3I55P

Co-crystal structure of mycalamide a bound to the large ribosomal subunit
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 23S ribosomal RNA
publication title Structures of triacetyloleandomycin and mycalamide A bind to the large ribosomal subunit of Haloarcula marismortui.
pubmed doi rcsb
total genus 45
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2009-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3i55P03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 3i55P01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 3i55P02
3CC7P 3G6EP 3CCRP 1W2BO 3CXCO 1JJ2O 3CCVP 3CCQP 3CCJP 1YJ9P 1QVGO 1VQ7P 3CPWO 3CCEP 3G71P 3CCUP 1K8AQ 1VQ6P 1YHQP 1K9MQ 3CCLP 3CMEP 1NJIQ 1S72P 3CMAP 1KD1Q 1VQ8P 1VQOP 3I56P 1M1KQ 3I55P 1Q82Q 3OW2O 1VQMP 2QEXP 1VQKP 1YI2P 1Q86Q 1M90Q 1KQSO 3G4SP 1VQ5P 1N8RQ 1QVFO 1Q81Q 1KC8Q 3CC4P 1YITP 1YJWP 3CD6P 1VQ4P 1VQ9P 3CCMP 2QA4P 1VQPP 3CCSP 1YIJP 1YJNP 3CC2P 2OTLP 1VQNP 1Q7YQ 1K73Q 1VQLP 2OTJP
chains in the Genus database with same CATH superfamily
1TU3F 3CCUP 3A0HE 1HTLC 1SFCD 2IPPA 2BCCD 2VLQA 1K05A 4R0MA 3V2PA 3L73D 2N9BA 2H7HA 2KOQA 1AV1A 2IFMA 3JC22 3K5BA 1SFCA 2KG6A 1URQA 1BGYD 2KZJA 2M5AA 2OYOA 2YKQA 2K2QA 3RG2A 1S2EA 1M1JC 4BPFA 5BS2A 5KTBA 2POHA 4QMAA 3E7KA 1PGJA 4CPGA 3B5NA 4NPEA 3PTZA 2XKMA 2E1MA 1SQVJ 1RF1C 1H0TB 1MV8A 5APUA 4DCKA 2QM8A 1VDFA 1HF9A 4OVNF 3M9HA 2N5HA 4H44B 2N98A 3U59A 1FZCA 1L0NG 3NTEA 3L75J 2CWOA 3G4SP 2M5RA 2ZVOB 3MTUE 3BRVB 1AUMA 2IZ0A 3AE9C 1PV3A 4RESB 3OAKA 1MZ9A 3RK3B 1FE6A 1M57D 4KHXA 3I56P 3M9BA 2YIUB 3Q5PA 1SQXE 4HH2A 2N50A 3L72E 1SLQA 1HVVA 1KFNA 3L70E 2GDYA 2A06G 3L74D 5AW4B 3VN0A 5AW1B 3D6ZA 4DZOA 3SWYA 3TK1A 2W6AA 3CXCO 3HE4A 3N4XA 4GOEA 1L0HA 3FX0A 1BCCG 1Z6MA 2Y0CA 2EHTA 3GLMA 1QL1A 2BHVA 3M9QA 1SFCC 2GZIA 1EQ7A 1SQPK 1VQKP 3VMXA 2GA1A 1URQC 1PP9J 2WT7B 3CL3D 1LTSC 3L71E 2NZ2A 3HRNA 1MKMA 1DNYA 3PH0A 1Q7YQ 2BCCG 2LL8A 4H0LD 3AE8C 2J59M 4PV1C 1FOSF 4GKGA 2PENA 1QEXA 1EC5A 1QGKB 3CMEP 5AVVB 1BDDA 1G2CB 1T3JA 2HR3A 1NVOA 1FJKA 1NHLA 2LMLA 4N78D 3GKLC 3L72D 1EMVA 3KYQA 3U43A 3ITKA 1KILD 1FZCC 2PNGA 5KLVE 4H2WC 1IMPA 2E5YA 2AFEA 3CX5D 1HH0A 2CPBA 3GHGA 3P7KA 2BQ1E 1CI6A 2AF8A 1KILA 2PEIA 3MIWA 4OGQB 1NOHA 2R5BA 2QG4A 1WT6A 5KP8B 2FADA 2WPSA 4KT0J 4L76A 1SQVE 1L0LK 1A43A 1KYOH 1E0HA 5AW9B 1SQPJ 1KB9H 2JWDA 1L0IA 2KOSA 2QA4P 1F80D 4HJGH 3IFMA 2XXMA 3LIEA 3G6EP 2MY5A 3L74G 7CEIA 2NPSA 1L4AB 5AVRB 1N7SD 4D6TG 1JNMA 3H1JE 2OQQA 2CGQA 4L75A 2VLPA 1MFZA 2JDIH 2WPVB 1SQVD 3L35A 1N7SA 3AECC 2H88C 1FBMA 3G0VA 3RK3E 1IFIA 3LMOA 3H47A 3USSA 2V7QH 3L75D 2K88A 2K0DX 1L2PA 3MP7B 1KYOI 2M0BA 4U3FJ 2PP6A 1J1EB 1KB9I 1PIXA 1FS0E 3KDPB 1KILC 1L0LJ 1IFMA 4BPGA 4GR2A 1GL2B 1PGPA 2KP8A 3RL0D 2PFXA 1ZOYC 2Y0EA 4PJ0H 3PHLA 3E1IA 4JBZA 1LTJC 4C7NB 3VTPC 2M8NA 1H0TA 1IFDA 1EDIA 3H1IE 2E42A 4XROA 3PJSK 1OVRA 2JU2A 3LW5H 1NU1J 3IN6A 5APTA 2WPTA 1PP9D 4UB8H 1HUCA 4B86A 2A45G 2V7QJ 2NPSC 2E75B 2WQYC 1OVUA 4IL6H 2FYNC 1PPJE 4U0FA 3B71A 3VMAA 2MVUA 1SQPE 2LF4A 1NAYA 1N7LA 1VQ9P 1LP1B 1N7SC 5KAFH 3IAOA 2O1JA 2PEMA 3CCVP 4TT3H 2H89C 3P8CE 1ZN5A 2QJYC 1RO2A 3A0HH 1J2JB 2GZFA 4HKGA 3G1IA 2WMMA 1LGHB 3L75G 1PPJD 3GG2A 1AFOA 2BUOA 2LR2A 1KTMA 5L8RJ 3H1KE 2WSCH 1KQSO 3O6QB 5CJ0A 1S3JA 1SQPD 4HKZH 1CZQA 1YBKA 5KJ7A 3CWBE 3MUDA 3S1KA 2K3RA 2K9YA 2QJPC 1ZRTD 1KYOE 1VQLP 1JTHB 3RL0C 3V2RA 1UIIA 1LT9B 4NPFX 1KB9E 1KFMA 4XA4A 3WU2H 2ZAEB 2FYZA 2P2UA 3WUTA 1P84D 1EXJA 2N6YA 3FGAD 1PZQA 3MHVA 4N6JA 1NGMB 2Q3IA 1VF5B 5BS1A 2LXBA 4DJGA 2E5TA 2Z4EA 3BCCG 1NTME 2L5GB 4OH8B 1PP9G 2PGDA 1MZ8A 1KMIZ 1SQXK 3EJEA 3DS0A 2O3JA 1E79H 2FBWC 3BRTB 4WWIA 4ZNCA 3V5BA 2LIUA 3GF7A 2LTEA 2IYPA 4U3FD 1D1DA 2KNCB 1NJIQ 3AEBC 4EOTA 5APVA 1L0LD 1OW8A 2O01N 1H8AA 1YJWP 3VP8A 2QJKC 1RE4A 3T97B 4LC1A 1S9KE 1GK6A 1FDOA 2L22A 1SP4A 3H25A 3AEFC 1U57A 2QM7A 5KJ7C 1S72P 2Z5HA 3MUDC 5F2KA 4PJ0E 2C0WA 3A7OA 4H0LB 2KW2A 1M56D 1Q86Q 2MR8A 2KGCA 1NTZK 1HGVA 1DD3A 3AE1C 1NU1D 1T8KA 4DG9A 2K0XA 2Q6QA 4PH1A 2QRXA 2N6ZA 4PXHB 2EIAA 5HGOA 1EZVI 3G26A 1JEKA 2JGPA 1S4XA 2FYUG 3FXEA 1IMQA 4UB8E 4IOIH 2E74D 3LRYA 1HJBA 2KG8A 2AEMA 1SQXJ 1GL2A 1FAVA 4IL6E 2AXCA 1PL5A 4I2LC 3L70J 1N73B 2KI7B 4MN4C 2IBZI 2KZIA 2AFDA 2YO3A 1USDA 2ZXEB 5JPAA 2O01J 5KAFE 5GTIH 2Z45A 2FVFA 2KGEA 1YTZI 2K9JA 1J1DB 2C0XA 4M3LA 2GYKA 3L4FA 1KV4A 3L71J 3VMZA 2XZ0D 2W83C 4H13B 2HG5D 3Q1MA 4XFXA 2DNWA 2L4BA 1VKUA 1RE4C 1URQD 3G1GA 1ZR2A 2VSQA 1OX3A 1NTZJ 4U3FG 1RO0A 1Q90D 4Y99C 4IPYA 1LP1A 3AEAC 1L0LG 2M3BA 4PV1D 4RKUJ 1OWAA 2KORA 5KLVJ 3B5ND 3RK2B 1W2EA 4W7YA 2J58A 1SQBG 1X0TA 2KLUA 2SPZA 1HJ0A 1WRGA 2Q7CA 3WU2E 4XRQA 1DD4A 2N1TD 2CK3H 2EFJA 3HE5B 3GF3A 5C39A 1LTTC 4IFMA 1YQ3C 1GL2C 5B5EH 2M8PA 3E2DA 1NU1G 2XZRA 2ITAA 1AQ5A 5EJDA 5EW5E 2L9FA 5KLIC 1T2KC 2ZT9D 1T6AA 4YXWH 2QEXP 2N1TA 3QWOC 2E74C 4GIFA 3BVHA 3F5HA 1YQ4C 3NFQA 4I7ZB 3D6YA 2L6EA 1S5LE 1EZVE 1ZW0A 5HGMA 1GW3A 3A5TA 3M91A 3H1JJ 5CCGD 5EFWB 2IBZE 3TNUB 3CC7P 2KS1A 4COCA 1RNIA 1IFPA 3HD7B 4WY4B 3I5CA 1LJ2A 5CCGA 1BE3G 4HYTB 1YYCA 1JY3O 4IL6X 3L36A 2HODA 2Z46A 1CEIA 3ZDMA 3G28A 2QIWA 2D2CB 4U0AA 5KAIH 1QLED 1ZNVA 2DW3A 1LWUB 3B4SA 5KP7B 3FXDA 2OYHA 5B66E 1BSHA 3L73G 2JR8A 2P9XA 3B5NC 1Q82Q 2NRGA 5CZDB 1Z56A 1BGYG 1N8RQ 2WTYA 2IDBA 1NTZE 1SQXD 5CJ4A 3CCMP 1IFJA 1YJNP 2LXCB 3EWKA 3L70D 4ZMDA 3TYYA 3WUUA 2IBZD 2C9NY 2N1TC 2N5IA 3H1IJ 1LT1A 1N86A 1GU5A 3Q2YA 1SQQK 2E76C 1MUUA 3DS5A 2LOLA 2ZT9C 5APQA 4EIJA 2LIWA 3HTKB 1KQGB 5H2FH 3DPHA 5GTIE 2FFDA 3L71D 1JY3N 1XTCC 2PY8A 2V4HA 2H8PD 3G71P 3EQ2A 4JQ0D 5BVZA 3EFGA 2ZFCA 1HY8A 5CHXA 4BRYA 2XT1A 1NTZD 4R4LA 2Y9ZA 1VQPP 3CCSP 1ZMBA 2R5DA 2NPSD 5CCGC 2GUSA 2VLNA 2B87A 5F2NA 4EYYQ 2KODA 1NTMK 5KLVD 5KKZB 1JY2O 5DJTB 1OZHA 1AQTA 3EJBA 3BATA 2PEOA 2W6JH 2JAZA 4WB4A 2OYHC 2WPQA 4YXDC 3HUSB 2FACA 4PWVB 1K04A 1NQ4A 1A8OA 3L37A 2GDXA 1FC2C 2PEKA 4TLFA 4EDFA 2JP3A 3G21A 2QSIA 1ZV8A 2R3SA 2OYIB 4C46A 3D71A 1M1KQ 1SQQJ 3H1KJ 4PH0A 5B5EE 3CWBJ 4CA3A 2ZJSE 3H1HJ 1GU4A 3R2PA 1H88A 2YNYA 3GHGC 1SQXG 2R32A 2JBGA 2KOOA 3L72G 2BEQD 3L70G 2FFDC 1PGQA 1DX7A 1QL2A 1IC2A 1M1JB 2FXOA 4U7JA 1HBWA 4H44D 1JY2N 3H1JD 1FZEA 1LNQA 4K35A 1GXHA 3VRLC 2OTKE 1NTMJ 1X8YA 4PD4H 3A2AA 3L71G 1RF1B 1E5WA 2EHSA 3RK3D 2E43A 2YMKA 3MD0A 3W67A 3CXHH 1VQNP 1PEOA 2IZ1A 1NYHA 3V2NA 5TJHA 3CCEP 4JYBA 4DT0A 3CCLP 1M6EX 1JMMA 1RHZB 2VRSA 5KAIE 2FXPA 4C7RA 2JO0A 1FDIA 1FZAA 5KLVG 1AYIA 4I6MC 1QRJA 3TNUA 2IYOA 5KP6B 2P7JA 1Y8AA 2YXQB 3H1LE 3H1ID 1FR2A 1VQOP 2JQ4A 2MVVA 1YI2P 3H0DA 1NTKE 1SQVG 2WT7A 1SFCB 4PD4I 2YXRB 1RE3A 1IZNB 3LW5J 3G9RA 4QKOA 2M5AB 2JJLA 5KJ7D 4U0CA 5H2FE 3CXHI 2KGDA 4PV1B 1BCCJ 2W27A 1SQQE 1G2CA 3B4QA 2OTLP 3H1HE 3WMM0 4H44C 4OGQD 3CPWO 3TDKA 2PAJA 1KD1Q 2FQ2A 3H1JG 1FZCB 3TGUE 2WSFH 3G3ZA 3GZMA 5HV8A 1DEEG 3KXDA 2HLOA 2M3EA 3P8CD 3M0DA 3RK3C 3AE6C 5CCHA 3SSUA 4U0EA 1DH3A 1AVYA 1GTWA 4U0BA 2ZXXA 3PP5A 1GK4A 2YIUC 2JB0A 1E6JP 5HVCA 1HGZA 2FKWB 2GZGA 2PEQA 4XFJA 1S5LH 1SQQD 3H1KD 1N2DC 5DJUB 2HPCB 2CNRA 2RN0A 1OFCX 3VOPA 3CWBD 2KOGA 2MJZA 3CI9A 3H1HD 3HE4B 2WSCJ 1KYOD 1KN7A 4F37A 2Q5UA 2O1KA 1KB9D 4OWFA 2K1AA 3V4WA 2P67A 3AE5C 1RE3C 2QVAA 2Q3EA 3AE4C 1L4AA 3OA7A 2WITA 3DTJA 1YITP 1JY3P 1NO4A 2WSFJ 4UB6H 2Z5IA 1L0NE 3H1IG 1IUQA 3II6A 3TSIA 2Y9YA 1RH5B 3RBZA 1LTAC 2XV6A 4WBAA 1EDJA 2YO2A 1KZUB 1VQ8P 1NTMD 1KQLA 3IF4A 1AA0A 1AJYA 3C9IA 5HGNA 1M7LA 3VP9A 2PEJA 2RH0A 5B66H 4PD4E 1YTZT 1PPJG 1X22A 4COPA 4D6TJ 1GL2D 1K30A 3M0AA 2XDJA 1USEA 2A06E 4ZKUA 1SQPG 2P10A 4Y28J 1ACPA 3CXHE 1T2KD 2KG9A 3M0DC 2P1JA 4OGQC 1A02J 4ASWA 1CI6B 4GT1A 1KILB 5APWA 1BCCE 4KJMA 3CC4P 1EXIA 2KSEA 2FQ0A 1Y47A 1JB0J 2A45H 3HZQA 3CCRP 1S9KD 3AEGC 3Q3DA 4C7NA 2LKMA 3EFFK 2BCCE 1LTJB 4WVZA 3GZLA 4RO0A 3O8ZA 2E75D 3MGNA 2WSSH 4IZ6A 2X2BA 1BAJA 4PD4D 2KSJA 2ZYAA 3P05A 1BGYE 1VHNA 2ONTA 5E79H 2KYVA 3DS2A 3H1KG 1L4AC 3NXSA 2K94A 1RQUA 3CWBG 2NO8A 2NPSB 3SWFA 2FHSC 2FYNB 3P8MC 1JM0A 3DS4A 1JY2P 1BCCD 1PFIA 1QX8A 3H32B 2GDWA 3B5IA 3SFEC 3RBXA 4I1LA 2W90A 1N7SB 4AYCA 2JO1A 1OXZA 2EG5A 1M74A 2A45I 4JF7A 3RL0g 2I8DA 1DIPA 5CMZA 3QH9A 1FZGA 1KORA 4N3YB 1Q81Q 1VQ4P 4O9BA 1J1EC 2YMYA 1NTMG 1VL2A 2OTJP 2QJYB 2G3AA 1ZXGA 3PRJA 3KPEA 4XE5B 3F89A 2AXTH 1FOSE 1CW5A 2KR5A 5AVTB 2E76D 4W80A 4XFYA 4RJTA 1Q2NA 3RGUA 2QE7H 3L74E 3EJDA 4GOFA 3O6QA 4L74A 1VPCA 4D6TE 1FZFA 1JTHA 2ZYGA 1YJ9P 1LT9A 1FJPA 2QJPB 4Z1MH 3RL0B 1JO5A 2AEFA 1LTBC 5DCKA 1VF5D 4LLHA 1VQMP 1M90Q 3E1RA 3LIDA 3BASA 3KQGA 3CE7A 4UHPB 1IFNA 2E75C 2KUBA 1AVOA 1R5SA 2WPRA 5APSA 1ZMEC 5BU8B 2IX7C 4WYMA 4UB6E 2GUVA 2CG5B 1H89A 1T3UA 4N78E 4GODA 2M8LA 2HPCA 2K0YA 1OMIA 1KILE 1XTGB 1K73Q 2JKVA 2FVEA 1G1JA 4D6TD 1EZVD 4ZKPA 3A0BH 3CX5E 2KNCA 4A7PA 2ZVNB 3WBHA 5APYA 3BCCJ 2FYUK 2GZJA 1NTKK 2OGUA 3T97A 1JOCA 3AE7C 1R8EA 3CCJP 2QJKB 1S1CX 1IO4A 5AW3B 2FQ1A 1OIPA 3I55P 3SWKA 1LT9C 3C8VA 1FDMA 2XU6A 1OW7A 3JSVC 2HFED 1QVGO 5CBOA 1P84H 4YTPC 1A02F 2LKIA 5GTHH 2H43A 1LTIC 4EI2A 5E79E 4JPZB 1PEQA 4BXLA 1VF5C 2WWWA 2GM4A 1N73A 1G1IA 1GZLA 1X9VA 3H1LJ 5AW5B 1K8AQ 4IFFA 3GJNA 5TISH 1IK7A 4H13D 1EDLA 1LTJA 3S9OA 3OW2O 2FYUJ 1BSNA 5AW8B 3L75E 1NTKJ 1W5CE 3A3YB 1JUNA 2BASA 1SQBK 3DS1A 1S5LX 2W8ZA 2UWJE 2JWAA 2ROQA 1ZLLA 2Z44A 3Q20A 1Y9BA 1M6NA 4GR6A 1NU1K 2I1KA 1EZVG 3IR9A 3RK2D 2AXTE 1P84I 2B88A 2KLVA 2VLOA 1L0NK 3H32A 3OJAB 4Y99B 4H0LC 1VQ6P 5AVZB 2JYGA 2HYNA 3TGUJ 3UIAA 2KIKA 5AW6B 2BEZF 1GD2E 3KZIH 3BCCE 2IBZG 2KXPB 1U7JA 2B9BA 5AVWB 4U0DA 1PP9E 1WMKA 3AEDC 3HE5A 1UIXA 4LGDE 2CQ8A 2KWLA 1M8OB 3VYIA 1UNKA 4ASVA 5CBNA 1N73C 3NMDA 5HGLA 3NTNA 5KLIB 1SQBJ 1U7MA 5AW7B 1ZR4A 2E74B 3GW6A 2XNXA 5BU5A 2YKOA 1HWTC 1J1DC 1NTZG 2WSEH 3PLNA 2KK7A 4YPCA 1FZBA 2K9JB 4BPHA 3DS3A 1DV5A 1RF0A 3U1CA 3JCUH 4H13C 3BCCD 3A0BE 1CSBA 3HD7D 4WY4D 1L0NJ 3D70A 3AE2C 3CCQP 5AW0B 2ZYDA 1K9MQ 2D2CD 3HD7A 4WY4A 1IJDB 5AVUB 4QNBA 1T8ZA 3VMYA 2MR7A 2FYUE 5F2OA 1EOQA 1ZRTE 3RK2C 2RKLA 2FVAA 2XNDH 1SS1A 1URQB 2CPSA 4W7ZA 1OVVA 1AF8A 1LWUA 1PEUA 3S4RA 2JEEA 2JYLA 2I1JA 3GMAA 5M1BA 2WZ7A 1LTGC 4DOJA 2PRRA 1NH4A 1P84E 4JYCA 1BE3J 5AVSB 3MGEA 2WSEJ 3CD6P 3V4QA 3B5NB 5GTHE 3G29A 5AW2B 3SFDC 4NPDA 3ABVC 5CCHD 1GXGA 3H1LD 2BCCJ 2L0QA 4I7ZC 2N1TB 2FAEA 3KHUA 3L73J 2AEJA 1KC8Q 2FYUD 2R44A 1NTKD 5AVQB 5TISE 2K5XA 3HTKA 2E76B 1BGYJ 1QVFO 2ZT9B 4U3FE 3W68A 1SVFA 3R4YA 1RF0C 4AQRD 1VQ7P 1MFTA 1OR5A 1L0LE 3H6PA 4R4MA 3AE3C 2FXMA 1VQ5P 1SQBE 3N7NA 3HD7C 4WY4C 2IFNA 2KS1B 1L4AD 3AEEC 1YHQP 1X79B 2KB7P 2P58A 5K5GB 2DGYA 1EDKA 2RMZA 3WUVA 1RQVA 2HODB 3TGUD 1IK9A 2D2CC 3M06A 1NU1E 1LWUC 3V2QA 2FY8A 3HUSA 4H2YC 4XFZA 1X3OA 2OYIC 3H4EA 3KZIE 4GDOA 2OYHB 4NEOA 4L73A 4M0IA 2N9YB 5APXA 1KLPA 3CMAP 1EIAA 5AVXB 2Y0DA 2WVRA 2OYIA 1GW4A 1BDCA 1R5LA 1KQFB 2XV5A 1GMJA 1RY3A 3L74J 1D7MA 2LPKA 3FWLA 3CX5H 3TF5A 2O01H 2MD9A 2G8YA 2MKVA 1SQBD 3MZWB 2K92A 1W2BO 1JJ2O 1OW6A 1DEBA 2JU1A 4IFDK 2K93A 3NY7B 5CCHC 3GHGB 1JCDA 1NKZB 2Q9IA 3M1MA 1NKNA 2FFDB 3H1LG 1BE3E 1M1JA 4K3AA 1NWQA 4AUWA 1L0ND 2YKPA 3C1LA 3JCUE 3V6IA 5KLVK 4HB1A 1NTKG 1BXIA 1PEMA 3P32A 3B8EB 2M8RA 5I4TG 4BRYB 3FWNA 1RF1A 4H2XC 3L72J 2ERHA 3L73E 1NAFA 5AVYB 2QNWA 1YIJP 3CC2P 4BWNA 5KKZC 4MRTC 2J5UA 2AVAA 2B87B 1SQVK 2MF4A 3Q5RA 1SQQG 1ZP0C 2KGAA 1PGOA 3CX5I 2A06D 3CXHD 3HUSC 2Q1KA 3H1HG 1HQBA 3RG6C 3U1AA 2W6BA 1JCCA 2B89A 2K37A 3CLQA 1GDTA 2GZEA 1JMBA 2L91A 2KOPA 1GPJA 2XZ1C 1BE3D 2C9LY 3Q5SA 2R3CA 1FU1A 1UJZA 3HYBA 2OARA 3TGUG
chains in the Genus database with same CATH topology
2XXMA 3G6EP 1K30A 3CXCO 2PY8A 5BS1A 3CCJP 3VRLC 3CPWO 4M0IA 5HGMA 3G71P 3CCUP 1VQ6P 5JPAA 1PEUA 2JYGA 1KD1Q 4U0FA 3CMAP 2JYLA 1EIAA 2Z45A 3I55P 2BHVA 4XFYA 1VQKP 2XT1A 2LF4A 4U0DA 3CC4P 3MGEA 3DS0A 3CD6P 1VQ9P 1VQPP 3CCSP 1ZMBA 4U0EA 3G29A 1VQNP 1Q7YQ 1PEOA 3HZQA 4U0BA 3CCRP 3CC7P 1W2BO 1JJ2O 2PEMA 3CCVP 2PENA 4COCA 4XFXA 1YJ9P 1RNIA 1QVGO 5F2NA 3CCEP 1D1DA 1E6JP 2KODA 3CCLP 3CMEP 1NJIQ 1M6EX 2PEQA 3G0VA 5DCKA 3G1GA 1VQMP 5BS2A 1M90Q 2JO0A 2PEOA 2Z46A 3M1MA 1PEQA 1RO0A 3H47A 5HGLA 1KC8Q 1BAJA 1RO2A 1YJWP 4IPYA 3G28A 1A8OA 4U0AA 1QVFO 3P05A 2E1MA 1QRJA 3G1IA 2ONTA 2PEKA 3DS2A 1VQ7P 1K8AQ 3G21A 4WYMA 1S72P 1PEMA 2P9XA 1VQOP 5F2KA 2BUOA 4GR2A 5I4TG 1Q82Q 1M1KQ 3NTEA 3OW2O 3DS3A 4PH0A 1YI2P 1Q86Q 2BQ1E 2CWOA 1KQSO 3G4SP 3DS4A 1VQ5P 1N8RQ 3H0DA 2PEIA 1AUMA 2M8LA 3DTJA 4XRQA 1YITP 3CCMP 1YIJP 1YJNP 3CC2P 3DS1A 3B5IA 4PH1A 1IUQA 2EFJA 1K73Q 1VQLP 2EIAA 5HGOA 3G26A 2Z44A 3CCQP 2XV6A 2M8NA 4U0CA 2M8PA 3E2DA 2EG5A 1YHQP 1K9MQ 1M74A 2DGYA 1A43A 1VQ8P 3WBHA 3I56P 3Q20A 3LRYA 4XROA 1M6NA 4GR6A 4QNBA 3RG6C 2QEXP 5HGNA 3DS5A 5F2OA 1EOQA 1Q81Q 2PEJA 1VQ4P 3DPHA 2QA4P 2L6EA 2OTLP 4COPA 4XFZA 3HYBA 2OARA 3H4EA 2OTJP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CC7 P;  3G6E P;  3CCR P;  1W2B O;  3CXC O;  1JJ2 O;  3CCV P;  3CCQ P;  3CCJ P;  1YJ9 P;  1QVG O;  1VQ7 P;  3CPW O;  3CCE P;  3G71 P;  3CCU P;  1K8A Q;  1VQ6 P;  1YHQ P;  1K9M Q;  3CCL P;  3CME P;  1NJI Q;  1S72 P;  3CMA P;  1KD1 Q;  1VQ8 P;  1VQO P;  3I56 P;  1M1K Q;  3I55 P;  1Q82 Q;  3OW2 O;  1VQM P;  2QEX P;  1VQK P;  1YI2 P;  1Q86 Q;  1M90 Q;  1KQS O;  3G4S P;  1VQ5 P;  1N8R Q;  1QVF O;  1Q81 Q;  1KC8 Q;  3CC4 P;  1YIT P;  1YJW P;  3CD6 P;  1VQ4 P;  1VQ9 P;  3CCM P;  2QA4 P;  1VQP P;  3CCS P;  1YIJ P;  1YJN P;  3CC2 P;  2OTL P;  1VQN P;  1Q7Y Q;  1K73 Q;  1VQL P;  2OTJ P; 
#chains in the Genus database with same CATH topology
 1TU3 F;  3CCU P;  3A0H E;  1HTL C;  1SFC D;  2IPP A;  2BCC D;  2VLQ A;  1K05 A;  4R0M A;  3V2P A;  3L73 D;  2N9B A;  2H7H A;  2KOQ A;  1AV1 A;  2IFM A;  3JC2 2;  3K5B A;  1SFC A;  2KG6 A;  1URQ A;  1BGY D;  2KZJ A;  2M5A A;  2OYO A;  2YKQ A;  2K2Q A;  3RG2 A;  1S2E A;  1M1J C;  4BPF A;  5BS2 A;  5KTB A;  2POH A;  4QMA A;  3E7K A;  1PGJ A;  4CPG A;  3B5N A;  4NPE A;  3PTZ A;  2XKM A;  2E1M A;  1SQV J;  1RF1 C;  1H0T B;  1MV8 A;  5APU A;  4DCK A;  2QM8 A;  1VDF A;  1HF9 A;  4OVN F;  3M9H A;  2N5H A;  4H44 B;  2N98 A;  3U59 A;  1FZC A;  1L0N G;  3NTE A;  3L75 J;  2CWO A;  3G4S P;  2M5R A;  2ZVO B;  3MTU E;  3BRV B;  1AUM A;  2IZ0 A;  3AE9 C;  1PV3 A;  4RES B;  3OAK A;  1MZ9 A;  3RK3 B;  1FE6 A;  1M57 D;  4KHX A;  3I56 P;  3M9B A;  2YIU B;  3Q5P A;  1SQX E;  4HH2 A;  2N50 A;  3L72 E;  1SLQ A;  1HVV A;  1KFN A;  3L70 E;  2GDY A;  2A06 G;  3L74 D;  5AW4 B;  3VN0 A;  5AW1 B;  3D6Z A;  4DZO A;  3SWY A;  3TK1 A;  2W6A A;  3CXC O;  3HE4 A;  3N4X A;  4GOE A;  1L0H A;  3FX0 A;  1BCC G;  1Z6M A;  2Y0C A;  2EHT A;  3GLM A;  1QL1 A;  2BHV A;  3M9Q A;  1SFC C;  2GZI A;  1EQ7 A;  1SQP K;  1VQK P;  3VMX A;  2GA1 A;  1URQ C;  1PP9 J;  2WT7 B;  3CL3 D;  1LTS C;  3L71 E;  2NZ2 A;  3HRN A;  1MKM A;  1DNY A;  3PH0 A;  1Q7Y Q;  2BCC G;  2LL8 A;  4H0L D;  3AE8 C;  2J59 M;  4PV1 C;  1FOS F;  4GKG A;  2PEN A;  1QEX A;  1EC5 A;  1QGK B;  3CME P;  5AVV B;  1BDD A;  1G2C B;  1T3J A;  2HR3 A;  1NVO A;  1FJK A;  1NHL A;  2LML A;  4N78 D;  3GKL C;  3L72 D;  1EMV A;  3KYQ A;  3U43 A;  3ITK A;  1KIL D;  1FZC C;  2PNG A;  5KLV E;  4H2W C;  1IMP A;  2E5Y A;  2AFE A;  3CX5 D;  1HH0 A;  2CPB A;  3GHG A;  3P7K A;  2BQ1 E;  1CI6 A;  2AF8 A;  1KIL A;  2PEI A;  3MIW A;  4OGQ B;  1NOH A;  2R5B A;  2QG4 A;  1WT6 A;  5KP8 B;  2FAD A;  2WPS A;  4KT0 J;  4L76 A;  1SQV E;  1L0L K;  1A43 A;  1KYO H;  1E0H A;  5AW9 B;  1SQP J;  1KB9 H;  2JWD A;  1L0I A;  2KOS A;  2QA4 P;  1F80 D;  4HJG H;  3IFM A;  2XXM A;  3LIE A;  3G6E P;  2MY5 A;  3L74 G;  7CEI A;  2NPS A;  1L4A B;  5AVR B;  1N7S D;  4D6T G;  1JNM A;  3H1J E;  2OQQ A;  2CGQ A;  4L75 A;  2VLP A;  1MFZ A;  2JDI H;  2WPV B;  1SQV D;  3L35 A;  1N7S A;  3AEC C;  2H88 C;  1FBM A;  3G0V A;  3RK3 E;  1IFI A;  3LMO A;  3H47 A;  3USS A;  2V7Q H;  3L75 D;  2K88 A;  2K0D X;  1L2P A;  3MP7 B;  1KYO I;  2M0B A;  4U3F J;  2PP6 A;  1J1E B;  1KB9 I;  1PIX A;  1FS0 E;  3KDP B;  1KIL C;  1L0L J;  1IFM A;  4BPG A;  4GR2 A;  1GL2 B;  1PGP A;  2KP8 A;  3RL0 D;  2PFX A;  1ZOY C;  2Y0E A;  4PJ0 H;  3PHL A;  3E1I A;  4JBZ A;  1LTJ C;  4C7N B;  3VTP C;  2M8N A;  1H0T A;  1IFD A;  1EDI A;  3H1I E;  2E42 A;  4XRO A;  3PJS K;  1OVR A;  2JU2 A;  3LW5 H;  1NU1 J;  3IN6 A;  5APT A;  2WPT A;  1PP9 D;  4UB8 H;  1HUC A;  4B86 A;  2A45 G;  2V7Q J;  2NPS C;  2E75 B;  2WQY C;  1OVU A;  4IL6 H;  2FYN C;  1PPJ E;  4U0F A;  3B71 A;  3VMA A;  2MVU A;  1SQP E;  2LF4 A;  1NAY A;  1N7L A;  1VQ9 P;  1LP1 B;  1N7S C;  5KAF H;  3IAO A;  2O1J A;  2PEM A;  3CCV P;  4TT3 H;  2H89 C;  3P8C E;  1ZN5 A;  2QJY C;  1RO2 A;  3A0H H;  1J2J B;  2GZF A;  4HKG A;  3G1I A;  2WMM A;  1LGH B;  3L75 G;  1PPJ D;  3GG2 A;  1AFO A;  2BUO A;  2LR2 A;  1KTM A;  5L8R J;  3H1K E;  2WSC H;  1KQS O;  3O6Q B;  5CJ0 A;  1S3J A;  1SQP D;  4HKZ H;  1CZQ A;  1YBK A;  5KJ7 A;  3CWB E;  3MUD A;  3S1K A;  2K3R A;  2K9Y A;  2QJP C;  1ZRT D;  1KYO E;  1VQL P;  1JTH B;  3RL0 C;  3V2R A;  1UII A;  1LT9 B;  4NPF X;  1KB9 E;  1KFM A;  4XA4 A;  3WU2 H;  2ZAE B;  2FYZ A;  2P2U A;  3WUT A;  1P84 D;  1EXJ A;  2N6Y A;  3FGA D;  1PZQ A;  3MHV A;  4N6J A;  1NGM B;  2Q3I A;  1VF5 B;  5BS1 A;  2LXB A;  4DJG A;  2E5T A;  2Z4E A;  3BCC G;  1NTM E;  2L5G B;  4OH8 B;  1PP9 G;  2PGD A;  1MZ8 A;  1KMI Z;  1SQX K;  3EJE A;  3DS0 A;  2O3J A;  1E79 H;  2FBW C;  3BRT B;  4WWI A;  4ZNC A;  3V5B A;  2LIU A;  3GF7 A;  2LTE A;  2IYP A;  4U3F D;  1D1D A;  2KNC B;  1NJI Q;  3AEB C;  4EOT A;  5APV A;  1L0L D;  1OW8 A;  2O01 N;  1H8A A;  1YJW P;  3VP8 A;  2QJK C;  1RE4 A;  3T97 B;  4LC1 A;  1S9K E;  1GK6 A;  1FDO A;  2L22 A;  1SP4 A;  3H25 A;  3AEF C;  1U57 A;  2QM7 A;  5KJ7 C;  1S72 P;  2Z5H A;  3MUD C;  5F2K A;  4PJ0 E;  2C0W A;  3A7O A;  4H0L B;  2KW2 A;  1M56 D;  1Q86 Q;  2MR8 A;  2KGC A;  1NTZ K;  1HGV A;  1DD3 A;  3AE1 C;  1NU1 D;  1T8K A;  4DG9 A;  2K0X A;  2Q6Q A;  4PH1 A;  2QRX A;  2N6Z A;  4PXH B;  2EIA A;  5HGO A;  1EZV I;  3G26 A;  1JEK A;  2JGP A;  1S4X A;  2FYU G;  3FXE A;  1IMQ A;  4UB8 E;  4IOI H;  2E74 D;  3LRY A;  1HJB A;  2KG8 A;  2AEM A;  1SQX J;  1GL2 A;  1FAV A;  4IL6 E;  2AXC A;  1PL5 A;  4I2L C;  3L70 J;  1N73 B;  2KI7 B;  4MN4 C;  2IBZ I;  2KZI A;  2AFD A;  2YO3 A;  1USD A;  2ZXE B;  5JPA A;  2O01 J;  5KAF E;  5GTI H;  2Z45 A;  2FVF A;  2KGE A;  1YTZ I;  2K9J A;  1J1D B;  2C0X A;  4M3L A;  2GYK A;  3L4F A;  1KV4 A;  3L71 J;  3VMZ A;  2XZ0 D;  2W83 C;  4H13 B;  2HG5 D;  3Q1M A;  4XFX A;  2DNW A;  2L4B A;  1VKU A;  1RE4 C;  1URQ D;  3G1G A;  1ZR2 A;  2VSQ A;  1OX3 A;  1NTZ J;  4U3F G;  1RO0 A;  1Q90 D;  4Y99 C;  4IPY A;  1LP1 A;  3AEA C;  1L0L G;  2M3B A;  4PV1 D;  4RKU J;  1OWA A;  2KOR A;  5KLV J;  3B5N D;  3RK2 B;  1W2E A;  4W7Y A;  2J58 A;  1SQB G;  1X0T A;  2KLU A;  2SPZ A;  1HJ0 A;  1WRG A;  2Q7C A;  3WU2 E;  4XRQ A;  1DD4 A;  2N1T D;  2CK3 H;  2EFJ A;  3HE5 B;  3GF3 A;  5C39 A;  1LTT C;  4IFM A;  1YQ3 C;  1GL2 C;  5B5E H;  2M8P A;  3E2D A;  1NU1 G;  2XZR A;  2ITA A;  1AQ5 A;  5EJD A;  5EW5 E;  2L9F A;  5KLI C;  1T2K C;  2ZT9 D;  1T6A A;  4YXW H;  2QEX P;  2N1T A;  3QWO C;  2E74 C;  4GIF A;  3BVH A;  3F5H A;  1YQ4 C;  3NFQ A;  4I7Z B;  3D6Y A;  2L6E A;  1S5L E;  1EZV E;  1ZW0 A;  5HGM A;  1GW3 A;  3A5T A;  3M91 A;  3H1J J;  5CCG D;  5EFW B;  2IBZ E;  3TNU B;  3CC7 P;  2KS1 A;  4COC A;  1RNI A;  1IFP A;  3HD7 B;  4WY4 B;  3I5C A;  1LJ2 A;  5CCG A;  1BE3 G;  4HYT B;  1YYC A;  1JY3 O;  4IL6 X;  3L36 A;  2HOD A;  2Z46 A;  1CEI A;  3ZDM A;  3G28 A;  2QIW A;  2D2C B;  4U0A A;  5KAI H;  1QLE D;  1ZNV A;  2DW3 A;  1LWU B;  3B4S A;  5KP7 B;  3FXD A;  2OYH A;  5B66 E;  1BSH A;  3L73 G;  2JR8 A;  2P9X A;  3B5N C;  1Q82 Q;  2NRG A;  5CZD B;  1Z56 A;  1BGY G;  1N8R Q;  2WTY A;  2IDB A;  1NTZ E;  1SQX D;  5CJ4 A;  3CCM P;  1IFJ A;  1YJN P;  2LXC B;  3EWK A;  3L70 D;  4ZMD A;  3TYY A;  3WUU A;  2IBZ D;  2C9N Y;  2N1T C;  2N5I A;  3H1I J;  1LT1 A;  1N86 A;  1GU5 A;  3Q2Y A;  1SQQ K;  2E76 C;  1MUU A;  3DS5 A;  2LOL A;  2ZT9 C;  5APQ A;  4EIJ A;  2LIW A;  3HTK B;  1KQG B;  5H2F H;  3DPH A;  5GTI E;  2FFD A;  3L71 D;  1JY3 N;  1XTC C;  2PY8 A;  2V4H A;  2H8P D;  3G71 P;  3EQ2 A;  4JQ0 D;  5BVZ A;  3EFG A;  2ZFC A;  1HY8 A;  5CHX A;  4BRY A;  2XT1 A;  1NTZ D;  4R4L A;  2Y9Z A;  1VQP P;  3CCS P;  1ZMB A;  2R5D A;  2NPS D;  5CCG C;  2GUS A;  2VLN A;  2B87 A;  5F2N A;  4EYY Q;  2KOD A;  1NTM K;  5KLV D;  5KKZ B;  1JY2 O;  5DJT B;  1OZH A;  1AQT A;  3EJB A;  3BAT A;  2PEO A;  2W6J H;  2JAZ A;  4WB4 A;  2OYH C;  2WPQ A;  4YXD C;  3HUS B;  2FAC A;  4PWV B;  1K04 A;  1NQ4 A;  1A8O A;  3L37 A;  2GDX A;  1FC2 C;  2PEK A;  4TLF A;  4EDF A;  2JP3 A;  3G21 A;  2QSI A;  1ZV8 A;  2R3S A;  2OYI B;  4C46 A;  3D71 A;  1M1K Q;  1SQQ J;  3H1K J;  4PH0 A;  5B5E E;  3CWB J;  4CA3 A;  2ZJS E;  3H1H J;  1GU4 A;  3R2P A;  1H88 A;  2YNY A;  3GHG C;  1SQX G;  2R32 A;  2JBG A;  2KOO A;  3L72 G;  2BEQ D;  3L70 G;  2FFD C;  1PGQ A;  1DX7 A;  1QL2 A;  1IC2 A;  1M1J B;  2FXO A;  4U7J A;  1HBW A;  4H44 D;  1JY2 N;  3H1J D;  1FZE A;  1LNQ A;  4K35 A;  1GXH A;  3VRL C;  2OTK E;  1NTM J;  1X8Y A;  4PD4 H;  3A2A A;  3L71 G;  1RF1 B;  1E5W A;  2EHS A;  3RK3 D;  2E43 A;  2YMK A;  3MD0 A;  3W67 A;  3CXH H;  1VQN P;  1PEO A;  2IZ1 A;  1NYH A;  3V2N A;  5TJH A;  3CCE P;  4JYB A;  4DT0 A;  3CCL P;  1M6E X;  1JMM A;  1RHZ B;  2VRS A;  5KAI E;  2FXP A;  4C7R A;  2JO0 A;  1FDI A;  1FZA A;  5KLV G;  1AYI A;  4I6M C;  1QRJ A;  3TNU A;  2IYO A;  5KP6 B;  2P7J A;  1Y8A A;  2YXQ B;  3H1L E;  3H1I D;  1FR2 A;  1VQO P;  2JQ4 A;  2MVV A;  1YI2 P;  3H0D A;  1NTK E;  1SQV G;  2WT7 A;  1SFC B;  4PD4 I;  2YXR B;  1RE3 A;  1IZN B;  3LW5 J;  3G9R A;  4QKO A;  2M5A B;  2JJL A;  5KJ7 D;  4U0C A;  5H2F E;  3CXH I;  2KGD A;  4PV1 B;  1BCC J;  2W27 A;  1SQQ E;  1G2C A;  3B4Q A;  2OTL P;  3H1H E;  3WMM 0;  4H44 C;  4OGQ D;  3CPW O;  3TDK A;  2PAJ A;  1KD1 Q;  2FQ2 A;  3H1J G;  1FZC B;  3TGU E;  2WSF H;  3G3Z A;  3GZM A;  5HV8 A;  1DEE G;  3KXD A;  2HLO A;  2M3E A;  3P8C D;  3M0D A;  3RK3 C;  3AE6 C;  5CCH A;  3SSU A;  4U0E A;  1DH3 A;  1AVY A;  1GTW A;  4U0B A;  2ZXX A;  3PP5 A;  1GK4 A;  2YIU C;  2JB0 A;  1E6J P;  5HVC A;  1HGZ A;  2FKW B;  2GZG A;  2PEQ A;  4XFJ A;  1S5L H;  1SQQ D;  3H1K D;  1N2D C;  5DJU B;  2HPC B;  2CNR A;  2RN0 A;  1OFC X;  3VOP A;  3CWB D;  2KOG A;  2MJZ A;  3CI9 A;  3H1H D;  3HE4 B;  2WSC J;  1KYO D;  1KN7 A;  4F37 A;  2Q5U A;  2O1K A;  1KB9 D;  4OWF A;  2K1A A;  3V4W A;  2P67 A;  3AE5 C;  1RE3 C;  2QVA A;  2Q3E A;  3AE4 C;  1L4A A;  3OA7 A;  2WIT A;  3DTJ A;  1YIT P;  1JY3 P;  1NO4 A;  2WSF J;  4UB6 H;  2Z5I A;  1L0N E;  3H1I G;  1IUQ A;  3II6 A;  3TSI A;  2Y9Y A;  1RH5 B;  3RBZ A;  1LTA C;  2XV6 A;  4WBA A;  1EDJ A;  2YO2 A;  1KZU B;  1VQ8 P;  1NTM D;  1KQL A;  3IF4 A;  1AA0 A;  1AJY A;  3C9I A;  5HGN A;  1M7L A;  3VP9 A;  2PEJ A;  2RH0 A;  5B66 H;  4PD4 E;  1YTZ T;  1PPJ G;  1X22 A;  4COP A;  4D6T J;  1GL2 D;  1K30 A;  3M0A A;  2XDJ A;  1USE A;  2A06 E;  4ZKU A;  1SQP G;  2P10 A;  4Y28 J;  1ACP A;  3CXH E;  1T2K D;  2KG9 A;  3M0D C;  2P1J A;  4OGQ C;  1A02 J;  4ASW A;  1CI6 B;  4GT1 A;  1KIL B;  5APW A;  1BCC E;  4KJM A;  3CC4 P;  1EXI A;  2KSE A;  2FQ0 A;  1Y47 A;  1JB0 J;  2A45 H;  3HZQ A;  3CCR P;  1S9K D;  3AEG C;  3Q3D A;  4C7N A;  2LKM A;  3EFF K;  2BCC E;  1LTJ B;  4WVZ A;  3GZL A;  4RO0 A;  3O8Z A;  2E75 D;  3MGN A;  2WSS H;  4IZ6 A;  2X2B A;  1BAJ A;  4PD4 D;  2KSJ A;  2ZYA A;  3P05 A;  1BGY E;  1VHN A;  2ONT A;  5E79 H;  2KYV A;  3DS2 A;  3H1K G;  1L4A C;  3NXS A;  2K94 A;  1RQU A;  3CWB G;  2NO8 A;  2NPS B;  3SWF A;  2FHS C;  2FYN B;  3P8M C;  1JM0 A;  3DS4 A;  1JY2 P;  1BCC D;  1PFI A;  1QX8 A;  3H32 B;  2GDW A;  3B5I A;  3SFE C;  3RBX A;  4I1L A;  2W90 A;  1N7S B;  4AYC A;  2JO1 A;  1OXZ A;  2EG5 A;  1M74 A;  2A45 I;  4JF7 A;  3RL0 g;  2I8D A;  1DIP A;  5CMZ A;  3QH9 A;  1FZG A;  1KOR A;  4N3Y B;  1Q81 Q;  1VQ4 P;  4O9B A;  1J1E C;  2YMY A;  1NTM G;  1VL2 A;  2OTJ P;  2QJY B;  2G3A A;  1ZXG A;  3PRJ A;  3KPE A;  4XE5 B;  3F89 A;  2AXT H;  1FOS E;  1CW5 A;  2KR5 A;  5AVT B;  2E76 D;  4W80 A;  4XFY A;  4RJT A;  1Q2N A;  3RGU A;  2QE7 H;  3L74 E;  3EJD A;  4GOF A;  3O6Q A;  4L74 A;  1VPC A;  4D6T E;  1FZF A;  1JTH A;  2ZYG A;  1YJ9 P;  1LT9 A;  1FJP A;  2QJP B;  4Z1M H;  3RL0 B;  1JO5 A;  2AEF A;  1LTB C;  5DCK A;  1VF5 D;  4LLH A;  1VQM P;  1M90 Q;  3E1R A;  3LID A;  3BAS A;  3KQG A;  3CE7 A;  4UHP B;  1IFN A;  2E75 C;  2KUB A;  1AVO A;  1R5S A;  2WPR A;  5APS A;  1ZME C;  5BU8 B;  2IX7 C;  4WYM A;  4UB6 E;  2GUV A;  2CG5 B;  1H89 A;  1T3U A;  4N78 E;  4GOD A;  2M8L A;  2HPC A;  2K0Y A;  1OMI A;  1KIL E;  1XTG B;  1K73 Q;  2JKV A;  2FVE A;  1G1J A;  4D6T D;  1EZV D;  4ZKP A;  3A0B H;  3CX5 E;  2KNC A;  4A7P A;  2ZVN B;  3WBH A;  5APY A;  3BCC J;  2FYU K;  2GZJ A;  1NTK K;  2OGU A;  3T97 A;  1JOC A;  3AE7 C;  1R8E A;  3CCJ P;  2QJK B;  1S1C X;  1IO4 A;  5AW3 B;  2FQ1 A;  1OIP A;  3I55 P;  3SWK A;  1LT9 C;  3C8V A;  1FDM A;  2XU6 A;  1OW7 A;  3JSV C;  2HFE D;  1QVG O;  5CBO A;  1P84 H;  4YTP C;  1A02 F;  2LKI A;  5GTH H;  2H43 A;  1LTI C;  4EI2 A;  5E79 E;  4JPZ B;  1PEQ A;  4BXL A;  1VF5 C;  2WWW A;  2GM4 A;  1N73 A;  1G1I A;  1GZL A;  1X9V A;  3H1L J;  5AW5 B;  1K8A Q;  4IFF A;  3GJN A;  5TIS H;  1IK7 A;  4H13 D;  1EDL A;  1LTJ A;  3S9O A;  3OW2 O;  2FYU J;  1BSN A;  5AW8 B;  3L75 E;  1NTK J;  1W5C E;  3A3Y B;  1JUN A;  2BAS A;  1SQB K;  3DS1 A;  1S5L X;  2W8Z A;  2UWJ E;  2JWA A;  2ROQ A;  1ZLL A;  2Z44 A;  3Q20 A;  1Y9B A;  1M6N A;  4GR6 A;  1NU1 K;  2I1K A;  1EZV G;  3IR9 A;  3RK2 D;  2AXT E;  1P84 I;  2B88 A;  2KLV A;  2VLO A;  1L0N K;  3H32 A;  3OJA B;  4Y99 B;  4H0L C;  1VQ6 P;  5AVZ B;  2JYG A;  2HYN A;  3TGU J;  3UIA A;  2KIK A;  5AW6 B;  2BEZ F;  1GD2 E;  3KZI H;  3BCC E;  2IBZ G;  2KXP B;  1U7J A;  2B9B A;  5AVW B;  4U0D A;  1PP9 E;  1WMK A;  3AED C;  3HE5 A;  1UIX A;  4LGD E;  2CQ8 A;  2KWL A;  1M8O B;  3VYI A;  1UNK A;  4ASV A;  5CBN A;  1N73 C;  3NMD A;  5HGL A;  3NTN A;  5KLI B;  1SQB J;  1U7M A;  5AW7 B;  1ZR4 A;  2E74 B;  3GW6 A;  2XNX A;  5BU5 A;  2YKO A;  1HWT C;  1J1D C;  1NTZ G;  2WSE H;  3PLN A;  2KK7 A;  4YPC A;  1FZB A;  2K9J B;  4BPH A;  3DS3 A;  1DV5 A;  1RF0 A;  3U1C A;  3JCU H;  4H13 C;  3BCC D;  3A0B E;  1CSB A;  3HD7 D;  4WY4 D;  1L0N J;  3D70 A;  3AE2 C;  3CCQ P;  5AW0 B;  2ZYD A;  1K9M Q;  2D2C D;  3HD7 A;  4WY4 A;  1IJD B;  5AVU B;  4QNB A;  1T8Z A;  3VMY A;  2MR7 A;  2FYU E;  5F2O A;  1EOQ A;  1ZRT E;  3RK2 C;  2RKL A;  2FVA A;  2XND H;  1SS1 A;  1URQ B;  2CPS A;  4W7Z A;  1OVV A;  1AF8 A;  1LWU A;  1PEU A;  3S4R A;  2JEE A;  2JYL A;  2I1J A;  3GMA A;  5M1B A;  2WZ7 A;  1LTG C;  4DOJ A;  2PRR A;  1NH4 A;  1P84 E;  4JYC A;  1BE3 J;  5AVS B;  3MGE A;  2WSE J;  3CD6 P;  3V4Q A;  3B5N B;  5GTH E;  3G29 A;  5AW2 B;  3SFD C;  4NPD A;  3ABV C;  5CCH D;  1GXG A;  3H1L D;  2BCC J;  2L0Q A;  4I7Z C;  2N1T B;  2FAE A;  3KHU A;  3L73 J;  2AEJ A;  1KC8 Q;  2FYU D;  2R44 A;  1NTK D;  5AVQ B;  5TIS E;  2K5X A;  3HTK A;  2E76 B;  1BGY J;  1QVF O;  2ZT9 B;  4U3F E;  3W68 A;  1SVF A;  3R4Y A;  1RF0 C;  4AQR D;  1VQ7 P;  1MFT A;  1OR5 A;  1L0L E;  3H6P A;  4R4M A;  3AE3 C;  2FXM A;  1VQ5 P;  1SQB E;  3N7N A;  3HD7 C;  4WY4 C;  2IFN A;  2KS1 B;  1L4A D;  3AEE C;  1YHQ P;  1X79 B;  2KB7 P;  2P58 A;  5K5G B;  2DGY A;  1EDK A;  2RMZ A;  3WUV A;  1RQV A;  2HOD B;  3TGU D;  1IK9 A;  2D2C C;  3M06 A;  1NU1 E;  1LWU C;  3V2Q A;  2FY8 A;  3HUS A;  4H2Y C;  4XFZ A;  1X3O A;  2OYI C;  3H4E A;  3KZI E;  4GDO A;  2OYH B;  4NEO A;  4L73 A;  4M0I A;  2N9Y B;  5APX A;  1KLP A;  3CMA P;  1EIA A;  5AVX B;  2Y0D A;  2WVR A;  2OYI A;  1GW4 A;  1BDC A;  1R5L A;  1KQF B;  2XV5 A;  1GMJ A;  1RY3 A;  3L74 J;  1D7M A;  2LPK A;  3FWL A;  3CX5 H;  3TF5 A;  2O01 H;  2MD9 A;  2G8Y A;  2MKV A;  1SQB D;  3MZW B;  2K92 A;  1W2B O;  1JJ2 O;  1OW6 A;  1DEB A;  2JU1 A;  4IFD K;  2K93 A;  3NY7 B;  5CCH C;  3GHG B;  1JCD A;  1NKZ B;  2Q9I A;  3M1M A;  1NKN A;  2FFD B;  3H1L G;  1BE3 E;  1M1J A;  4K3A A;  1NWQ A;  4AUW A;  1L0N D;  2YKP A;  3C1L A;  3JCU E;  3V6I A;  5KLV K;  4HB1 A;  1NTK G;  1BXI A;  1PEM A;  3P32 A;  3B8E B;  2M8R A;  5I4T G;  4BRY B;  3FWN A;  1RF1 A;  4H2X C;  3L72 J;  2ERH A;  3L73 E;  1NAF A;  5AVY B;  2QNW A;  1YIJ P;  3CC2 P;  4BWN A;  5KKZ C;  4MRT C;  2J5U A;  2AVA A;  2B87 B;  1SQV K;  2MF4 A;  3Q5R A;  1SQQ G;  1ZP0 C;  2KGA A;  1PGO A;  3CX5 I;  2A06 D;  3CXH D;  3HUS C;  2Q1K A;  3H1H G;  1HQB A;  3RG6 C;  3U1A A;  2W6B A;  1JCC A;  2B89 A;  2K37 A;  3CLQ A;  1GDT A;  2GZE A;  1JMB A;  2L91 A;  2KOP A;  1GPJ A;  2XZ1 C;  1BE3 D;  2C9L Y;  3Q5S A;  2R3C A;  1FU1 A;  1UJZ A;  3HYB A;  2OAR A;  3TGU G; 
#chains in the Genus database with same CATH homology
 2XXM A;  3G6E P;  1K30 A;  3CXC O;  2PY8 A;  5BS1 A;  3CCJ P;  3VRL C;  3CPW O;  4M0I A;  5HGM A;  3G71 P;  3CCU P;  1VQ6 P;  5JPA A;  1PEU A;  2JYG A;  1KD1 Q;  4U0F A;  3CMA P;  2JYL A;  1EIA A;  2Z45 A;  3I55 P;  2BHV A;  4XFY A;  1VQK P;  2XT1 A;  2LF4 A;  4U0D A;  3CC4 P;  3MGE A;  3DS0 A;  3CD6 P;  1VQ9 P;  1VQP P;  3CCS P;  1ZMB A;  4U0E A;  3G29 A;  1VQN P;  1Q7Y Q;  1PEO A;  3HZQ A;  4U0B A;  3CCR P;  3CC7 P;  1W2B O;  1JJ2 O;  2PEM A;  3CCV P;  2PEN A;  4COC A;  4XFX A;  1YJ9 P;  1RNI A;  1QVG O;  5F2N A;  3CCE P;  1D1D A;  1E6J P;  2KOD A;  3CCL P;  3CME P;  1NJI Q;  1M6E X;  2PEQ A;  3G0V A;  5DCK A;  3G1G A;  1VQM P;  5BS2 A;  1M90 Q;  2JO0 A;  2PEO A;  2Z46 A;  3M1M A;  1PEQ A;  1RO0 A;  3H47 A;  5HGL A;  1KC8 Q;  1BAJ A;  1RO2 A;  1YJW P;  4IPY A;  3G28 A;  1A8O A;  4U0A A;  1QVF O;  3P05 A;  2E1M A;  1QRJ A;  3G1I A;  2ONT A;  2PEK A;  3DS2 A;  1VQ7 P;  1K8A Q;  3G21 A;  4WYM A;  1S72 P;  1PEM A;  2P9X A;  1VQO P;  5F2K A;  2BUO A;  4GR2 A;  5I4T G;  1Q82 Q;  1M1K Q;  3NTE A;  3OW2 O;  3DS3 A;  4PH0 A;  1YI2 P;  1Q86 Q;  2BQ1 E;  2CWO A;  1KQS O;  3G4S P;  3DS4 A;  1VQ5 P;  1N8R Q;  3H0D A;  2PEI A;  1AUM A;  2M8L A;  3DTJ A;  4XRQ A;  1YIT P;  3CCM P;  1YIJ P;  1YJN P;  3CC2 P;  3DS1 A;  3B5I A;  4PH1 A;  1IUQ A;  2EFJ A;  1K73 Q;  1VQL P;  2EIA A;  5HGO A;  3G26 A;  2Z44 A;  3CCQ P;  2XV6 A;  2M8N A;  4U0C A;  2M8P A;  3E2D A;  2EG5 A;  1YHQ P;  1K9M Q;  1M74 A;  2DGY A;  1A43 A;  1VQ8 P;  3WBH A;  3I56 P;  3Q20 A;  3LRY A;  4XRO A;  1M6N A;  4GR6 A;  4QNB A;  3RG6 C;  2QEX P;  5HGN A;  3DS5 A;  5F2O A;  1EOQ A;  1Q81 Q;  2PEJ A;  1VQ4 P;  3DPH A;  2QA4 P;  2L6E A;  2OTL P;  4COP A;  4XFZ A;  3HYB A;  2OAR A;  3H4E A;  2OTJ P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...