1HY8A

Solution structure of b. subtilis acyl carrier protein
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
76
structure length
76
Chain Sequence
ADTLERVTKIIVDRLGVDEADVKLEASFKEDLGADSLDVVELVMELEDEFDMEISDEDAEKIATVGDAVNYIQNQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of B. subtilis acyl carrier protein.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Lipid binding protein
molecule keywords ACYL CARRIER PROTEIN
total genus 20
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2001-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 1hy8A00
2DNWA 3EJDA 2N50A 1HY8A 3CE7A 2LL8A 4HKGA 2L0QA 5HVCA 2LTEA 2KGDA 3EJEA 5KP6B 1F80D 2N98A 4BPGA 1L0HA 2CG5B 1L0IA 2VSQA 2MF4A 2KW2A 3LMOA 2K94A 2K93A 2L22A 2AFEA 2L9FA 2K0XA 2LKIA 2AF8A 3RG2A 2MVUA 2XZ0D 2K2QA 2K0YA 4PXHB 2FVAA 4BPHA 1OR5A 2K92A 2CQ8A 5EJDA 2KGAA 4DG9A 2LMLA 2JQ4A 2N5HA 2FAEA 4PWVB 2N6ZA 4H2YC 1DNYA 2FADA 2MVVA 1HQBA 2LIWA 1AF8A 1T8KA 2FHSC 2FVEA 2KOPA 2KG8A 1VKUA 2X2BA 2FQ0A 2KOQA 2KWLA 3GZLA 2FQ2A 3GZMA 2EHTA 2N5IA 4R0MA 2CNRA 1X3OA 2JU1A 5KP8B 2MY5A 1KLPA 2CGQA 4H2XC 4CA3A 4MRTC 2AFDA 4BPFA 1DV5A 2MR7A 2MD9A 2QNWA 4H2WC 4NEOA 1ACPA 2KGCA 2FVFA 5HV8A 4IZ6A 2GDWA 2L4BA 1NQ4A 2FQ1A 2KG9A 5KP7B 2KG6A 2KORA 2KR5A 2XZ1C 2M5RA 5CZDB 2KGEA 3EJBA 3NY7B 2LIUA 2LPKA 2N6YA 2AVAA 2LOLA 2GDYA 2JU2A 2KOOA 2KOSA 2EHSA 2GDXA 2ROQA 2PNGA 2JGPA 2FACA 2MR8A
chains in the Genus database with same CATH superfamily
1A43A 1RO2A 3EJDA 2QA4P 1HY8A 1K30A 3G29A 5F2OA 1N8RQ 2EIAA 1YHQP 3CC4P 2LTEA 2E1MA 4BPGA 1L0HA 1BXIA 4PH0A 1K9MQ 2L9FA 3DS3A 2LKIA 2PEQA 3H47A 3WBHA 3RG2A 4QKOA 4U0BA 2XZ0D 2FVAA 1OR5A 2JQ4A 2N5HA 2FAEA 4WYMA 5DCKA 4GR6A 4H2YC 2FADA 5HGMA 1K8AQ 1EMVA 1YITP 1NJIQ 1ZNVA 2KOPA 2KG8A 2KWLA 1K73Q 2FQ2A 2EHTA 1UNKA 1YJ9P 2N5IA 4R0MA 1VQ5P 1X3OA 5KP8B 1KLPA 3CCMP 3DTJA 3OW2O 4H2XC 4CA3A 1Z6MA 2AFDA 2MR7A 3B5IA 2MD9A 4COPA 4U0EA 1UJZA 4IZ6A 1NQ4A 2LF4A 3DS1A 5KP7B 4XRQA 4PH1A 2KORA 2Z45A 3DPHA 5HGLA 1GXHA 3EJBA 3CCVP 2VLQA 3HYBA 3DS5A 2N6YA 2PEJA 3CXCO 2K5XA 2LOLA 2GDYA 2M8LA 2JGPA 2MR8A 1D1DA 1QVFO 2DNWA 2N50A 3CE7A 2LL8A 2L0QA 5HVCA 3GJNA 2XV6A 1EIAA 5KP6B 1F80D 4QNBA 1FR2A 3G1IA 2CG5B 2MF4A 2CWOA 3U43A 2K0XA 3CC2P 3DS4A 2Z46A 1E0HA 2AF8A 3HZQA 2JAZA 1AUMA 3G0VA 2K0YA 3LRYA 3P05A 2CQ8A 5EJDA 2KGAA 4DG9A 2LMLA 1KD1Q 1EOQA 3E2DA 1VQNP 3CCRP 1YJNP 3G1GA 2LIWA 4U0FA 4UHPB 2FVEA 2X2BA 2FQ0A 2KOQA 2OTJP 2M8NA 3RG6C 1YI2P 3MGEA 2KODA 2CNRA 3CCSP 2K0DX 2BUOA 2JYLA 2EG5A 1VQ9P 1S72P 1M90Q 2CGQA 1QVGO 2WPTA 2QNWA 3M1MA 4H2WC 7CEIA 2FVFA 5HV8A 2L4BA 3CCUP 1RNIA 3I56P 2GZFA 2KR5A 1CEIA 2GZEA 2M5RA 5HGNA 1VQ8P 5CZDB 4U0AA 3DS2A 1YIJP 2ERHA 2OTLP 1VQLP 2PNGA 5HGOA 2FACA 1M6EX 1VQ6P 3H4EA 1KC8Q 2JYGA 2Z44A 2KGDA 2N98A 1GXGA 1E6JP 3CCEP 4XROA 2DGYA 2GZIA 1RO0A 3G4SP 5EW5E 1Q7YQ 1VQ4P 2MVUA 1AYIA 2K2QA 4PXHB 5BS2A 1VQKP 5JPAA 3NTEA 3CMEP 1DNYA 2VLOA 1ZMBA 1HQBA 2MVVA 3G21A 1VQMP 3CCLP 2PENA 1T8KA 2XT1A 1Q82Q 2FHSC 2VLPA 1W2BO 3DS0A 5BS1A 3G6EP 4U0DA 2GZJA 2NO8A 2GZGA 1M1KQ 2OARA 3G71P 4F37A 4MRTC 4BPFA 3G28A 4NEOA 2GDWA 2FQ1A 2KG9A 1VHNA 1IMPA 5I4TG 2M8PA 2PEMA 3NY7B 2LPKA 1JJ2O 2JO0A 2JB0A 2KOOA 2QEXP 4M0IA 3CCJP 4HKGA 2XXMA 4IPYA 2VLNA 3EJEA 1QRJA 4XFYA 3CPWO 1MZ8A 1L0IA 2VSQA 2KW2A 3LMOA 2K94A 2K93A 2L22A 2AFEA 1VQ7P 3CD6P 3I55P 2PEKA 1M6NA 4GR2A 1VQOP 3CMAP 1GPJA 4BPHA 2K92A 1M74A 4PWVB 2PEIA 2N6ZA 2P9XA 2JBGA 1VQPP 2PEOA 1A8OA 1AF8A 5F2NA 2ONTA 1VKUA 2BHVA 1IUQA 3GZLA 2PY8A 3GZMA 1Q86Q 1YJWP 2EFJA 4XFXA 4COCA 3H0DA 2JU1A 3B4QA 1KQSO 1BAJA 2MY5A 2GYKA 5F2KA 4U0CA 1IMQA 1DV5A 1ACPA 2KGCA 2KG6A 3CCQP 4XFZA 1Q81Q 2XZ1C 2L6EA 2KGEA 2LIUA 3VRLC 2AVAA 2JU2A 3G26A 3Q20A 2KOSA 3CC7P 2EHSA 2GDXA 2ROQA 3GKLC
chains in the Genus database with same CATH topology
2DNWA 3EJDA 2N50A 1HY8A 3CE7A 2LL8A 4HKGA 2L0QA 5HVCA 2LTEA 2KGDA 3EJEA 5KP6B 1F80D 2N98A 4BPGA 1L0HA 2CG5B 1L0IA 2VSQA 2MF4A 2KW2A 3LMOA 2K94A 2K93A 2L22A 2AFEA 2L9FA 2K0XA 2LKIA 2AF8A 3RG2A 2MVUA 2XZ0D 2K2QA 2K0YA 4PXHB 2FVAA 4BPHA 1OR5A 2K92A 2CQ8A 5EJDA 2KGAA 4DG9A 2LMLA 2JQ4A 2N5HA 2FAEA 4PWVB 2N6ZA 4H2YC 1DNYA 2FADA 2MVVA 1HQBA 2LIWA 1AF8A 1T8KA 2FHSC 2FVEA 2KOPA 2KG8A 1VKUA 2X2BA 2FQ0A 2KOQA 2KWLA 3GZLA 2FQ2A 3GZMA 2EHTA 2N5IA 4R0MA 2CNRA 1X3OA 2JU1A 5KP8B 2MY5A 1KLPA 2CGQA 4H2XC 4CA3A 4MRTC 2AFDA 4BPFA 1DV5A 2MR7A 2MD9A 2QNWA 4H2WC 4NEOA 1ACPA 2KGCA 2FVFA 5HV8A 4IZ6A 2GDWA 2L4BA 1NQ4A 2FQ1A 2KG9A 5KP7B 2KG6A 2KORA 2KR5A 2XZ1C 2M5RA 5CZDB 2KGEA 3EJBA 3NY7B 2LIUA 2LPKA 2N6YA 2AVAA 2LOLA 2GDYA 2JU2A 2KOOA 2KOSA 2EHSA 2GDXA 2ROQA 2PNGA 2JGPA 2FACA 2MR8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DNW A;  3EJD A;  2N50 A;  1HY8 A;  3CE7 A;  2LL8 A;  4HKG A;  2L0Q A;  5HVC A;  2LTE A;  2KGD A;  3EJE A;  5KP6 B;  1F80 D;  2N98 A;  4BPG A;  1L0H A;  2CG5 B;  1L0I A;  2VSQ A;  2MF4 A;  2KW2 A;  3LMO A;  2K94 A;  2K93 A;  2L22 A;  2AFE A;  2L9F A;  2K0X A;  2LKI A;  2AF8 A;  3RG2 A;  2MVU A;  2XZ0 D;  2K2Q A;  2K0Y A;  4PXH B;  2FVA A;  4BPH A;  1OR5 A;  2K92 A;  2CQ8 A;  5EJD A;  2KGA A;  4DG9 A;  2LML A;  2JQ4 A;  2N5H A;  2FAE A;  4PWV B;  2N6Z A;  4H2Y C;  1DNY A;  2FAD A;  2MVV A;  1HQB A;  2LIW A;  1AF8 A;  1T8K A;  2FHS C;  2FVE A;  2KOP A;  2KG8 A;  1VKU A;  2X2B A;  2FQ0 A;  2KOQ A;  2KWL A;  3GZL A;  2FQ2 A;  3GZM A;  2EHT A;  2N5I A;  4R0M A;  2CNR A;  1X3O A;  2JU1 A;  5KP8 B;  2MY5 A;  1KLP A;  2CGQ A;  4H2X C;  4CA3 A;  4MRT C;  2AFD A;  4BPF A;  1DV5 A;  2MR7 A;  2MD9 A;  2QNW A;  4H2W C;  4NEO A;  1ACP A;  2KGC A;  2FVF A;  5HV8 A;  4IZ6 A;  2GDW A;  2L4B A;  1NQ4 A;  2FQ1 A;  2KG9 A;  5KP7 B;  2KG6 A;  2KOR A;  2KR5 A;  2XZ1 C;  2M5R A;  5CZD B;  2KGE A;  3EJB A;  3NY7 B;  2LIU A;  2LPK A;  2N6Y A;  2AVA A;  2LOL A;  2GDY A;  2JU2 A;  2KOO A;  2KOS A;  2EHS A;  2GDX A;  2ROQ A;  2PNG A;  2JGP A;  2FAC A;  2MR8 A; 
#chains in the Genus database with same CATH topology
 1A43 A;  1RO2 A;  3EJD A;  2QA4 P;  1HY8 A;  1K30 A;  3G29 A;  5F2O A;  1N8R Q;  2EIA A;  1YHQ P;  3CC4 P;  2LTE A;  2E1M A;  4BPG A;  1L0H A;  1BXI A;  4PH0 A;  1K9M Q;  2L9F A;  3DS3 A;  2LKI A;  2PEQ A;  3H47 A;  3WBH A;  3RG2 A;  4QKO A;  4U0B A;  2XZ0 D;  2FVA A;  1OR5 A;  2JQ4 A;  2N5H A;  2FAE A;  4WYM A;  5DCK A;  4GR6 A;  4H2Y C;  2FAD A;  5HGM A;  1K8A Q;  1EMV A;  1YIT P;  1NJI Q;  1ZNV A;  2KOP A;  2KG8 A;  2KWL A;  1K73 Q;  2FQ2 A;  2EHT A;  1UNK A;  1YJ9 P;  2N5I A;  4R0M A;  1VQ5 P;  1X3O A;  5KP8 B;  1KLP A;  3CCM P;  3DTJ A;  3OW2 O;  4H2X C;  4CA3 A;  1Z6M A;  2AFD A;  2MR7 A;  3B5I A;  2MD9 A;  4COP A;  4U0E A;  1UJZ A;  4IZ6 A;  1NQ4 A;  2LF4 A;  3DS1 A;  5KP7 B;  4XRQ A;  4PH1 A;  2KOR A;  2Z45 A;  3DPH A;  5HGL A;  1GXH A;  3EJB A;  3CCV P;  2VLQ A;  3HYB A;  3DS5 A;  2N6Y A;  2PEJ A;  3CXC O;  2K5X A;  2LOL A;  2GDY A;  2M8L A;  2JGP A;  2MR8 A;  1D1D A;  1QVF O;  2DNW A;  2N50 A;  3CE7 A;  2LL8 A;  2L0Q A;  5HVC A;  3GJN A;  2XV6 A;  1EIA A;  5KP6 B;  1F80 D;  4QNB A;  1FR2 A;  3G1I A;  2CG5 B;  2MF4 A;  2CWO A;  3U43 A;  2K0X A;  3CC2 P;  3DS4 A;  2Z46 A;  1E0H A;  2AF8 A;  3HZQ A;  2JAZ A;  1AUM A;  3G0V A;  2K0Y A;  3LRY A;  3P05 A;  2CQ8 A;  5EJD A;  2KGA A;  4DG9 A;  2LML A;  1KD1 Q;  1EOQ A;  3E2D A;  1VQN P;  3CCR P;  1YJN P;  3G1G A;  2LIW A;  4U0F A;  4UHP B;  2FVE A;  2X2B A;  2FQ0 A;  2KOQ A;  2OTJ P;  2M8N A;  3RG6 C;  1YI2 P;  3MGE A;  2KOD A;  2CNR A;  3CCS P;  2K0D X;  2BUO A;  2JYL A;  2EG5 A;  1VQ9 P;  1S72 P;  1M90 Q;  2CGQ A;  1QVG O;  2WPT A;  2QNW A;  3M1M A;  4H2W C;  7CEI A;  2FVF A;  5HV8 A;  2L4B A;  3CCU P;  1RNI A;  3I56 P;  2GZF A;  2KR5 A;  1CEI A;  2GZE A;  2M5R A;  5HGN A;  1VQ8 P;  5CZD B;  4U0A A;  3DS2 A;  1YIJ P;  2ERH A;  2OTL P;  1VQL P;  2PNG A;  5HGO A;  2FAC A;  1M6E X;  1VQ6 P;  3H4E A;  1KC8 Q;  2JYG A;  2Z44 A;  2KGD A;  2N98 A;  1GXG A;  1E6J P;  3CCE P;  4XRO A;  2DGY A;  2GZI A;  1RO0 A;  3G4S P;  5EW5 E;  1Q7Y Q;  1VQ4 P;  2MVU A;  1AYI A;  2K2Q A;  4PXH B;  5BS2 A;  1VQK P;  5JPA A;  3NTE A;  3CME P;  1DNY A;  2VLO A;  1ZMB A;  1HQB A;  2MVV A;  3G21 A;  1VQM P;  3CCL P;  2PEN A;  1T8K A;  2XT1 A;  1Q82 Q;  2FHS C;  2VLP A;  1W2B O;  3DS0 A;  5BS1 A;  3G6E P;  4U0D A;  2GZJ A;  2NO8 A;  2GZG A;  1M1K Q;  2OAR A;  3G71 P;  4F37 A;  4MRT C;  4BPF A;  3G28 A;  4NEO A;  2GDW A;  2FQ1 A;  2KG9 A;  1VHN A;  1IMP A;  5I4T G;  2M8P A;  2PEM A;  3NY7 B;  2LPK A;  1JJ2 O;  2JO0 A;  2JB0 A;  2KOO A;  2QEX P;  4M0I A;  3CCJ P;  4HKG A;  2XXM A;  4IPY A;  2VLN A;  3EJE A;  1QRJ A;  4XFY A;  3CPW O;  1MZ8 A;  1L0I A;  2VSQ A;  2KW2 A;  3LMO A;  2K94 A;  2K93 A;  2L22 A;  2AFE A;  1VQ7 P;  3CD6 P;  3I55 P;  2PEK A;  1M6N A;  4GR2 A;  1VQO P;  3CMA P;  1GPJ A;  4BPH A;  2K92 A;  1M74 A;  4PWV B;  2PEI A;  2N6Z A;  2P9X A;  2JBG A;  1VQP P;  2PEO A;  1A8O A;  1AF8 A;  5F2N A;  2ONT A;  1VKU A;  2BHV A;  1IUQ A;  3GZL A;  2PY8 A;  3GZM A;  1Q86 Q;  1YJW P;  2EFJ A;  4XFX A;  4COC A;  3H0D A;  2JU1 A;  3B4Q A;  1KQS O;  1BAJ A;  2MY5 A;  2GYK A;  5F2K A;  4U0C A;  1IMQ A;  1DV5 A;  1ACP A;  2KGC A;  2KG6 A;  3CCQ P;  4XFZ A;  1Q81 Q;  2XZ1 C;  2L6E A;  2KGE A;  2LIU A;  3VRL C;  2AVA A;  2JU2 A;  3G26 A;  3Q20 A;  2KOS A;  3CC7 P;  2EHS A;  2GDX A;  2ROQ A;  3GKL C; 
#chains in the Genus database with same CATH homology
 2DNW A;  3EJD A;  2N50 A;  1HY8 A;  3CE7 A;  2LL8 A;  4HKG A;  2L0Q A;  5HVC A;  2LTE A;  2KGD A;  3EJE A;  5KP6 B;  1F80 D;  2N98 A;  4BPG A;  1L0H A;  2CG5 B;  1L0I A;  2VSQ A;  2MF4 A;  2KW2 A;  3LMO A;  2K94 A;  2K93 A;  2L22 A;  2AFE A;  2L9F A;  2K0X A;  2LKI A;  2AF8 A;  3RG2 A;  2MVU A;  2XZ0 D;  2K2Q A;  2K0Y A;  4PXH B;  2FVA A;  4BPH A;  1OR5 A;  2K92 A;  2CQ8 A;  5EJD A;  2KGA A;  4DG9 A;  2LML A;  2JQ4 A;  2N5H A;  2FAE A;  4PWV B;  2N6Z A;  4H2Y C;  1DNY A;  2FAD A;  2MVV A;  1HQB A;  2LIW A;  1AF8 A;  1T8K A;  2FHS C;  2FVE A;  2KOP A;  2KG8 A;  1VKU A;  2X2B A;  2FQ0 A;  2KOQ A;  2KWL A;  3GZL A;  2FQ2 A;  3GZM A;  2EHT A;  2N5I A;  4R0M A;  2CNR A;  1X3O A;  2JU1 A;  5KP8 B;  2MY5 A;  1KLP A;  2CGQ A;  4H2X C;  4CA3 A;  4MRT C;  2AFD A;  4BPF A;  1DV5 A;  2MR7 A;  2MD9 A;  2QNW A;  4H2W C;  4NEO A;  1ACP A;  2KGC A;  2FVF A;  5HV8 A;  4IZ6 A;  2GDW A;  2L4B A;  1NQ4 A;  2FQ1 A;  2KG9 A;  5KP7 B;  2KG6 A;  2KOR A;  2KR5 A;  2XZ1 C;  2M5R A;  5CZD B;  2KGE A;  3EJB A;  3NY7 B;  2LIU A;  2LPK A;  2N6Y A;  2AVA A;  2LOL A;  2GDY A;  2JU2 A;  2KOO A;  2KOS A;  2EHS A;  2GDX A;  2ROQ A;  2PNG A;  2JGP A;  2FAC A;  2MR8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...