA 5HGNA 2AF8A 2XZ1C 1ZMBA 1Q81Q 3DPHA 1AUMA 2Z45A 4U0EA 3CC4P 2FVFA 2LIWA 3G0VA 2QNWA 2PEQA 2KG9A 5KP6B 3U43A 2KG8A 2M8LA 1OR5A 3G1GA 2GYKA 2GZIA 3CD6P 2K5XA 3VRLC 3CXCO 2KORA 3CC2P 1K9MQ 1VQPP 3G21A 2KG6A 2LOLA 5HVCA 3DS2A 1GPJA 1KQSO 1RNIA 1EMVA 5F2KA 4IPYA 1YHQP 1E0HA 2CWOA 1NQ4A 2L6EA 2ERHA 4BPGA 2M5RA 2PENA 1VQLP 2KOQA 3DS4A 2FQ0A 2NO8A 2PEJA 1QVFO 4XROA 2JYLA 2FQ1A 7CEIA 1JJ2O 3CMAP 2K0YA 2K94A 1YJNP 2KWLA 2KGDA 3DS3A 3MGEA 1CEIA 1VQ7P 2DNWA 2KOSA 2XXMA 2Z44A 3B5IA 2MVVA 5F2NA 1T8KA 3WBHA 1K73Q 4BPFA 2JB0A 2MF4A 2OARA 2X2BA 3GZLA 2CG5B 1EOQA 4WYMA 2GZGA 3H0DA 2LMLA 5BS1A 3E2DA 1BAJA 1GXGA 4U0CA 2KOPA 2FACA 2BUOA 1AYIA 3CCSP 2XT1A 5JPAA 3GJNA 2L22A 2LIUA 2KGCA 2GDYA 1IMPA 3CE7A 2JGPA 2MR7A 1YIJP 1YITP 2N6ZA 3P05A 3CCQP 2MVUA 3EJDA 2LPKA 1RO2A 2ROQA 5HV8A 2JYGA 2GZJA 4R0MA 2N5HA 1VQ6P 2K93A 1VQOP 3CCJP 1A43A 1AF8A 2JQ4A 3DTJA 1FR2A 2EFJA 5BS2A 2KGAA 4QNBA 1E6JP 2KW2A 2PY8A 1K8AQ 2KR5A 2JO0A 2AFDA 4XFZA 3NTEA 3CMEP 2AFEA 4QKOA 3CCMP 3HZQA 4PXHB 2PEMA 1M90Q 1KLPA 4DG9A 1YJWP 1N8RQ 1VQ5P 2PEIA 2BHVA 2LF4A 3G1IA 5EW5E 3M1MA 1ACPA 2FHSC 4NEOA 2LL8A 3RG6C 4H2YC 1QVGO 5EJDA 1M6NA 4F37A 3G26A 2VLQA 2EIAA 5HGOA 1EIAA 1VQKP 4COPA 3G29A 2FVEA 2MR8A 2FVAA 2VLOA 4GR6A 1S72P 1IMQA 1W2BO 2QA4P 1D1DA 4PWVB 1GXHA 2CGQA 2KODA 3LMOA 2KOOA 1L0HA 2P9XA 4XFYA 4COCA 2QEXP 3GZMA 3G71P 5CZDB 2K2QA 4U0DA 3EJBA 2GZEA
chains in the Genus database with same CATH topology
7CEIA 1FR2A 2JB0A 1MZ8A 3U43A 2GZFA 1EMVA 1UJZA 1IMPA 2GZIA 2GYKA 2K5XA 1E0HA 2GZGA 2WPTA 2ERHA 5EW5E 2VLOA 1IMQA 1CEIA 2JAZA 1UNKA 3GKLC 2GZJA 2VLPA 1GXGA 2K0DX 1BXIA 1ZNVA 2VLNA 1GXHA 2NO8A 1AYIA 4UHPB 2GZEA 4F37A 4QKOA 3GJNA 2JBGA 2VLQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 7CEI A;  1FR2 A;  2JB0 A;  1MZ8 A;  3U43 A;  2GZF A;  1EMV A;  1UJZ A;  1IMP A;  2GZI A;  2GYK A;  2K5X A;  1E0H A;  2GZG A;  2WPT A;  2ERH A;  5EW5 E;  2VLO A;  1IMQ A;  1CEI A;  2JAZ A;  1UNK A;  3GKL C;  2GZJ A;  2VLP A;  1GXG A;  2K0D X;  1BXI A;  1ZNV A;  2VLN A;  1GXH A;  2NO8 A;  1AYI A;  4UHP B;  2GZE A;  4F37 A;  4QKO A;  3GJN A;  2JBG A;  2VLQ A; 
#chains in the Genus database with same CATH topology
 1K30 A;  3CCL P;  4M0I A;  3B4Q A;  4U0A A;  3DS1 A;  1QRJ A;  1VQ8 P;  1L0I A;  3CC7 P;  4PH0 A;  1VHN A;  2VLP A;  2K0D X;  2L4B A;  4BPH A;  3H4E A;  3CCV P;  2L9F A;  3H47 A;  5HGM A;  5KP7 B;  3I56 P;  1Q82 Q;  2K92 A;  2VSQ A;  4XFX A;  1DV5 A;  1RO0 A;  2XZ0 D;  2N50 A;  3Q20 A;  2CNR A;  1UNK A;  3G28 A;  4HKG A;  2FAD A;  1M6E X;  1ZNV A;  2K0X A;  4U0B A;  1Z6M A;  2L0Q A;  2GZF A;  1M74 A;  2PEK A;  2GDW A;  3OW2 O;  2PEO A;  2JAZ A;  2N98 A;  1M1K Q;  3CPW O;  1F80 D;  1YJ9 P;  4CA3 A;  2VLN A;  2ONT A;  2AVA A;  3LRY A;  1VQ9 P;  1VQM P;  3DS0 A;  4GR2 A;  2GDX A;  5F2O A;  5I4T G;  2MD9 A;  3RG2 A;  1VQ4 P;  4XRQ A;  2OTJ P;  2WPT A;  3G4S P;  3CCU P;  3G6E P;  1KC8 Q;  1A8O A;  2EHS A;  2FAE A;  2CQ8 A;  1HQB A;  3NY7 B;  3CCE P;  2FQ2 A;  3I55 P;  2JBG A;  3DS5 A;  4H2W C;  2DGY A;  1UJZ A;  5KP8 B;  4MRT C;  2N6Y A;  4IZ6 A;  3GKL C;  1YI2 P;  2EG5 A;  2XV6 A;  1BXI A;  5DCK A;  1VQN P;  2MY5 A;  1MZ8 A;  2LKI A;  1IUQ A;  1X3O A;  2LTE A;  1KD1 Q;  2N5I A;  2Z46 A;  2PNG A;  2M8P A;  3EJE A;  1VKU A;  2M8N A;  1Q86 Q;  5HGL A;  2JU1 A;  3CCR P;  4UHP B;  2OTL P;  4H2X C;  3HYB A;  1HY8 A;  2JU2 A;  2EHT A;  1NJI Q;  4PH1 A;  4U0F A;  2KGE A;  1Q7Y Q;  2E1M A;  1DNY A;  5HGN A;  2AF8 A;  2XZ1 C;  1ZMB A;  1Q81 Q;  3DPH A;  1AUM A;  2Z45 A;  4U0E A;  3CC4 P;  2FVF A;  2LIW A;  3G0V A;  2QNW A;  2PEQ A;  2KG9 A;  5KP6 B;  3U43 A;  2KG8 A;  2M8L A;  1OR5 A;  3G1G A;  2GYK A;  2GZI A;  3CD6 P;  2K5X A;  3VRL C;  3CXC O;  2KOR A;  3CC2 P;  1K9M Q;  1VQP P;  3G21 A;  2KG6 A;  2LOL A;  5HVC A;  3DS2 A;  1GPJ A;  1KQS O;  1RNI A;  1EMV A;  5F2K A;  4IPY A;  1YHQ P;  1E0H A;  2CWO A;  1NQ4 A;  2L6E A;  2ERH A;  4BPG A;  2M5R A;  2PEN A;  1VQL P;  2KOQ A;  3DS4 A;  2FQ0 A;  2NO8 A;  2PEJ A;  1QVF O;  4XRO A;  2JYL A;  2FQ1 A;  7CEI A;  1JJ2 O;  3CMA P;  2K0Y A;  2K94 A;  1YJN P;  2KWL A;  2KGD A;  3DS3 A;  3MGE A;  1CEI A;  1VQ7 P;  2DNW A;  2KOS A;  2XXM A;  2Z44 A;  3B5I A;  2MVV A;  5F2N A;  1T8K A;  3WBH A;  1K73 Q;  4BPF A;  2JB0 A;  2MF4 A;  2OAR A;  2X2B A;  3GZL A;  2CG5 B;  1EOQ A;  4WYM A;  2GZG A;  3H0D A;  2LML A;  5BS1 A;  3E2D A;  1BAJ A;  1GXG A;  4U0C A;  2KOP A;  2FAC A;  2BUO A;  1AYI A;  3CCS P;  2XT1 A;  5JPA A;  3GJN A;  2L22 A;  2LIU A;  2KGC A;  2GDY A;  1IMP A;  3CE7 A;  2JGP A;  2MR7 A;  1YIJ P;  1YIT P;  2N6Z A;  3P05 A;  3CCQ P;  2MVU A;  3EJD A;  2LPK A;  1RO2 A;  2ROQ A;  5HV8 A;  2JYG A;  2GZJ A;  4R0M A;  2N5H A;  1VQ6 P;  2K93 A;  1VQO P;  3CCJ P;  1A43 A;  1AF8 A;  2JQ4 A;  3DTJ A;  1FR2 A;  2EFJ A;  5BS2 A;  2KGA A;  4QNB A;  1E6J P;  2KW2 A;  2PY8 A;  1K8A Q;  2KR5 A;  2JO0 A;  2AFD A;  4XFZ A;  3NTE A;  3CME P;  2AFE A;  4QKO A;  3CCM P;  3HZQ A;  4PXH B;  2PEM A;  1M90 Q;  1KLP A;  4DG9 A;  1YJW P;  1N8R Q;  1VQ5 P;  2PEI A;  2BHV A;  2LF4 A;  3G1I A;  5EW5 E;  3M1M A;  1ACP A;  2FHS C;  4NEO A;  2LL8 A;  3RG6 C;  4H2Y C;  1QVG O;  5EJD A;  1M6N A;  4F37 A;  3G26 A;  2VLQ A;  2EIA A;  5HGO A;  1EIA A;  1VQK P;  4COP A;  3G29 A;  2FVE A;  2MR8 A;  2FVA A;  2VLO A;  4GR6 A;  1S72 P;  1IMQ A;  1W2B O;  2QA4 P;  1D1D A;  4PWV B;  1GXH A;  2CGQ A;  2KOD A;  3LMO A;  2KOO A;  1L0H A;  2P9X A;  4XFY A;  4COC A;  2QEX P;  3GZM A;  3G71 P;  5CZD B;  2K2Q A;  4U0D A;  3EJB A;  2GZE A; 
#chains in the Genus database with same CATH homology
 7CEI A;  1FR2 A;  2JB0 A;  1MZ8 A;  3U43 A;  2GZF A;  1EMV A;  1UJZ A;  1IMP A;  2GZI A;  2GYK A;  2K5X A;  1E0H A;  2GZG A;  2WPT A;  2ERH A;  5EW5 E;  2VLO A;  1IMQ A;  1CEI A;  2JAZ A;  1UNK A;  3GKL C;  2GZJ A;  2VLP A;  1GXG A;  2K0D X;  1BXI A;  1ZNV A;  2VLN A;  1GXH A;  2NO8 A;  1AYI A;  4UHP B;  2GZE A;  4F37 A;  4QKO A;  3GJN A;  2JBG A;  2VLQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...