1HY8A

Solution structure of b. subtilis acyl carrier protein
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
76
structure length
76
Chain Sequence
ADTLERVTKIIVDRLGVDEADVKLEASFKEDLGADSLDVVELVMELEDEFDMEISDEDAEKIATVGDAVNYIQNQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of B. subtilis acyl carrier protein.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Lipid binding protein
molecule keywords ACYL CARRIER PROTEIN
total genus 20
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2001-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 1hy8A00
2AFEA 2FAEA 3LMOA 1DV5A 2L22A 2PNGA 1VKUA 5KP6B 4R0MA 1HQBA 2FQ2A 2AF8A 2GDXA 4HKGA 4MRTC 1L0IA 2LIUA 2CG5B 2LL8A 2N5HA 2JU2A 2LMLA 2KG8A 2KORA 2L9FA 2LPKA 2FQ1A 2XZ1C 2KOQA 2KGEA 4NEOA 4H2YC 2N5IA 2MY5A 2N6YA 4PXHB 2JGPA 1OR5A 3EJBA 2K94A 2EHTA 2KGAA 1NQ4A 2MF4A 2ROQA 1HY8A 2CGQA 5EJDA 3NY7B 2FHSC 4DG9A 2X2BA 2LIWA 5HVCA 2CQ8A 2FQ0A 2KGDA 2LOLA 2N98A 4PWVB 1X3OA 5CZDB 1T8KA 2KGCA 2EHSA 2KOOA 1DNYA 2MVVA 2FADA 2FVFA 2K2QA 2MVUA 4BPFA 2K0YA 2M5RA 2N6ZA 2KOPA 3RG2A 4BPHA 4CA3A 5KP7B 2KR5A 2KW2A 3GZMA 2K92A 2DNWA 2GDWA 2MR7A 2N50A 1F80D 2XZ0D 2CNRA 2JU1A 2KWLA 2FVAA 2L0QA 4H2XC 2KG9A 5KP8B 3CE7A 2KOSA 2KG6A 2AFDA 2LKIA 2GDYA 1KLPA 2FVEA 3EJEA 2AVAA 4H2WC 2FACA 2MR8A 2L4BA 2LTEA 5HV8A 2K93A 2VSQA 4IZ6A 4BPGA 2QNWA 3EJDA 1ACPA 2JQ4A 1L0HA 2MD9A 3GZLA 1AF8A 2K0XA
chains in the Genus database with same CATH superfamily
3DS3A 4PH0A 3CD6P 2Z46A 1UJZA 1HQBA 2PENA 3CMEP 2VLNA 2FQ2A 2AF8A 2GDXA 3DPHA 4MRTC 4U0EA 2CG5B 2GZIA 1K8AQ 3CCEP 2KORA 1GXHA 2PEJA 1M6EX 2LPKA 2FQ1A 2XZ1C 2KOQA 7CEIA 2PEMA 1RO2A 1NJIQ 1VQMP 1Q81Q 4U0DA 1OR5A 2K94A 4XFXA 2KGAA 1NQ4A 1UNKA 1AYIA 5HGOA 1QRJA 2XT1A 2OTJP 1D1DA 4COCA 2LIWA 2M8LA 1GXGA 2LOLA 1IMQA 1VQ8P 5F2KA 5CZDB 3CCJP 2E1MA 2KOOA 2P9XA 3H0DA 2FVFA 2PEKA 3G71P 4QKOA 2K92A 1K9MQ 3B4QA 3H47A 4COPA 2DGYA 2FVAA 5KP8B 1A43A 1KLPA 1S72P 2FVEA 1YJWP 4IPYA 3CPWO 1VQKP 1BAJA 2MR8A 1KC8Q 1Q82Q 4U0FA 2VSQA 1M1KQ 2QNWA 3EJDA 2JQ4A 2GZGA 2AFEA 2XXMA 2WPTA 2XV6A 2OTLP 3P05A 3CCSP 2KODA 2PNGA 1VHNA 1EOQA 2Z45A 2JYGA 1YJ9P 2N5HA 2LMLA 1YITP 4U0BA 3DS4A 2QEXP 1VQ6P 2EIAA 2JYLA 3G4SP 2N5IA 2MY5A 2K0DX 3G6EP 2JGPA 2CWOA 3EJBA 2MF4A 1HY8A 5EJDA 1VQ4P 2FHSC 4DG9A 2X2BA 4F37A 3DTJA 3Q20A 2FQ0A 3CCVP 3U43A 1T8KA 3DS5A 4QNBA 2KGCA 2EHSA 1DNYA 3LRYA 2MVVA 4GR6A 2FADA 2GZEA 3M1MA 2K2QA 3G0VA 3CCRP 2L6EA 1CEIA 2N50A 2XZ0D 2CNRA 1M90Q 1Z6MA 2EFJA 3E2DA 2KG6A 4WYMA 4UHPB 2VLQA 2FACA 1VQOP 3CC7P 4PH1A 1EIAA 5HV8A 2GZJA 3G26A 1ACPA 2ONTA 2JB0A 1AF8A 1A8OA 4U0CA 1GPJA 3LMOA 1DV5A 5BS2A 2L22A 2M8PA 1N8RQ 5KP6B 2K5XA 4R0MA 2EG5A 2LIUA 2LL8A 1VQLP 2JAZA 2KG8A 4XRQA 5DCKA 2L9FA 2KGEA 3G28A 4NEOA 4H2YC 1ZMBA 2EHTA 1BXIA 5HGNA 2CGQA 2CQ8A 3GJNA 2KGDA 2N98A 2PEOA 2NO8A 4PWVB 1X3OA 3GKLC 2PY8A 2JO0A 3MGEA 3G1IA 4GR2A 4BPFA 1ZNVA 2VLPA 2KOPA 3RG2A 3I55P 3NTEA 4BPHA 3OW2O 4CA3A 3CCUP 2QA4P 5KP7B 2KW2A 3B5IA 3HYBA 2GDWA 2VLOA 1AUMA 2JU1A 2L0QA 3G21A 1K73Q 2LKIA 3EJEA 4H2WC 2GZFA 3CCMP 2LTEA 2K93A 3CC4P 1W2BO 3CC2P 3DS1A 3I56P 3GZLA 1VQ5P 2M8NA 3CCQP 2FAEA 5I4TG 1IMPA 4M0IA 3HZQA 2JBGA 1VKUA 5HGLA 1MZ8A 3G1GA 1RNIA 4HKGA 3VRLC 1FR2A 1L0IA 1KQSO 2JU2A 1K30A 4XROA 2LF4A 5EW5E 2BHVA 2N6YA 2PEIA 5BS1A 5F2OA 4PXHB 2ROQA 1YI2P 1E6JP 3NY7B 5F2NA 5HVCA 1VQNP 2BUOA 4XFYA 2ERHA 2Z44A 3WBHA 2PEQA 4U0AA 2GYKA 1E0HA 1YJNP 5HGMA 1Q86Q 2MVUA 1YIJP 2K0YA 2M5RA 2N6ZA 1Q7YQ 3H4EA 1YHQP 1RO0A 2KR5A 3GZMA 3DS0A 2DNWA 2MR7A 1F80D 2KWLA 4H2XC 3CMAP 2KG9A 3CE7A 2KOSA 1M6NA 2AFDA 4XFZA 3RG6C 2GDYA 3CCLP 2AVAA 1VQPP 5JPAA 2L4BA 1KD1Q 3CXCO 1JJ2O 1VQ7P 1QVGO 4IZ6A 4BPGA 1M74A 1QVFO 1EMVA 1L0HA 2OARA 2MD9A 3DS2A 1VQ9P 2K0XA 1IUQA 3G29A
chains in the Genus database with same CATH topology
2AFEA 2FAEA 3LMOA 1DV5A 2L22A 2PNGA 1VKUA 5KP6B 4R0MA 1HQBA 2FQ2A 2AF8A 2GDXA 4HKGA 4MRTC 1L0IA 2LIUA 2CG5B 2LL8A 2N5HA 2JU2A 2LMLA 2KG8A 2KORA 2L9FA 2LPKA 2FQ1A 2XZ1C 2KOQA 2KGEA 4NEOA 4H2YC 2N5IA 2MY5A 2N6YA 4PXHB 2JGPA 1OR5A 3EJBA 2K94A 2EHTA 2KGAA 1NQ4A 2MF4A 2ROQA 1HY8A 2CGQA 5EJDA 3NY7B 2FHSC 4DG9A 2X2BA 2LIWA 5HVCA 2CQ8A 2FQ0A 2KGDA 2LOLA 2N98A 4PWVB 1X3OA 5CZDB 1T8KA 2KGCA 2EHSA 2KOOA 1DNYA 2MVVA 2FADA 2FVFA 2K2QA 2MVUA 4BPFA 2K0YA 2M5RA 2N6ZA 2KOPA 3RG2A 4BPHA 4CA3A 5KP7B 2KR5A 2KW2A 3GZMA 2K92A 2DNWA 2GDWA 2MR7A 2N50A 1F80D 2XZ0D 2CNRA 2JU1A 2KWLA 2FVAA 2L0QA 4H2XC 2KG9A 5KP8B 3CE7A 2KOSA 2KG6A 2AFDA 2LKIA 2GDYA 1KLPA 2FVEA 3EJEA 2AVAA 4H2WC 2FACA 2MR8A 2L4BA 2LTEA 5HV8A 2K93A 2VSQA 4IZ6A 4BPGA 2QNWA 3EJDA 1ACPA 2JQ4A 1L0HA 2MD9A 3GZLA 1AF8A 2K0XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AFE A;  2FAE A;  3LMO A;  1DV5 A;  2L22 A;  2PNG A;  1VKU A;  5KP6 B;  4R0M A;  1HQB A;  2FQ2 A;  2AF8 A;  2GDX A;  4HKG A;  4MRT C;  1L0I A;  2LIU A;  2CG5 B;  2LL8 A;  2N5H A;  2JU2 A;  2LML A;  2KG8 A;  2KOR A;  2L9F A;  2LPK A;  2FQ1 A;  2XZ1 C;  2KOQ A;  2KGE A;  4NEO A;  4H2Y C;  2N5I A;  2MY5 A;  2N6Y A;  4PXH B;  2JGP A;  1OR5 A;  3EJB A;  2K94 A;  2EHT A;  2KGA A;  1NQ4 A;  2MF4 A;  2ROQ A;  1HY8 A;  2CGQ A;  5EJD A;  3NY7 B;  2FHS C;  4DG9 A;  2X2B A;  2LIW A;  5HVC A;  2CQ8 A;  2FQ0 A;  2KGD A;  2LOL A;  2N98 A;  4PWV B;  1X3O A;  5CZD B;  1T8K A;  2KGC A;  2EHS A;  2KOO A;  1DNY A;  2MVV A;  2FAD A;  2FVF A;  2K2Q A;  2MVU A;  4BPF A;  2K0Y A;  2M5R A;  2N6Z A;  2KOP A;  3RG2 A;  4BPH A;  4CA3 A;  5KP7 B;  2KR5 A;  2KW2 A;  3GZM A;  2K92 A;  2DNW A;  2GDW A;  2MR7 A;  2N50 A;  1F80 D;  2XZ0 D;  2CNR A;  2JU1 A;  2KWL A;  2FVA A;  2L0Q A;  4H2X C;  2KG9 A;  5KP8 B;  3CE7 A;  2KOS A;  2KG6 A;  2AFD A;  2LKI A;  2GDY A;  1KLP A;  2FVE A;  3EJE A;  2AVA A;  4H2W C;  2FAC A;  2MR8 A;  2L4B A;  2LTE A;  5HV8 A;  2K93 A;  2VSQ A;  4IZ6 A;  4BPG A;  2QNW A;  3EJD A;  1ACP A;  2JQ4 A;  1L0H A;  2MD9 A;  3GZL A;  1AF8 A;  2K0X A; 
#chains in the Genus database with same CATH topology
 3DS3 A;  4PH0 A;  3CD6 P;  2Z46 A;  1UJZ A;  1HQB A;  2PEN A;  3CME P;  2VLN A;  2FQ2 A;  2AF8 A;  2GDX A;  3DPH A;  4MRT C;  4U0E A;  2CG5 B;  2GZI A;  1K8A Q;  3CCE P;  2KOR A;  1GXH A;  2PEJ A;  1M6E X;  2LPK A;  2FQ1 A;  2XZ1 C;  2KOQ A;  7CEI A;  2PEM A;  1RO2 A;  1NJI Q;  1VQM P;  1Q81 Q;  4U0D A;  1OR5 A;  2K94 A;  4XFX A;  2KGA A;  1NQ4 A;  1UNK A;  1AYI A;  5HGO A;  1QRJ A;  2XT1 A;  2OTJ P;  1D1D A;  4COC A;  2LIW A;  2M8L A;  1GXG A;  2LOL A;  1IMQ A;  1VQ8 P;  5F2K A;  5CZD B;  3CCJ P;  2E1M A;  2KOO A;  2P9X A;  3H0D A;  2FVF A;  2PEK A;  3G71 P;  4QKO A;  2K92 A;  1K9M Q;  3B4Q A;  3H47 A;  4COP A;  2DGY A;  2FVA A;  5KP8 B;  1A43 A;  1KLP A;  1S72 P;  2FVE A;  1YJW P;  4IPY A;  3CPW O;  1VQK P;  1BAJ A;  2MR8 A;  1KC8 Q;  1Q82 Q;  4U0F A;  2VSQ A;  1M1K Q;  2QNW A;  3EJD A;  2JQ4 A;  2GZG A;  2AFE A;  2XXM A;  2WPT A;  2XV6 A;  2OTL P;  3P05 A;  3CCS P;  2KOD A;  2PNG A;  1VHN A;  1EOQ A;  2Z45 A;  2JYG A;  1YJ9 P;  2N5H A;  2LML A;  1YIT P;  4U0B A;  3DS4 A;  2QEX P;  1VQ6 P;  2EIA A;  2JYL A;  3G4S P;  2N5I A;  2MY5 A;  2K0D X;  3G6E P;  2JGP A;  2CWO A;  3EJB A;  2MF4 A;  1HY8 A;  5EJD A;  1VQ4 P;  2FHS C;  4DG9 A;  2X2B A;  4F37 A;  3DTJ A;  3Q20 A;  2FQ0 A;  3CCV P;  3U43 A;  1T8K A;  3DS5 A;  4QNB A;  2KGC A;  2EHS A;  1DNY A;  3LRY A;  2MVV A;  4GR6 A;  2FAD A;  2GZE A;  3M1M A;  2K2Q A;  3G0V A;  3CCR P;  2L6E A;  1CEI A;  2N50 A;  2XZ0 D;  2CNR A;  1M90 Q;  1Z6M A;  2EFJ A;  3E2D A;  2KG6 A;  4WYM A;  4UHP B;  2VLQ A;  2FAC A;  1VQO P;  3CC7 P;  4PH1 A;  1EIA A;  5HV8 A;  2GZJ A;  3G26 A;  1ACP A;  2ONT A;  2JB0 A;  1AF8 A;  1A8O A;  4U0C A;  1GPJ A;  3LMO A;  1DV5 A;  5BS2 A;  2L22 A;  2M8P A;  1N8R Q;  5KP6 B;  2K5X A;  4R0M A;  2EG5 A;  2LIU A;  2LL8 A;  1VQL P;  2JAZ A;  2KG8 A;  4XRQ A;  5DCK A;  2L9F A;  2KGE A;  3G28 A;  4NEO A;  4H2Y C;  1ZMB A;  2EHT A;  1BXI A;  5HGN A;  2CGQ A;  2CQ8 A;  3GJN A;  2KGD A;  2N98 A;  2PEO A;  2NO8 A;  4PWV B;  1X3O A;  3GKL C;  2PY8 A;  2JO0 A;  3MGE A;  3G1I A;  4GR2 A;  4BPF A;  1ZNV A;  2VLP A;  2KOP A;  3RG2 A;  3I55 P;  3NTE A;  4BPH A;  3OW2 O;  4CA3 A;  3CCU P;  2QA4 P;  5KP7 B;  2KW2 A;  3B5I A;  3HYB A;  2GDW A;  2VLO A;  1AUM A;  2JU1 A;  2L0Q A;  3G21 A;  1K73 Q;  2LKI A;  3EJE A;  4H2W C;  2GZF A;  3CCM P;  2LTE A;  2K93 A;  3CC4 P;  1W2B O;  3CC2 P;  3DS1 A;  3I56 P;  3GZL A;  1VQ5 P;  2M8N A;  3CCQ P;  2FAE A;  5I4T G;  1IMP A;  4M0I A;  3HZQ A;  2JBG A;  1VKU A;  5HGL A;  1MZ8 A;  3G1G A;  1RNI A;  4HKG A;  3VRL C;  1FR2 A;  1L0I A;  1KQS O;  2JU2 A;  1K30 A;  4XRO A;  2LF4 A;  5EW5 E;  2BHV A;  2N6Y A;  2PEI A;  5BS1 A;  5F2O A;  4PXH B;  2ROQ A;  1YI2 P;  1E6J P;  3NY7 B;  5F2N A;  5HVC A;  1VQN P;  2BUO A;  4XFY A;  2ERH A;  2Z44 A;  3WBH A;  2PEQ A;  4U0A A;  2GYK A;  1E0H A;  1YJN P;  5HGM A;  1Q86 Q;  2MVU A;  1YIJ P;  2K0Y A;  2M5R A;  2N6Z A;  1Q7Y Q;  3H4E A;  1YHQ P;  1RO0 A;  2KR5 A;  3GZM A;  3DS0 A;  2DNW A;  2MR7 A;  1F80 D;  2KWL A;  4H2X C;  3CMA P;  2KG9 A;  3CE7 A;  2KOS A;  1M6N A;  2AFD A;  4XFZ A;  3RG6 C;  2GDY A;  3CCL P;  2AVA A;  1VQP P;  5JPA A;  2L4B A;  1KD1 Q;  3CXC O;  1JJ2 O;  1VQ7 P;  1QVG O;  4IZ6 A;  4BPG A;  1M74 A;  1QVF O;  1EMV A;  1L0H A;  2OAR A;  2MD9 A;  3DS2 A;  1VQ9 P;  2K0X A;  1IUQ A;  3G29 A; 
#chains in the Genus database with same CATH homology
 2AFE A;  2FAE A;  3LMO A;  1DV5 A;  2L22 A;  2PNG A;  1VKU A;  5KP6 B;  4R0M A;  1HQB A;  2FQ2 A;  2AF8 A;  2GDX A;  4HKG A;  4MRT C;  1L0I A;  2LIU A;  2CG5 B;  2LL8 A;  2N5H A;  2JU2 A;  2LML A;  2KG8 A;  2KOR A;  2L9F A;  2LPK A;  2FQ1 A;  2XZ1 C;  2KOQ A;  2KGE A;  4NEO A;  4H2Y C;  2N5I A;  2MY5 A;  2N6Y A;  4PXH B;  2JGP A;  1OR5 A;  3EJB A;  2K94 A;  2EHT A;  2KGA A;  1NQ4 A;  2MF4 A;  2ROQ A;  1HY8 A;  2CGQ A;  5EJD A;  3NY7 B;  2FHS C;  4DG9 A;  2X2B A;  2LIW A;  5HVC A;  2CQ8 A;  2FQ0 A;  2KGD A;  2LOL A;  2N98 A;  4PWV B;  1X3O A;  5CZD B;  1T8K A;  2KGC A;  2EHS A;  2KOO A;  1DNY A;  2MVV A;  2FAD A;  2FVF A;  2K2Q A;  2MVU A;  4BPF A;  2K0Y A;  2M5R A;  2N6Z A;  2KOP A;  3RG2 A;  4BPH A;  4CA3 A;  5KP7 B;  2KR5 A;  2KW2 A;  3GZM A;  2K92 A;  2DNW A;  2GDW A;  2MR7 A;  2N50 A;  1F80 D;  2XZ0 D;  2CNR A;  2JU1 A;  2KWL A;  2FVA A;  2L0Q A;  4H2X C;  2KG9 A;  5KP8 B;  3CE7 A;  2KOS A;  2KG6 A;  2AFD A;  2LKI A;  2GDY A;  1KLP A;  2FVE A;  3EJE A;  2AVA A;  4H2W C;  2FAC A;  2MR8 A;  2L4B A;  2LTE A;  5HV8 A;  2K93 A;  2VSQ A;  4IZ6 A;  4BPG A;  2QNW A;  3EJD A;  1ACP A;  2JQ4 A;  1L0H A;  2MD9 A;  3GZL A;  1AF8 A;  2K0X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...