3I55P

Co-crystal structure of mycalamide a bound to the large ribosomal subunit
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
143
structure length
143
Chain Sequence
b'TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title Structures of triacetyloleandomycin and mycalamide A bind to the large ribosomal subunit of Haloarcula marismortui.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 45
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2009-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3i55P03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 3i55P01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 3i55P02
1VQPP 3CCRP 3CC7P 3CCQP 1Q86Q 2QEXP 1Q82Q 1QVFO 3CCVP 3CPWO 1YJWP 1M90Q 3CC2P 1VQ8P 1VQLP 2OTLP 3G71P 3CXCO 1Q7YQ 1YJ9P 3CD6P 1VQOP 1S72P 3CCUP 1YITP 3CCEP 3CCLP 1YI2P 3CMAP 1NJIQ 3CC4P 1VQNP 3OW2O 1N8RQ 1VQKP 1JJ2O 1Q81Q 1VQMP 1YHQP 1KQSO 2QA4P 3CCJP 3I56P 3G4SP 1VQ5P 1KD1Q 1VQ6P 1VQ7P 1YIJP 1VQ9P 3G6EP 1K9MQ 3CCSP 1KC8Q 1K8AQ 1QVGO 1VQ4P 2OTJP 3I55P 3CCMP 1K73Q 1M1KQ 1W2BO 3CMEP 1YJNP
chains in the Genus database with same CATH superfamily
2LKMA 1JMBA 2EIAA 1P84D 2KZJA 1NTKK 1GXGA 2G3AA 1G2CB 2B87A 1JY2O 2W8ZA 4BPGA 2N1TB 3GMAA 1NTKJ 4OVNF 1OW6A 1GMJA 1LWUA 2JP3A 3CXHE 2HG5D 4IFMA 4GR6A 1TU3F 2M0BA 1A02F 1AA0A 1PPJE 2IZ1A 2R3CA 3F89A 2PEKA 3DS2A 4LC1A 5BU8B 2NO8A 5AVRB 2D2CD 2FAEA 2FVEA 2KUBA 3B5ND 2N9YB 3Q20A 1T8ZA 1OZHA 2C9LY 2XU6A 1SQQE 5CJ4A 3VMXA 4IL6X 3AE1C 2KG9A 3I55P 1YJNP 3L73E 1YJWP 7CEIA 5BVZA 2GZGA 2GA1A 2YMYA 2MVVA 2LXBA 2WQYC 4H2XC 3E7KA 1RE3C 1ZN5A 2O01J 4M3LA 3K5BA 1VQ7P 3TYYA 4YXWH 1G2CA 1PIXA 2B88A 2KR5A 1DNYA 1LTJA 2L91A 3MZWB 2WSFJ 5HGLA 5B66H 1KD1Q 1KB9I 1KYOI 1T3UA 4H44B 1FAVA 4D6TJ 2ZT9C 1NTZG 3H1IJ 1EDKA 2ZYAA 5F2KA 4WWIA 1LTIC 1HGZA 5AW2B 1WRGA 2JQ4A 1G1IA 3CCSP 2NPSA 2Y0DA 3D70A 1BAJA 1SFCB 1OVUA 2KOPA 1L4AA 1BCCE 1JO5A 1QVFO 1OW8A 1BSHA 5KJ7A 2ZYDA 1P84H 1J2JB 1CW5A 3RBZA 2AVAA 2LIWA 1NVOA 2IFNA 1EZVG 3G26A 1RY3A 2OTJP 4U0DA 2KLVA 3CX5E 4EIJA 1KV4A 1LWUC 2CQ8A 1M1JA 2E76B 3AEDC 1X22A 2KNCB 3RG2A 1JY3P 1BDCA 1VKUA 1FZBA 2FYUD 1RNIA 4I7ZC 3WUUA 3TGUD 1FZCA 2PEJA 3V2QA 5B5EH 2KWLA 3MTUE 3CXHI 4BRYA 2N5IA 4H2WC 4WY4B 3U59A 3H32A 3CCVP 1GK4A 2LMLA 3L74E 2OYHB 1J1EB 1WMKA 1UIIA 2K9YA 3C1LA 3DS4A 2ZVNB 2AEFA 2RH0A 5KLVG 3G29A 2BEZF 3ZDMA 4XFXA 3P7KA 2WTYA 3AE3C 1N7LA 4COPA 1YTZI 1LP1A 3AEFC 3CCEP 4W80A 2AEJA 3H1HJ 2CGQA 4D6TG 1SQBK 2H88C 4GKGA 2FVAA 1RH5B 1LTJC 2P7JA 2OGUA 3FWNA 2OYIA 1BGYD 2Y0CA 2WPRA 2IDBA 3MD0A 1NTMJ 1DX7A 2EFJA 5APTA 1Q86Q 2W6JH 4C7RA 2Y9YA 3BCCD 5L8RJ 3AE5C 5CBNA 3PRJA 1NJIQ 4N6JA 3R4YA 1JJ2O 2A45H 1RO0A 2M8NA 1KQGB 5GTIH 1PEUA 2ZJSE 1N73A 4K3AA 1ZW0A 2PEQA 5C39A 2YKPA 2W6BA 3LIEA 3NXSA 2K1AA 4I6MC 1EXIA 5E79H 2W83C 3EFGA 3RK3D 1L4AC 2BQ1E 1RF0A 1JMMA 5KJ7C 1NU1G 2JKVA 2MY5A 1SQXK 4U0FA 3H1LE 1VQPP 3L72D 1SQXJ 3GW6A 2QJKB 2JJLA 2NRGA 1Q7YQ 5KAFE 1HWTC 4PD4I 1L0NJ 1YQ4C 4PV1D 1OFCX 3OW2O 2LF4A 5GTHH 2Y0EA 1KB9D 3EFFK 3SWYA 3R2PA 1EDIA 2XZ1C 2E74D 2FFDB 1IFDA 3CWBJ 4K35A 5KAIH 5APXA 4ASVA 4Y99B 5TJHA 3CX5I 1SVFA 2Z45A 1IFIA 3MHVA 1FZCC 4O9BA 1EXJA 5I4TG 2RMZA 4YXDC 1VQ5P 3AE6C 3IFMA 1OW7A 3G9RA 5APSA 1PV3A 3S9OA 2L9FA 3H1HG 1SQPG 2PNGA 1JOCA 2AXTH 4JQ0D 5CCGA 2FYUE 3TGUE 2W27A 2J59M 2H43A 2KSEA 2FFDA 2WSCH 3A0HH 2M8PA 1ZXGA 1Z56A 2A45G 2E76C 4UB6E 3CCUP 1FDIA 3L71J 3CI9A 4IPYA 1AQ5A 2A06G 3M06A 3L36A 1PP9D 3CXHD 3VN0A 2QM7A 4DT0A 1EMVA 4UHPB 1BE3G 1SQVD 4XFZA 1PZQA 2OYHC 3MGNA 2PY8A 3PLNA 3V2RA 3CCJP 1N73C 3G1GA 5CCHA 1SQQD 2E5TA 3L37A 2KGCA 4L73A 2Y9ZA 1BGYE 4RJTA 1L0NG 3MGEA 3L73D 2L22A 2EG5A 2QIWA 1M90Q 3BCCE 1QX8A 3P8MC 2KOSA 1RF0C 4KHXA 1FOSE 1KQSO 4HYTB 2P2UA 3GG2A 2V4HA 5APVA 1KLPA 1KB9H 1KYOH 1LTTC 2FQ1A 3G1IA 1IMQA 4R4LA 1NTKD 2ZT9B 2FXOA 2IBZD 3RL0g 4COCA 1ACPA 1PEOA 4AUWA 1PGJA 2CG5B 1S3JA 1K9MQ 1L4AD 1LT9B 5KJ7D 4GODA 4U3FJ 1T6AA 2KS1A 2M5RA 4L76A 3L72E 2QM8A 3VYIA 3H0DA 1JNMA 1N86A 2P1JA 2GDYA 4RO0A 3V2PA 3JC22 1R5SA 3L70D 1L0LG 3H1KJ 3HZQA 2LPKA 1OVVA 4PJ0H 3I5CA 3U1CA 5CCGC 3CMEP 2QJKC 2B87B 4PD4D 1KMIZ 4GR2A 1SQVK 1LWUB 2JO1A 3GF7A 2FFDC 1GW4A 3DS5A 2YXQB 4I7ZB 1NQ4A 3GHGB 2LXCB 3CXHH 1HJBA 3M0DA 1U7JA 2P10A 3RGUA 1SFCD 1JUNA 1LT9A 5EJDA 3FX0A 2XXMA 3Q1MA 1GPJA 1NTZK 1ZLLA 1X8YA 2R5BA 4RKUJ 4MN4C 2QA4P 1NTZJ 1IZNB 1URQA 1FZGA 3H1ID 2WSEJ 4ZKUA 4EDFA 1RE4A 3G3ZA 3B71A 2K93A 4YPCA 1KILB 1HBWA 3L75D 1KQLA 3CPWO 2JWDA 5CCHC 3L74D 1GD2E 2E76D 1WT6A 3GZMA 3H1JJ 1N7SB 1OMIA 5HGOA 1PP9E 1LTJB 1IC2A 4H13B 4WY4D 3F5HA 3VOPA 2KP8A 1DD3A 1MZ8A 1SQVE 3PTZA 3GHGA 2J58A 1MZ9A 2KZIA 5APYA 4U3FG 5AW3B 2H8PD 2M8LA 1GK6A 4BPHA 1Q2NA 1ZMEC 2DW3A 2YMKA 1VF5C 4R4MA 3RG6C 1FZFA 3CCRP 5TISE 2KORA 2XKMA 5KP7B 1E6JP 3H1KG 4PH1A 1KILA 1Q81Q 5KP8B 2HODA 2NPSB 1HGVA 1E79H 3RL0B 1L4AB 3NY7B 3Q3DA 1N7SA 4YTPC 4BPFA 1W5CE 1ZP0C 2Q9IA 2C9NY 4KJMA 3V6IA 1QEXA 1NTKE 3BASA 2JU2A 3NFQA 1CI6A 2IBZE 1XTGB 5KLVJ 2GDXA 1ZRTE 3EJDA 1EOQA 2CWOA 4HH2A 1T3JA 1PPJG 2WWWA 3SSUA 2YXRB 1YBKA 3H1LD 3UIAA 1M1JB 2I1KA 5HV8A 1NGMB 3MIWA 2HPCA 2K0YA 3IAOA 4IZ6A 3G71P 3CX5H 1SQBD 2WPSA 3GF3A 5BU5A 3SWFA 1FZCB 3M0DC 5AVXB 1NTMD 4BRYB 2KB7P 1LT9C 2WZ7A 3EWKA 3L70E 1DIPA 3H32B 3AEEC 1GW3A 1OR5A 1FDOA 5CCGD 2BASA 2XV5A 3H1JG 1URQC 4PD4E 2P67A 4C46A 3M91A 1NO4A 1MFZA 3CMAP 2Z5HA 2K0DX 1RE4C 3CL3D 4U0EA 2XV6A 3I56P 3KDPB 2SPZA 3OAKA 2XZRA 2LKIA 1GU5A 4QKOA 2Z44A 1LP1B 3O6QA 2BEQD 1NU1K 2KGDA 3QH9A 1KTMA 2WVRA 1NU1J 2VRSA 3VMYA 2OYIB 2C0XA 3H1IE 1SQXD 3GHGC 2JGPA 1JB0J 2FQ0A 4R0MA 5AVUB 3A7OA 2IYOA 2LL8A 3L75E 2PEOA 3CXCO 3KYQA 3NMDA 1K04A 1YITP 1BSNA 1DD4A 3CWBD 2I1JA 5M1BA 1GU4A 3A5TA 4HJGH 5HVCA 1YTZT 1N73B 3U1AA 2WT7A 1Z6MA 3B8EB 3HE5A 2KOQA 1LTGC 1KILC 1BCCG 5AVWB 2CPBA 1X9VA 3CC7P 4GOEA 4ZMDA 1AUMA 2BCCD 4DG9A 3HD7A 1VQOP 1NKZB 1N7SC 1FC2C 3S4RA 1SQPJ 4TLFA 4H2YC 3A0BE 4EI2A 3A2AA 1ZR4A 4H13C 1NTMK 1GDTA 2I8DA 3FWLA 1VF5D 2Q7CA 3RBXA 2B89A 2GZEA 5APUA 2KYVA 2QEXP 2GUVA 1QGKB 2B9BA 2FXMA 3TSIA 2PFXA 1YI2P 5KAFH 2IBZI 5DCKA 3P05A 2BUOA 3SFDC 1N2DC 2PENA 3PJSK 4XROA 3L71D 4PH0A 3GJNA 4CPGA 2ZXXA 3WBHA 2GZFA 5AW1B 5AVZB 4U0CA 3M9BA 3PHLA 1T2KC 1BE3J 2NPSC 1HH0A 4OGQC 3RL0C 5AW7B 4WBAA 1QL2A 2OARA 3HYBA 2DGYA 4ZNCA 1PFIA 3KPEA 2ZT9D 2M8RA 2JYLA 3H1HE 3TNUA 2HFED 1L0NK 2IX7C 3U43A 1RHZB 2HR3A 3USSA 4GDOA 1SQBE 2ZAEB 3LW5H 2E5YA 3LW5J 1S9KD 1NTME 2LOLA 2E75C 2M5AB 4H0LB 1LTBC 1QVGO 1M1JC 1DEEG 1W2BO 4IFDK 3NTNA 1DEBA 2G8YA 4L75A 2LIUA 4NPEA 4UB6H 3GZLA 2JWAA 4DOJA 3O8ZA 1VHNA 2N9BA 1KQFB 1K73Q 2YKOA 2GDWA 2BHVA 3V2NA 2GZJA 4OH8B 4JYBA 4GT1A 2OQQA 4DZOA 4WVZA 4GIFA 1JTHA 4B86A 3EJBA 3II6A 1YHQP 2ERHA 5APWA 2LR2A 5AVQB 3RK2B 1RF1A 4IOIH 3P8CE 1LTSC 3V4WA 2AXCA 1SQXE 3HE4A 4N3YB 3OA7A 2Q1KA 3Q5SA 1EIAA 1L0NE 5F2OA 1Y8AA 1UIXA 1CSBA 2M5AA 1NHLA 4OWFA 2WSCJ 4C7NA 3EJEA 1NH4A 2K92A 1J1DC 1L0LJ 3CD6P 1L2PA 1U57A 3KQGA 2OYIC 4HKZH 3CWBE 5JPAA 2W90A 1S5LE 3H4EA 4UB8E 1S1CX 3AE2C 3AECC 3M0AA 2KGAA 1L0HA 1KILD 1HTLC 1VF5B 3L35A 1AV1A 4NPFX 3DS0A 2AFEA 2FY8A 1F80D 2FVFA 2BCCE 1N7SD 3LRYA 2PGDA 2E43A 2N6ZA 2KS1B 4H13D 1HF9A 4DCKA 3W68A 2FXPA 1FJKA 5CHXA 5HGNA 1NTZD 2FADA 1H89A 3VTPC 2QSIA 4A7PA 2FYUG 1N8RQ 2KG8A 1M74A 3VRLC 3TGUG 1YIJP 1FBMA 1YQ3C 5CJ0A 2MVUA 1RO2A 4IL6E 3LMOA 3L71E 5CMZA 1MV8A 1XTCC 1EDJA 1Q90D 2JYGA 1ZRTD 2Z5IA 1VQKP 1A02J 3A3YB 3D6ZA 2V7QH 2NPSD 4OGQD 3RL0D 1M57D 2AF8A 4GOFA 2RKLA 4JBZA 2R3SA 2E1MA 3KZIE 5H2FE 2FACA 2L4BA 1URQB 1FZEA 2VLOA 3N4XA 2A45I 1IFMA 1YYCA 4WB4A 1M6EX 1S9KE 1BGYG 1K30A 2QJYC 3PH0A 2E75D 2K5XA 3B4SA 2KW2A 1KFNA 3BCCG 1RF1C 2XNDH 1S72P 2M3BA 2KG6A 2FHSC 1AYIA 3BVHA 2Z4EA 2DNWA 4H0LC 5KKZC 1ZNVA 2QNWA 1PEMA 3VMZA 5KLVD 2LTEA 1PEQA 1EQ7A 2P9XA 5KLIC 2PEIA 1VQLP 2EHTA 5AW8B 1OVRA 4D6TD 2WSSH 1IFNA 3AE8C 5APQA 1MUUA 2NZ2A 4NEOA 3MP7B 1SQQJ 3L72G 3T97B 1IMPA 3P32A 1K05A 2Q6QA 5TISH 2HODB 2Q3EA 3L73J 2R5DA 3H1KE 3RK2C 3AE9C 2VLNA 1VQ4P 2PP6A 1UNKA 2W6AA 2L0QA 1SS1A 1KILE 1LGHB 2JB0A 1CI6B 4U7JA 3HTKA 3VP8A 5AVVB 5AW5B 1JEKA 1MKMA 5AW4B 1ZOYC 4EOTA 3G6EP 1GL2A 1AFOA 3C8VA 3WU2E 4EYYQ 1VDFA 2HPCB 3HRNA 1NU1D 2ROQA 2FQ2A 3JCUE 3Q5RA 3CCQP 5AVSB 1L0IA 1NTZE 1JY2N 2P58A 2K9JA 1NWQA 3T97A 2KXPB 1NYHA 2O01N 1LT1A 2ITAA 3E2DA 1DH3A 4WYMA 3CE7A 3WMM0 1FJPA 1ZMBA 4OGQB 2AEMA 2YIUC 3BATA 3L70J 4Y28J 3H1JE 1VQ8P 5KLVK 3S1KA 1GZLA 3DS3A 1S4XA 2O01H 2MKVA 4PD4H 2FYNC 1W2EA 1BCCJ 1AJYA 1FZAA 2J5UA 1JM0A 1PP9G 2KOGA 3WUVA 1KFMA 2K94A 1IJDB 2N1TA 2E75B 3O6QB 1HY8A 1KC8Q 2QJPB 2O1JA 3AEBC 1EZVE 1SQVG 3V5BA 2EHSA 3JSVC 1H8AA 2WSFH 3H1HD 1SQPD 2OTLP 3WUTA 2Z46A 3ABVC 1Y47A 1H0TB 2MF4A 1ZV8A 3DTJA 2N6YA 1SQQG 4AYCA 2Q5UA 3MUDA 5AW0B 3RK3C 2K0XA 1HJ0A 4AQRD 1FE6A 2GZIA 1PGPA 3FGAD 2R44A 2CPSA 3L73G 4LGDE 1LNQA 3M9QA 1PGOA 4PV1C 5DJUB 1RQVA 1LTAC 3CC4P 1M7LA 2WT7B 3L75J 4RESB 2E74C 3HE5B 3L74J 2KI7B 3D6YA 3SWKA 5EFWB 4PXHB 4I2LC 2A06D 4H0LD 4U0BA 1JCCA 2JBGA 1HVVA 3ITKA 1M1KQ 1NTKG 5KLVE 3HD7B 2MR7A 4U0AA 1BE3D 2IBZG 2KLUA 1OIPA 1S2EA 1VQNP 5B66E 1J1DB 2JO0A 2N98A 1E5WA 2VLQA 2MR8A 4MRTC 1VQ6P 3P8CD 4D6TE 1H0TA 2E42A 2AFDA 2C0WA 3A0BH 2FBWC 1EDLA 1L0ND 3TF5A 1R5LA 1HUCA 3AE4C 1GL2C 5CCHD 1USDA 2WPQA 3L4FA 3RK2D 1T8KA 3M9HA 3IN6A 3L70G 3DPHA 2R32A 3IF4A 2FKWB 2FYZA 1HQBA 2D2CB 5KTBA 1P84E 1SFCA 1KN7A 2O3JA 3B5NB 1SQPK 3Q5PA 3M1MA 2K3RA 5AVTB 2JU1A 3TNUB 2JAZA 2ONTA 1A43A 1NU1E 1M8OB 1NKNA 2L5GB 1CZQA 1H88A 5EW5E 1YJ9P 3H1LJ 2N1TC 3E1RA 1VL2A 1KZUB 3H1IG 5B5EE 1SQBJ 2KNCA 3LIDA 3NTEA 1L0LD 2KGEA 3HUSB 4Z1MH 3L75G 1EZVI 1X3OA 3L74G 3MUDC 2PEMA 3CC2P 2WMMA 4WY4A 2GYKA 2X2BA 1M6NA 1FR2A 3CLQA 1GXHA 3E1IA 3G4SP 2OYHA 4ASWA 3B4QA 3B5NA 2POHA 1OWAA 3H6PA 3C9IA 1M56D 1AQTA 2QJYB 3KHUA 2HLOA 2YNYA 1JTHB 1R8EA 4XE5B 1SQPE 1RF1B 2N50A 2H89C 3N7NA 2YKQA 3HE4B 4N78D 3Q2YA 1UJZA 1AVOA 2FYUK 2QJPC 3TDKA 4QMAA 5KKZB 2FYUJ 4C7NB 3TGUJ 2OYOA 1Y9BA 1IK9A 1Q82Q 4L74A 2IZ0A 4BWNA 2WITA 1URQD 3HUSA 5F2NA 5KLIB 2QVAA 1KYOD 2UWJE 2XNXA 1JY2P 1FS0E 2YO2A 2H7HA 4PWVB 4H44C 2XT1A 1OX3A 5GTIE 1S5LH 2K2QA 5BS1A 2A06E 4XFJA 4UB8H 2JEEA 2GUSA 3H25A 1BE3E 1AF8A 4JF7A 2ZFCA 3AEGC 5E79E 3KXDA 1PGQA 1BXIA 1VQ9P 4I1LA 4U3FD 2BCCJ 2MJZA 3H1LG 2RN0A 1SFCC 3HD7C 4XRQA 1DV5A 1BGYJ 1L0LK 1SQBG 2XDJA 1GTWA 1GL2D 3H47A 1PL5A 5GTHE 2VLPA 1P84I 2QG4A 1NTMG 3H1KD 3IR9A 3BCCJ 5KAIE 2ZXEB 4JYCA 5KP6B 1LJ2A 2O1KA 4IL6H 1D1DA 3FXDA 3AE7C 2K88A 4XFYA 2JDIH 1ZR2A 3W67A 1PPJD 1RQUA 4WY4C 2PRRA 2JR8A 4KT0J 3SFEC 3TK1A 1U7MA 2HYNA 4NPDA 2D2CC 2CK3H 2AXTE 2VSQA 1J1EC 3BRTB 2YIUB 2ZYGA 1SP4A 3B5NC 4CA3A 3KZIH 2N1TD 1EC5A 5H2FH 5BS2A 3L72J 2QE7H 2FYNB 1SQXG 1QRJA 1AVYA 1A8OA 1G1JA 1JCDA 1K8AQ 2WPTA 3D71A 1L0LE 3A0HE 4M0IA 5DJTB 3H1JD 3QWOC 1OXZA 2KOOA 3CWBG 1KORA 1JY3O 3CCLP 5HGMA 3DS1A 1T2KD 1IFJA 2OTKE 2V7QJ 3RK3B 3GLMA 3HUSC 1X0TA 3PP5A 1IO4A 2IPPA 1EZVD 3CCMP 1NOHA 3GKLC 5AVYB 2YO3A 1D7MA 1JY3N 1SLQA 2BCCG 3V4QA 2M3EA 4PV1B 4QNBA 1VQMP 2IFMA 5CZDB 4N78E 2N5HA 3OJAB 2E74B 3RK3E 1RE3A 4BXLA 2GM4A 4XA4A 3BRVB 3G21A 4W7ZA 1BDDA 1USEA 2CNRA 3VMAA 4HB1A 1KB9E 1KYOE 1FU1A 4H44D 1X79B 4HKGA 4F37A 3HTKB 3L71G 3G0VA 2KODA 1IK7A 1BCCD 1MFTA 1PP9J 1QL1A 5AW6B 1FOSF 1CEIA 2Q3IA 2L6EA 2XZ0D 1GL2B 1SQVJ 2MD9A 5K5GB 2PAJA 1E0HA 4U3FE 3FXEA 2KSJA 4Y99C 1SQQK 2QRXA 2IYPA 3WU2H 1NAFA 3HD7D 2K9JB 2KK7A 3CX5D 3B5IA 2KIKA 4TT3H 1VPCA 3JCUH 4LLHA 2K37A 5AW9B 4DJGA 1FDMA 3EQ2A 1IUQA 1S5LX 3AEAC 1NAYA 2WSEH 4IFFA 4JPZB 4W7YA 5CBOA 3VP9A 4PJ0E 4ZKPA 1IFPA 2ZVOB 1QLED 3G28A 2WPVB
chains in the Genus database with same CATH topology
2JYLA 2EG5A 4U0AA 3CCQP 2PEMA 1M90Q 3CC2P 3DS0A 2EIAA 2PEOA 3CXCO 2Z45A 3H47A 4COPA 2XXMA 5F2KA 1S72P 1YITP 1M6NA 3CCEP 1VQNP 1EOQA 2JO0A 4QNBA 5I4TG 1VQMP 1KQSO 2QA4P 3LRYA 1VQ5P 3G4SP 1VQ6P 2CWOA 3E2DA 4WYMA 4GR6A 1ZMBA 3G1IA 3CCSP 1QVGO 1PEMA 2PEKA 3DS2A 1W2BO 1BAJA 1PEQA 2EFJA 3CC7P 1Q86Q 5HGNA 2P9XA 3G21A 1AUMA 3CPWO 1QVFO 2PEIA 1D1DA 1VQ8P 1VQLP 3G71P 3DS3A 3Q20A 4COCA 1VQOP 1NJIQ 1PEOA 4XFYA 1N8RQ 1M74A 1JJ2O 3VRLC 1YIJP 1RO0A 5HGOA 3DPHA 2M8NA 1K9MQ 1KC8Q 3G26A 3G0VA 2OTJP 3I55P 4U0DA 1K73Q 1PEUA 2KODA 1RO2A 2BHVA 1YJNP 2QEXP 1Q82Q 1YJWP 2M8PA 2OTLP 2L6EA 2PEQA 2Z46A 5F2NA 2JYGA 3CCUP 3H0DA 1YI2P 3CMAP 1VQKP 4IPYA 5BS2A 3DTJA 5DCKA 4U0EA 1YHQP 2XV6A 3P05A 3I56P 1RNIA 2BUOA 1VQ7P 2M8LA 1QRJA 3M1MA 2XT1A 1A8OA 2PEJA 5BS1A 2BQ1E 3HZQA 1K8AQ 2PENA 3RG6C 1VQ4P 1EIAA 4XROA 2ONTA 4U0FA 4PH0A 5F2OA 1A43A 4M0IA 3CMEP 3B5IA 4XFZA 2Z44A 3CCRP 1VQPP 2E1MA 3WBHA 3CCVP 1Q7YQ 4GR2A 1E6JP 4U0CA 1YJ9P 3CD6P 1IUQA 4PH1A 3CCLP 5HGLA 3CC4P 5HGMA 3OW2O 2LF4A 2PY8A 3DS1A 1Q81Q 5JPAA 3CCJP 3DS4A 1KD1Q 3G1GA 1VQ9P 1M6EX 3H4EA 3G6EP 1K30A 3DS5A 4U0BA 3NTEA 3G29A 2OARA 3CCMP 3HYBA 2DGYA 1M1KQ 3MGEA 3G28A 4XRQA 4XFXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQP P;  3CCR P;  3CC7 P;  3CCQ P;  1Q86 Q;  2QEX P;  1Q82 Q;  1QVF O;  3CCV P;  3CPW O;  1YJW P;  1M90 Q;  3CC2 P;  1VQ8 P;  1VQL P;  2OTL P;  3G71 P;  3CXC O;  1Q7Y Q;  1YJ9 P;  3CD6 P;  1VQO P;  1S72 P;  3CCU P;  1YIT P;  3CCE P;  3CCL P;  1YI2 P;  3CMA P;  1NJI Q;  3CC4 P;  1VQN P;  3OW2 O;  1N8R Q;  1VQK P;  1JJ2 O;  1Q81 Q;  1VQM P;  1YHQ P;  1KQS O;  2QA4 P;  3CCJ P;  3I56 P;  3G4S P;  1VQ5 P;  1KD1 Q;  1VQ6 P;  1VQ7 P;  1YIJ P;  1VQ9 P;  3G6E P;  1K9M Q;  3CCS P;  1KC8 Q;  1K8A Q;  1QVG O;  1VQ4 P;  2OTJ P;  3I55 P;  3CCM P;  1K73 Q;  1M1K Q;  1W2B O;  3CME P;  1YJN P; 
#chains in the Genus database with same CATH topology
 2LKM A;  1JMB A;  2EIA A;  1P84 D;  2KZJ A;  1NTK K;  1GXG A;  2G3A A;  1G2C B;  2B87 A;  1JY2 O;  2W8Z A;  4BPG A;  2N1T B;  3GMA A;  1NTK J;  4OVN F;  1OW6 A;  1GMJ A;  1LWU A;  2JP3 A;  3CXH E;  2HG5 D;  4IFM A;  4GR6 A;  1TU3 F;  2M0B A;  1A02 F;  1AA0 A;  1PPJ E;  2IZ1 A;  2R3C A;  3F89 A;  2PEK A;  3DS2 A;  4LC1 A;  5BU8 B;  2NO8 A;  5AVR B;  2D2C D;  2FAE A;  2FVE A;  2KUB A;  3B5N D;  2N9Y B;  3Q20 A;  1T8Z A;  1OZH A;  2C9L Y;  2XU6 A;  1SQQ E;  5CJ4 A;  3VMX A;  4IL6 X;  3AE1 C;  2KG9 A;  3I55 P;  1YJN P;  3L73 E;  1YJW P;  7CEI A;  5BVZ A;  2GZG A;  2GA1 A;  2YMY A;  2MVV A;  2LXB A;  2WQY C;  4H2X C;  3E7K A;  1RE3 C;  1ZN5 A;  2O01 J;  4M3L A;  3K5B A;  1VQ7 P;  3TYY A;  4YXW H;  1G2C A;  1PIX A;  2B88 A;  2KR5 A;  1DNY A;  1LTJ A;  2L91 A;  3MZW B;  2WSF J;  5HGL A;  5B66 H;  1KD1 Q;  1KB9 I;  1KYO I;  1T3U A;  4H44 B;  1FAV A;  4D6T J;  2ZT9 C;  1NTZ G;  3H1I J;  1EDK A;  2ZYA A;  5F2K A;  4WWI A;  1LTI C;  1HGZ A;  5AW2 B;  1WRG A;  2JQ4 A;  1G1I A;  3CCS P;  2NPS A;  2Y0D A;  3D70 A;  1BAJ A;  1SFC B;  1OVU A;  2KOP A;  1L4A A;  1BCC E;  1JO5 A;  1QVF O;  1OW8 A;  1BSH A;  5KJ7 A;  2ZYD A;  1P84 H;  1J2J B;  1CW5 A;  3RBZ A;  2AVA A;  2LIW A;  1NVO A;  2IFN A;  1EZV G;  3G26 A;  1RY3 A;  2OTJ P;  4U0D A;  2KLV A;  3CX5 E;  4EIJ A;  1KV4 A;  1LWU C;  2CQ8 A;  1M1J A;  2E76 B;  3AED C;  1X22 A;  2KNC B;  3RG2 A;  1JY3 P;  1BDC A;  1VKU A;  1FZB A;  2FYU D;  1RNI A;  4I7Z C;  3WUU A;  3TGU D;  1FZC A;  2PEJ A;  3V2Q A;  5B5E H;  2KWL A;  3MTU E;  3CXH I;  4BRY A;  2N5I A;  4H2W C;  4WY4 B;  3U59 A;  3H32 A;  3CCV P;  1GK4 A;  2LML A;  3L74 E;  2OYH B;  1J1E B;  1WMK A;  1UII A;  2K9Y A;  3C1L A;  3DS4 A;  2ZVN B;  2AEF A;  2RH0 A;  5KLV G;  3G29 A;  2BEZ F;  3ZDM A;  4XFX A;  3P7K A;  2WTY A;  3AE3 C;  1N7L A;  4COP A;  1YTZ I;  1LP1 A;  3AEF C;  3CCE P;  4W80 A;  2AEJ A;  3H1H J;  2CGQ A;  4D6T G;  1SQB K;  2H88 C;  4GKG A;  2FVA A;  1RH5 B;  1LTJ C;  2P7J A;  2OGU A;  3FWN A;  2OYI A;  1BGY D;  2Y0C A;  2WPR A;  2IDB A;  3MD0 A;  1NTM J;  1DX7 A;  2EFJ A;  5APT A;  1Q86 Q;  2W6J H;  4C7R A;  2Y9Y A;  3BCC D;  5L8R J;  3AE5 C;  5CBN A;  3PRJ A;  1NJI Q;  4N6J A;  3R4Y A;  1JJ2 O;  2A45 H;  1RO0 A;  2M8N A;  1KQG B;  5GTI H;  1PEU A;  2ZJS E;  1N73 A;  4K3A A;  1ZW0 A;  2PEQ A;  5C39 A;  2YKP A;  2W6B A;  3LIE A;  3NXS A;  2K1A A;  4I6M C;  1EXI A;  5E79 H;  2W83 C;  3EFG A;  3RK3 D;  1L4A C;  2BQ1 E;  1RF0 A;  1JMM A;  5KJ7 C;  1NU1 G;  2JKV A;  2MY5 A;  1SQX K;  4U0F A;  3H1L E;  1VQP P;  3L72 D;  1SQX J;  3GW6 A;  2QJK B;  2JJL A;  2NRG A;  1Q7Y Q;  5KAF E;  1HWT C;  4PD4 I;  1L0N J;  1YQ4 C;  4PV1 D;  1OFC X;  3OW2 O;  2LF4 A;  5GTH H;  2Y0E A;  1KB9 D;  3EFF K;  3SWY A;  3R2P A;  1EDI A;  2XZ1 C;  2E74 D;  2FFD B;  1IFD A;  3CWB J;  4K35 A;  5KAI H;  5APX A;  4ASV A;  4Y99 B;  5TJH A;  3CX5 I;  1SVF A;  2Z45 A;  1IFI A;  3MHV A;  1FZC C;  4O9B A;  1EXJ A;  5I4T G;  2RMZ A;  4YXD C;  1VQ5 P;  3AE6 C;  3IFM A;  1OW7 A;  3G9R A;  5APS A;  1PV3 A;  3S9O A;  2L9F A;  3H1H G;  1SQP G;  2PNG A;  1JOC A;  2AXT H;  4JQ0 D;  5CCG A;  2FYU E;  3TGU E;  2W27 A;  2J59 M;  2H43 A;  2KSE A;  2FFD A;  2WSC H;  3A0H H;  2M8P A;  1ZXG A;  1Z56 A;  2A45 G;  2E76 C;  4UB6 E;  3CCU P;  1FDI A;  3L71 J;  3CI9 A;  4IPY A;  1AQ5 A;  2A06 G;  3M06 A;  3L36 A;  1PP9 D;  3CXH D;  3VN0 A;  2QM7 A;  4DT0 A;  1EMV A;  4UHP B;  1BE3 G;  1SQV D;  4XFZ A;  1PZQ A;  2OYH C;  3MGN A;  2PY8 A;  3PLN A;  3V2R A;  3CCJ P;  1N73 C;  3G1G A;  5CCH A;  1SQQ D;  2E5T A;  3L37 A;  2KGC A;  4L73 A;  2Y9Z A;  1BGY E;  4RJT A;  1L0N G;  3MGE A;  3L73 D;  2L22 A;  2EG5 A;  2QIW A;  1M90 Q;  3BCC E;  1QX8 A;  3P8M C;  2KOS A;  1RF0 C;  4KHX A;  1FOS E;  1KQS O;  4HYT B;  2P2U A;  3GG2 A;  2V4H A;  5APV A;  1KLP A;  1KB9 H;  1KYO H;  1LTT C;  2FQ1 A;  3G1I A;  1IMQ A;  4R4L A;  1NTK D;  2ZT9 B;  2FXO A;  2IBZ D;  3RL0 g;  4COC A;  1ACP A;  1PEO A;  4AUW A;  1PGJ A;  2CG5 B;  1S3J A;  1K9M Q;  1L4A D;  1LT9 B;  5KJ7 D;  4GOD A;  4U3F J;  1T6A A;  2KS1 A;  2M5R A;  4L76 A;  3L72 E;  2QM8 A;  3VYI A;  3H0D A;  1JNM A;  1N86 A;  2P1J A;  2GDY A;  4RO0 A;  3V2P A;  3JC2 2;  1R5S A;  3L70 D;  1L0L G;  3H1K J;  3HZQ A;  2LPK A;  1OVV A;  4PJ0 H;  3I5C A;  3U1C A;  5CCG C;  3CME P;  2QJK C;  2B87 B;  4PD4 D;  1KMI Z;  4GR2 A;  1SQV K;  1LWU B;  2JO1 A;  3GF7 A;  2FFD C;  1GW4 A;  3DS5 A;  2YXQ B;  4I7Z B;  1NQ4 A;  3GHG B;  2LXC B;  3CXH H;  1HJB A;  3M0D A;  1U7J A;  2P10 A;  3RGU A;  1SFC D;  1JUN A;  1LT9 A;  5EJD A;  3FX0 A;  2XXM A;  3Q1M A;  1GPJ A;  1NTZ K;  1ZLL A;  1X8Y A;  2R5B A;  4RKU J;  4MN4 C;  2QA4 P;  1NTZ J;  1IZN B;  1URQ A;  1FZG A;  3H1I D;  2WSE J;  4ZKU A;  4EDF A;  1RE4 A;  3G3Z A;  3B71 A;  2K93 A;  4YPC A;  1KIL B;  1HBW A;  3L75 D;  1KQL A;  3CPW O;  2JWD A;  5CCH C;  3L74 D;  1GD2 E;  2E76 D;  1WT6 A;  3GZM A;  3H1J J;  1N7S B;  1OMI A;  5HGO A;  1PP9 E;  1LTJ B;  1IC2 A;  4H13 B;  4WY4 D;  3F5H A;  3VOP A;  2KP8 A;  1DD3 A;  1MZ8 A;  1SQV E;  3PTZ A;  3GHG A;  2J58 A;  1MZ9 A;  2KZI A;  5APY A;  4U3F G;  5AW3 B;  2H8P D;  2M8L A;  1GK6 A;  4BPH A;  1Q2N A;  1ZME C;  2DW3 A;  2YMK A;  1VF5 C;  4R4M A;  3RG6 C;  1FZF A;  3CCR P;  5TIS E;  2KOR A;  2XKM A;  5KP7 B;  1E6J P;  3H1K G;  4PH1 A;  1KIL A;  1Q81 Q;  5KP8 B;  2HOD A;  2NPS B;  1HGV A;  1E79 H;  3RL0 B;  1L4A B;  3NY7 B;  3Q3D A;  1N7S A;  4YTP C;  4BPF A;  1W5C E;  1ZP0 C;  2Q9I A;  2C9N Y;  4KJM A;  3V6I A;  1QEX A;  1NTK E;  3BAS A;  2JU2 A;  3NFQ A;  1CI6 A;  2IBZ E;  1XTG B;  5KLV J;  2GDX A;  1ZRT E;  3EJD A;  1EOQ A;  2CWO A;  4HH2 A;  1T3J A;  1PPJ G;  2WWW A;  3SSU A;  2YXR B;  1YBK A;  3H1L D;  3UIA A;  1M1J B;  2I1K A;  5HV8 A;  1NGM B;  3MIW A;  2HPC A;  2K0Y A;  3IAO A;  4IZ6 A;  3G71 P;  3CX5 H;  1SQB D;  2WPS A;  3GF3 A;  5BU5 A;  3SWF A;  1FZC B;  3M0D C;  5AVX B;  1NTM D;  4BRY B;  2KB7 P;  1LT9 C;  2WZ7 A;  3EWK A;  3L70 E;  1DIP A;  3H32 B;  3AEE C;  1GW3 A;  1OR5 A;  1FDO A;  5CCG D;  2BAS A;  2XV5 A;  3H1J G;  1URQ C;  4PD4 E;  2P67 A;  4C46 A;  3M91 A;  1NO4 A;  1MFZ A;  3CMA P;  2Z5H A;  2K0D X;  1RE4 C;  3CL3 D;  4U0E A;  2XV6 A;  3I56 P;  3KDP B;  2SPZ A;  3OAK A;  2XZR A;  2LKI A;  1GU5 A;  4QKO A;  2Z44 A;  1LP1 B;  3O6Q A;  2BEQ D;  1NU1 K;  2KGD A;  3QH9 A;  1KTM A;  2WVR A;  1NU1 J;  2VRS A;  3VMY A;  2OYI B;  2C0X A;  3H1I E;  1SQX D;  3GHG C;  2JGP A;  1JB0 J;  2FQ0 A;  4R0M A;  5AVU B;  3A7O A;  2IYO A;  2LL8 A;  3L75 E;  2PEO A;  3CXC O;  3KYQ A;  3NMD A;  1K04 A;  1YIT P;  1BSN A;  1DD4 A;  3CWB D;  2I1J A;  5M1B A;  1GU4 A;  3A5T A;  4HJG H;  5HVC A;  1YTZ T;  1N73 B;  3U1A A;  2WT7 A;  1Z6M A;  3B8E B;  3HE5 A;  2KOQ A;  1LTG C;  1KIL C;  1BCC G;  5AVW B;  2CPB A;  1X9V A;  3CC7 P;  4GOE A;  4ZMD A;  1AUM A;  2BCC D;  4DG9 A;  3HD7 A;  1VQO P;  1NKZ B;  1N7S C;  1FC2 C;  3S4R A;  1SQP J;  4TLF A;  4H2Y C;  3A0B E;  4EI2 A;  3A2A A;  1ZR4 A;  4H13 C;  1NTM K;  1GDT A;  2I8D A;  3FWL A;  1VF5 D;  2Q7C A;  3RBX A;  2B89 A;  2GZE A;  5APU A;  2KYV A;  2QEX P;  2GUV A;  1QGK B;  2B9B A;  2FXM A;  3TSI A;  2PFX A;  1YI2 P;  5KAF H;  2IBZ I;  5DCK A;  3P05 A;  2BUO A;  3SFD C;  1N2D C;  2PEN A;  3PJS K;  4XRO A;  3L71 D;  4PH0 A;  3GJN A;  4CPG A;  2ZXX A;  3WBH A;  2GZF A;  5AW1 B;  5AVZ B;  4U0C A;  3M9B A;  3PHL A;  1T2K C;  1BE3 J;  2NPS C;  1HH0 A;  4OGQ C;  3RL0 C;  5AW7 B;  4WBA A;  1QL2 A;  2OAR A;  3HYB A;  2DGY A;  4ZNC A;  1PFI A;  3KPE A;  2ZT9 D;  2M8R A;  2JYL A;  3H1H E;  3TNU A;  2HFE D;  1L0N K;  2IX7 C;  3U43 A;  1RHZ B;  2HR3 A;  3USS A;  4GDO A;  1SQB E;  2ZAE B;  3LW5 H;  2E5Y A;  3LW5 J;  1S9K D;  1NTM E;  2LOL A;  2E75 C;  2M5A B;  4H0L B;  1LTB C;  1QVG O;  1M1J C;  1DEE G;  1W2B O;  4IFD K;  3NTN A;  1DEB A;  2G8Y A;  4L75 A;  2LIU A;  4NPE A;  4UB6 H;  3GZL A;  2JWA A;  4DOJ A;  3O8Z A;  1VHN A;  2N9B A;  1KQF B;  1K73 Q;  2YKO A;  2GDW A;  2BHV A;  3V2N A;  2GZJ A;  4OH8 B;  4JYB A;  4GT1 A;  2OQQ A;  4DZO A;  4WVZ A;  4GIF A;  1JTH A;  4B86 A;  3EJB A;  3II6 A;  1YHQ P;  2ERH A;  5APW A;  2LR2 A;  5AVQ B;  3RK2 B;  1RF1 A;  4IOI H;  3P8C E;  1LTS C;  3V4W A;  2AXC A;  1SQX E;  3HE4 A;  4N3Y B;  3OA7 A;  2Q1K A;  3Q5S A;  1EIA A;  1L0N E;  5F2O A;  1Y8A A;  1UIX A;  1CSB A;  2M5A A;  1NHL A;  4OWF A;  2WSC J;  4C7N A;  3EJE A;  1NH4 A;  2K92 A;  1J1D C;  1L0L J;  3CD6 P;  1L2P A;  1U57 A;  3KQG A;  2OYI C;  4HKZ H;  3CWB E;  5JPA A;  2W90 A;  1S5L E;  3H4E A;  4UB8 E;  1S1C X;  3AE2 C;  3AEC C;  3M0A A;  2KGA A;  1L0H A;  1KIL D;  1HTL C;  1VF5 B;  3L35 A;  1AV1 A;  4NPF X;  3DS0 A;  2AFE A;  2FY8 A;  1F80 D;  2FVF A;  2BCC E;  1N7S D;  3LRY A;  2PGD A;  2E43 A;  2N6Z A;  2KS1 B;  4H13 D;  1HF9 A;  4DCK A;  3W68 A;  2FXP A;  1FJK A;  5CHX A;  5HGN A;  1NTZ D;  2FAD A;  1H89 A;  3VTP C;  2QSI A;  4A7P A;  2FYU G;  1N8R Q;  2KG8 A;  1M74 A;  3VRL C;  3TGU G;  1YIJ P;  1FBM A;  1YQ3 C;  5CJ0 A;  2MVU A;  1RO2 A;  4IL6 E;  3LMO A;  3L71 E;  5CMZ A;  1MV8 A;  1XTC C;  1EDJ A;  1Q90 D;  2JYG A;  1ZRT D;  2Z5I A;  1VQK P;  1A02 J;  3A3Y B;  3D6Z A;  2V7Q H;  2NPS D;  4OGQ D;  3RL0 D;  1M57 D;  2AF8 A;  4GOF A;  2RKL A;  4JBZ A;  2R3S A;  2E1M A;  3KZI E;  5H2F E;  2FAC A;  2L4B A;  1URQ B;  1FZE A;  2VLO A;  3N4X A;  2A45 I;  1IFM A;  1YYC A;  4WB4 A;  1M6E X;  1S9K E;  1BGY G;  1K30 A;  2QJY C;  3PH0 A;  2E75 D;  2K5X A;  3B4S A;  2KW2 A;  1KFN A;  3BCC G;  1RF1 C;  2XND H;  1S72 P;  2M3B A;  2KG6 A;  2FHS C;  1AYI A;  3BVH A;  2Z4E A;  2DNW A;  4H0L C;  5KKZ C;  1ZNV A;  2QNW A;  1PEM A;  3VMZ A;  5KLV D;  2LTE A;  1PEQ A;  1EQ7 A;  2P9X A;  5KLI C;  2PEI A;  1VQL P;  2EHT A;  5AW8 B;  1OVR A;  4D6T D;  2WSS H;  1IFN A;  3AE8 C;  5APQ A;  1MUU A;  2NZ2 A;  4NEO A;  3MP7 B;  1SQQ J;  3L72 G;  3T97 B;  1IMP A;  3P32 A;  1K05 A;  2Q6Q A;  5TIS H;  2HOD B;  2Q3E A;  3L73 J;  2R5D A;  3H1K E;  3RK2 C;  3AE9 C;  2VLN A;  1VQ4 P;  2PP6 A;  1UNK A;  2W6A A;  2L0Q A;  1SS1 A;  1KIL E;  1LGH B;  2JB0 A;  1CI6 B;  4U7J A;  3HTK A;  3VP8 A;  5AVV B;  5AW5 B;  1JEK A;  1MKM A;  5AW4 B;  1ZOY C;  4EOT A;  3G6E P;  1GL2 A;  1AFO A;  3C8V A;  3WU2 E;  4EYY Q;  1VDF A;  2HPC B;  3HRN A;  1NU1 D;  2ROQ A;  2FQ2 A;  3JCU E;  3Q5R A;  3CCQ P;  5AVS B;  1L0I A;  1NTZ E;  1JY2 N;  2P58 A;  2K9J A;  1NWQ A;  3T97 A;  2KXP B;  1NYH A;  2O01 N;  1LT1 A;  2ITA A;  3E2D A;  1DH3 A;  4WYM A;  3CE7 A;  3WMM 0;  1FJP A;  1ZMB A;  4OGQ B;  2AEM A;  2YIU C;  3BAT A;  3L70 J;  4Y28 J;  3H1J E;  1VQ8 P;  5KLV K;  3S1K A;  1GZL A;  3DS3 A;  1S4X A;  2O01 H;  2MKV A;  4PD4 H;  2FYN C;  1W2E A;  1BCC J;  1AJY A;  1FZA A;  2J5U A;  1JM0 A;  1PP9 G;  2KOG A;  3WUV A;  1KFM A;  2K94 A;  1IJD B;  2N1T A;  2E75 B;  3O6Q B;  1HY8 A;  1KC8 Q;  2QJP B;  2O1J A;  3AEB C;  1EZV E;  1SQV G;  3V5B A;  2EHS A;  3JSV C;  1H8A A;  2WSF H;  3H1H D;  1SQP D;  2OTL P;  3WUT A;  2Z46 A;  3ABV C;  1Y47 A;  1H0T B;  2MF4 A;  1ZV8 A;  3DTJ A;  2N6Y A;  1SQQ G;  4AYC A;  2Q5U A;  3MUD A;  5AW0 B;  3RK3 C;  2K0X A;  1HJ0 A;  4AQR D;  1FE6 A;  2GZI A;  1PGP A;  3FGA D;  2R44 A;  2CPS A;  3L73 G;  4LGD E;  1LNQ A;  3M9Q A;  1PGO A;  4PV1 C;  5DJU B;  1RQV A;  1LTA C;  3CC4 P;  1M7L A;  2WT7 B;  3L75 J;  4RES B;  2E74 C;  3HE5 B;  3L74 J;  2KI7 B;  3D6Y A;  3SWK A;  5EFW B;  4PXH B;  4I2L C;  2A06 D;  4H0L D;  4U0B A;  1JCC A;  2JBG A;  1HVV A;  3ITK A;  1M1K Q;  1NTK G;  5KLV E;  3HD7 B;  2MR7 A;  4U0A A;  1BE3 D;  2IBZ G;  2KLU A;  1OIP A;  1S2E A;  1VQN P;  5B66 E;  1J1D B;  2JO0 A;  2N98 A;  1E5W A;  2VLQ A;  2MR8 A;  4MRT C;  1VQ6 P;  3P8C D;  4D6T E;  1H0T A;  2E42 A;  2AFD A;  2C0W A;  3A0B H;  2FBW C;  1EDL A;  1L0N D;  3TF5 A;  1R5L A;  1HUC A;  3AE4 C;  1GL2 C;  5CCH D;  1USD A;  2WPQ A;  3L4F A;  3RK2 D;  1T8K A;  3M9H A;  3IN6 A;  3L70 G;  3DPH A;  2R32 A;  3IF4 A;  2FKW B;  2FYZ A;  1HQB A;  2D2C B;  5KTB A;  1P84 E;  1SFC A;  1KN7 A;  2O3J A;  3B5N B;  1SQP K;  3Q5P A;  3M1M A;  2K3R A;  5AVT B;  2JU1 A;  3TNU B;  2JAZ A;  2ONT A;  1A43 A;  1NU1 E;  1M8O B;  1NKN A;  2L5G B;  1CZQ A;  1H88 A;  5EW5 E;  1YJ9 P;  3H1L J;  2N1T C;  3E1R A;  1VL2 A;  1KZU B;  3H1I G;  5B5E E;  1SQB J;  2KNC A;  3LID A;  3NTE A;  1L0L D;  2KGE A;  3HUS B;  4Z1M H;  3L75 G;  1EZV I;  1X3O A;  3L74 G;  3MUD C;  2PEM A;  3CC2 P;  2WMM A;  4WY4 A;  2GYK A;  2X2B A;  1M6N A;  1FR2 A;  3CLQ A;  1GXH A;  3E1I A;  3G4S P;  2OYH A;  4ASW A;  3B4Q A;  3B5N A;  2POH A;  1OWA A;  3H6P A;  3C9I A;  1M56 D;  1AQT A;  2QJY B;  3KHU A;  2HLO A;  2YNY A;  1JTH B;  1R8E A;  4XE5 B;  1SQP E;  1RF1 B;  2N50 A;  2H89 C;  3N7N A;  2YKQ A;  3HE4 B;  4N78 D;  3Q2Y A;  1UJZ A;  1AVO A;  2FYU K;  2QJP C;  3TDK A;  4QMA A;  5KKZ B;  2FYU J;  4C7N B;  3TGU J;  2OYO A;  1Y9B A;  1IK9 A;  1Q82 Q;  4L74 A;  2IZ0 A;  4BWN A;  2WIT A;  1URQ D;  3HUS A;  5F2N A;  5KLI B;  2QVA A;  1KYO D;  2UWJ E;  2XNX A;  1JY2 P;  1FS0 E;  2YO2 A;  2H7H A;  4PWV B;  4H44 C;  2XT1 A;  1OX3 A;  5GTI E;  1S5L H;  2K2Q A;  5BS1 A;  2A06 E;  4XFJ A;  4UB8 H;  2JEE A;  2GUS A;  3H25 A;  1BE3 E;  1AF8 A;  4JF7 A;  2ZFC A;  3AEG C;  5E79 E;  3KXD A;  1PGQ A;  1BXI A;  1VQ9 P;  4I1L A;  4U3F D;  2BCC J;  2MJZ A;  3H1L G;  2RN0 A;  1SFC C;  3HD7 C;  4XRQ A;  1DV5 A;  1BGY J;  1L0L K;  1SQB G;  2XDJ A;  1GTW A;  1GL2 D;  3H47 A;  1PL5 A;  5GTH E;  2VLP A;  1P84 I;  2QG4 A;  1NTM G;  3H1K D;  3IR9 A;  3BCC J;  5KAI E;  2ZXE B;  4JYC A;  5KP6 B;  1LJ2 A;  2O1K A;  4IL6 H;  1D1D A;  3FXD A;  3AE7 C;  2K88 A;  4XFY A;  2JDI H;  1ZR2 A;  3W67 A;  1PPJ D;  1RQU A;  4WY4 C;  2PRR A;  2JR8 A;  4KT0 J;  3SFE C;  3TK1 A;  1U7M A;  2HYN A;  4NPD A;  2D2C C;  2CK3 H;  2AXT E;  2VSQ A;  1J1E C;  3BRT B;  2YIU B;  2ZYG A;  1SP4 A;  3B5N C;  4CA3 A;  3KZI H;  2N1T D;  1EC5 A;  5H2F H;  5BS2 A;  3L72 J;  2QE7 H;  2FYN B;  1SQX G;  1QRJ A;  1AVY A;  1A8O A;  1G1J A;  1JCD A;  1K8A Q;  2WPT A;  3D71 A;  1L0L E;  3A0H E;  4M0I A;  5DJT B;  3H1J D;  3QWO C;  1OXZ A;  2KOO A;  3CWB G;  1KOR A;  1JY3 O;  3CCL P;  5HGM A;  3DS1 A;  1T2K D;  1IFJ A;  2OTK E;  2V7Q J;  3RK3 B;  3GLM A;  3HUS C;  1X0T A;  3PP5 A;  1IO4 A;  2IPP A;  1EZV D;  3CCM P;  1NOH A;  3GKL C;  5AVY B;  2YO3 A;  1D7M A;  1JY3 N;  1SLQ A;  2BCC G;  3V4Q A;  2M3E A;  4PV1 B;  4QNB A;  1VQM P;  2IFM A;  5CZD B;  4N78 E;  2N5H A;  3OJA B;  2E74 B;  3RK3 E;  1RE3 A;  4BXL A;  2GM4 A;  4XA4 A;  3BRV B;  3G21 A;  4W7Z A;  1BDD A;  1USE A;  2CNR A;  3VMA A;  4HB1 A;  1KB9 E;  1KYO E;  1FU1 A;  4H44 D;  1X79 B;  4HKG A;  4F37 A;  3HTK B;  3L71 G;  3G0V A;  2KOD A;  1IK7 A;  1BCC D;  1MFT A;  1PP9 J;  1QL1 A;  5AW6 B;  1FOS F;  1CEI A;  2Q3I A;  2L6E A;  2XZ0 D;  1GL2 B;  1SQV J;  2MD9 A;  5K5G B;  2PAJ A;  1E0H A;  4U3F E;  3FXE A;  2KSJ A;  4Y99 C;  1SQQ K;  2QRX A;  2IYP A;  3WU2 H;  1NAF A;  3HD7 D;  2K9J B;  2KK7 A;  3CX5 D;  3B5I A;  2KIK A;  4TT3 H;  1VPC A;  3JCU H;  4LLH A;  2K37 A;  5AW9 B;  4DJG A;  1FDM A;  3EQ2 A;  1IUQ A;  1S5L X;  3AEA C;  1NAY A;  2WSE H;  4IFF A;  4JPZ B;  4W7Y A;  5CBO A;  3VP9 A;  4PJ0 E;  4ZKP A;  1IFP A;  2ZVO B;  1QLE D;  3G28 A;  2WPV B; 
#chains in the Genus database with same CATH homology
 2JYL A;  2EG5 A;  4U0A A;  3CCQ P;  2PEM A;  1M90 Q;  3CC2 P;  3DS0 A;  2EIA A;  2PEO A;  3CXC O;  2Z45 A;  3H47 A;  4COP A;  2XXM A;  5F2K A;  1S72 P;  1YIT P;  1M6N A;  3CCE P;  1VQN P;  1EOQ A;  2JO0 A;  4QNB A;  5I4T G;  1VQM P;  1KQS O;  2QA4 P;  3LRY A;  1VQ5 P;  3G4S P;  1VQ6 P;  2CWO A;  3E2D A;  4WYM A;  4GR6 A;  1ZMB A;  3G1I A;  3CCS P;  1QVG O;  1PEM A;  2PEK A;  3DS2 A;  1W2B O;  1BAJ A;  1PEQ A;  2EFJ A;  3CC7 P;  1Q86 Q;  5HGN A;  2P9X A;  3G21 A;  1AUM A;  3CPW O;  1QVF O;  2PEI A;  1D1D A;  1VQ8 P;  1VQL P;  3G71 P;  3DS3 A;  3Q20 A;  4COC A;  1VQO P;  1NJI Q;  1PEO A;  4XFY A;  1N8R Q;  1M74 A;  1JJ2 O;  3VRL C;  1YIJ P;  1RO0 A;  5HGO A;  3DPH A;  2M8N A;  1K9M Q;  1KC8 Q;  3G26 A;  3G0V A;  2OTJ P;  3I55 P;  4U0D A;  1K73 Q;  1PEU A;  2KOD A;  1RO2 A;  2BHV A;  1YJN P;  2QEX P;  1Q82 Q;  1YJW P;  2M8P A;  2OTL P;  2L6E A;  2PEQ A;  2Z46 A;  5F2N A;  2JYG A;  3CCU P;  3H0D A;  1YI2 P;  3CMA P;  1VQK P;  4IPY A;  5BS2 A;  3DTJ A;  5DCK A;  4U0E A;  1YHQ P;  2XV6 A;  3P05 A;  3I56 P;  1RNI A;  2BUO A;  1VQ7 P;  2M8L A;  1QRJ A;  3M1M A;  2XT1 A;  1A8O A;  2PEJ A;  5BS1 A;  2BQ1 E;  3HZQ A;  1K8A Q;  2PEN A;  3RG6 C;  1VQ4 P;  1EIA A;  4XRO A;  2ONT A;  4U0F A;  4PH0 A;  5F2O A;  1A43 A;  4M0I A;  3CME P;  3B5I A;  4XFZ A;  2Z44 A;  3CCR P;  1VQP P;  2E1M A;  3WBH A;  3CCV P;  1Q7Y Q;  4GR2 A;  1E6J P;  4U0C A;  1YJ9 P;  3CD6 P;  1IUQ A;  4PH1 A;  3CCL P;  5HGL A;  3CC4 P;  5HGM A;  3OW2 O;  2LF4 A;  2PY8 A;  3DS1 A;  1Q81 Q;  5JPA A;  3CCJ P;  3DS4 A;  1KD1 Q;  3G1G A;  1VQ9 P;  1M6E X;  3H4E A;  3G6E P;  1K30 A;  3DS5 A;  4U0B A;  3NTE A;  3G29 A;  2OAR A;  3CCM P;  3HYB A;  2DGY A;  1M1K Q;  3MGE A;  3G28 A;  4XRQ A;  4XFX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...