1HY8A

Solution structure of b. subtilis acyl carrier protein
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
76
structure length
76
Chain Sequence
ADTLERVTKIIVDRLGVDEADVKLEASFKEDLGADSLDVVELVMELEDEFDMEISDEDAEKIATVGDAVNYIQNQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of B. subtilis acyl carrier protein.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Lipid binding protein
molecule keywords ACYL CARRIER PROTEIN
total genus 20
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2001-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 1hy8A00
2ROQA 2XZ1C 2GDYA 2LOLA 2KOPA 2GDXA 1X3OA 2L0QA 2GDWA 2N50A 2EHSA 3NY7B 2DNWA 2K92A 2FADA 2K93A 2MR7A 2JQ4A 1DNYA 2K0YA 3CE7A 2KOSA 2KGEA 1L0IA 1HY8A 2FVEA 2KORA 4H2WC 2KOQA 2K0XA 2FQ0A 2N5HA 2VSQA 2FQ1A 3EJBA 5KP8B 4MRTC 2K2QA 2LMLA 2K94A 2FVAA 4PWVB 2LPKA 3GZMA 1HQBA 2FAEA 5HVCA 2KW2A 1DV5A 2N6ZA 2KGCA 3RG2A 5CZDB 2AF8A 4IZ6A 2LIUA 2KG9A 4BPFA 4HKGA 2MD9A 2N5IA 5KP6B 2CQ8A 3LMOA 2MF4A 2X2BA 2PNGA 1KLPA 5EJDA 2KGDA 4H2XC 2AFEA 2N6YA 1T8KA 5HV8A 2L9FA 1F80D 2CNRA 2L22A 2QNWA 2KWLA 2N98A 2XZ0D 2LKIA 2JU1A 2M5RA 1ACPA 4NEOA 4PXHB 4R0MA 2MVUA 2L4BA 2KG6A 3EJEA 2KOOA 3EJDA 2CG5B 2MY5A 2KGAA 2FHSC 1AF8A 2LIWA 4BPGA 1L0HA 1NQ4A 5KP7B 2CGQA 2JGPA 2LTEA 2FQ2A 3GZLA 1VKUA 2AVAA 2FVFA 2EHTA 2MVVA 4H2YC 1OR5A 2LL8A 4DG9A 2FACA 2JU2A 2AFDA 2KR5A 2KG8A 4CA3A 2MR8A 4BPHA
chains in the Genus database with same CATH superfamily
1YIJP 4U0EA 2JYLA 2KOPA 5HGLA 1VQMP 1K8AQ 2EHSA 3WBHA 2XT1A 1GPJA 2FADA 1DNYA 2PEKA 3DS0A 2PEJA 3VRLC 2OTJP 2OTLP 3GKLC 4H2WC 3MGEA 2KOQA 2K0XA 3H0DA 4F37A 2K2QA 3CMAP 2LPKA 3GZMA 5HVCA 2KW2A 1YJNP 4HKGA 3I55P 2MD9A 1VQLP 2X2BA 1UJZA 4H2XC 1T8KA 2N6YA 5HV8A 2XXMA 3DS2A 1UNKA 3P05A 1M1KQ 2QNWA 2KWLA 2XZ0D 4U0DA 1ACPA 4U0BA 2MVUA 2L4BA 3B5IA 3EJEA 2CG5B 3B4QA 1Q86Q 2VLOA 2K5XA 5KP7B 2JGPA 2VLPA 5HGNA 3GZLA 3CCUP 1YI2P 1S72P 4PH1A 1BXIA 4XROA 1YITP 1KD1Q 2M8LA 4DG9A 2XV6A 2KR5A 4CA3A 2MR8A 4BPHA 2ROQA 2XZ1C 2GDYA 4QNBA 4IPYA 2GDXA 2L0QA 1VHNA 1QVGO 2N50A 1KC8Q 3DS5A 1EMVA 1VQ5P 2JQ4A 2K0YA 1VQKP 2GZEA 1Q81Q 4U0FA 2KOSA 2KODA 2KORA 2FQ0A 2N5HA 2FQ1A 1VQPP 1RNIA 4PH0A 2FVAA 1QVFO 2N6ZA 3RG2A 3CMEP 4IZ6A 2LIUA 5BS1A 3OW2O 3LMOA 1BAJA 3RG6C 3CCQP 3DTJA 1KLPA 1VQOP 1Q7YQ 3G6EP 1F80D 1AUMA 1MZ8A 2LKIA 2JU1A 3CPWO 1GXHA 3G71P 2GZFA 4NEOA 3G1IA 2NO8A 1FR2A 2JAZA 3CCLP 2KGAA 3U43A 1L0HA 1AYIA 2LTEA 2FQ2A 4COCA 3CC2P 2ERHA 1EOQA 2FVFA 7CEIA 2BHVA 3CCSP 4H2YC 2LF4A 1OR5A 1KQSO 2EIAA 2AFDA 1M6EX 3CCEP 3M1MA 1A43A 5F2NA 3Q20A 1X3OA 2GDWA 2GZGA 3DS4A 2M8NA 2DNWA 5BS2A 1ZNVA 3G21A 2K93A 2PY8A 3NTEA 4XFYA 2MR7A 2QEXP 1D1DA 5HGOA 1VQ6P 1N8RQ 4UHPB 1L0IA 2FVEA 1M74A 3G26A 3H47A 1K73Q 5KP8B 4MRTC 2JB0A 1HQBA 1Z6MA 5I4TG 2FAEA 3CCMP 1DV5A 2PEMA 5CZDB 3DS1A 2PEIA 2AF8A 3G28A 4BPFA 3LRYA 3GJNA 2MF4A 3G29A 2JO0A 2JYGA 1CEIA 2KGDA 2EFJA 2WPTA 1YHQP 1VQ7P 1M90Q 2N98A 2L6EA 4PXHB 4R0MA 3G4SP 3HYBA 1GXGA 1ZMBA 1NJIQ 1YJ9P 2KG6A 2KOOA 3CC4P 3EJDA 2MY5A 4XFXA 5JPAA 3G0VA 2FHSC 3I56P 1AF8A 1VQ9P 1NQ4A 2Z46A 1VKUA 2AVAA 2EHTA 2MVVA 4GR6A 1A8OA 2GZJA 2ONTA 1Q82Q 3CCVP 2PEQA 2FACA 3G1GA 3CXCO 2KG8A 3CD6P 2BUOA 2LOLA 3CCJP 3CC7P 3NY7B 1IMPA 2K92A 1W2BO 3DPHA 4M0IA 2PENA 1RO0A 2Z45A 3CE7A 5EW5E 5F2KA 5F2OA 2PEOA 2KGEA 1HY8A 2QA4P 1M6NA 2VSQA 3EJBA 5DCKA 2Z44A 2DGYA 2LMLA 2K94A 1IMQA 4PWVB 2KGCA 2GZIA 2KG9A 2N5IA 5KP6B 2CQ8A 1QRJA 2K0DX 2PNGA 4U0CA 1E0HA 4COPA 5EJDA 2AFEA 1VQ8P 2CWOA 1IUQA 3HZQA 2L9FA 1VQ4P 2CNRA 1K9MQ 2L22A 2JBGA 3CCRP 1K30A 1RO2A 1E6JP 1EIAA 2M5RA 5HGMA 2M8PA 2VLQA 3H4EA 2OARA 2E1MA 1JJ2O 1VQNP 4U0AA 2LIWA 2VLNA 4XFZA 4BPGA 2CGQA 4WYMA 3DS3A 2P9XA 4GR2A 2GYKA 4QKOA 1YJWP 2LL8A 4XRQA 2JU2A 2EG5A 3E2DA
chains in the Genus database with same CATH topology
2ROQA 2XZ1C 2GDYA 2LOLA 2KOPA 2GDXA 1X3OA 2L0QA 2GDWA 2N50A 2EHSA 3NY7B 2DNWA 2K92A 2FADA 2K93A 2MR7A 2JQ4A 1DNYA 2K0YA 3CE7A 2KOSA 2KGEA 1L0IA 1HY8A 2FVEA 2KORA 4H2WC 2KOQA 2K0XA 2FQ0A 2N5HA 2VSQA 2FQ1A 3EJBA 5KP8B 4MRTC 2K2QA 2LMLA 2K94A 2FVAA 4PWVB 2LPKA 3GZMA 1HQBA 2FAEA 5HVCA 2KW2A 1DV5A 2N6ZA 2KGCA 3RG2A 5CZDB 2AF8A 4IZ6A 2LIUA 2KG9A 4BPFA 4HKGA 2MD9A 2N5IA 5KP6B 2CQ8A 3LMOA 2MF4A 2X2BA 2PNGA 1KLPA 5EJDA 2KGDA 4H2XC 2AFEA 2N6YA 1T8KA 5HV8A 2L9FA 1F80D 2CNRA 2L22A 2QNWA 2KWLA 2N98A 2XZ0D 2LKIA 2JU1A 2M5RA 1ACPA 4NEOA 4PXHB 4R0MA 2MVUA 2L4BA 2KG6A 3EJEA 2KOOA 3EJDA 2CG5B 2MY5A 2KGAA 2FHSC 1AF8A 2LIWA 4BPGA 1L0HA 1NQ4A 5KP7B 2CGQA 2JGPA 2LTEA 2FQ2A 3GZLA 1VKUA 2AVAA 2FVFA 2EHTA 2MVVA 4H2YC 1OR5A 2LL8A 4DG9A 2FACA 2JU2A 2AFDA 2KR5A 2KG8A 4CA3A 2MR8A 4BPHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ROQ A;  2XZ1 C;  2GDY A;  2LOL A;  2KOP A;  2GDX A;  1X3O A;  2L0Q A;  2GDW A;  2N50 A;  2EHS A;  3NY7 B;  2DNW A;  2K92 A;  2FAD A;  2K93 A;  2MR7 A;  2JQ4 A;  1DNY A;  2K0Y A;  3CE7 A;  2KOS A;  2KGE A;  1L0I A;  1HY8 A;  2FVE A;  2KOR A;  4H2W C;  2KOQ A;  2K0X A;  2FQ0 A;  2N5H A;  2VSQ A;  2FQ1 A;  3EJB A;  5KP8 B;  4MRT C;  2K2Q A;  2LML A;  2K94 A;  2FVA A;  4PWV B;  2LPK A;  3GZM A;  1HQB A;  2FAE A;  5HVC A;  2KW2 A;  1DV5 A;  2N6Z A;  2KGC A;  3RG2 A;  5CZD B;  2AF8 A;  4IZ6 A;  2LIU A;  2KG9 A;  4BPF A;  4HKG A;  2MD9 A;  2N5I A;  5KP6 B;  2CQ8 A;  3LMO A;  2MF4 A;  2X2B A;  2PNG A;  1KLP A;  5EJD A;  2KGD A;  4H2X C;  2AFE A;  2N6Y A;  1T8K A;  5HV8 A;  2L9F A;  1F80 D;  2CNR A;  2L22 A;  2QNW A;  2KWL A;  2N98 A;  2XZ0 D;  2LKI A;  2JU1 A;  2M5R A;  1ACP A;  4NEO A;  4PXH B;  4R0M A;  2MVU A;  2L4B A;  2KG6 A;  3EJE A;  2KOO A;  3EJD A;  2CG5 B;  2MY5 A;  2KGA A;  2FHS C;  1AF8 A;  2LIW A;  4BPG A;  1L0H A;  1NQ4 A;  5KP7 B;  2CGQ A;  2JGP A;  2LTE A;  2FQ2 A;  3GZL A;  1VKU A;  2AVA A;  2FVF A;  2EHT A;  2MVV A;  4H2Y C;  1OR5 A;  2LL8 A;  4DG9 A;  2FAC A;  2JU2 A;  2AFD A;  2KR5 A;  2KG8 A;  4CA3 A;  2MR8 A;  4BPH A; 
#chains in the Genus database with same CATH topology
 1YIJ P;  4U0E A;  2JYL A;  2KOP A;  5HGL A;  1VQM P;  1K8A Q;  2EHS A;  3WBH A;  2XT1 A;  1GPJ A;  2FAD A;  1DNY A;  2PEK A;  3DS0 A;  2PEJ A;  3VRL C;  2OTJ P;  2OTL P;  3GKL C;  4H2W C;  3MGE A;  2KOQ A;  2K0X A;  3H0D A;  4F37 A;  2K2Q A;  3CMA P;  2LPK A;  3GZM A;  5HVC A;  2KW2 A;  1YJN P;  4HKG A;  3I55 P;  2MD9 A;  1VQL P;  2X2B A;  1UJZ A;  4H2X C;  1T8K A;  2N6Y A;  5HV8 A;  2XXM A;  3DS2 A;  1UNK A;  3P05 A;  1M1K Q;  2QNW A;  2KWL A;  2XZ0 D;  4U0D A;  1ACP A;  4U0B A;  2MVU A;  2L4B A;  3B5I A;  3EJE A;  2CG5 B;  3B4Q A;  1Q86 Q;  2VLO A;  2K5X A;  5KP7 B;  2JGP A;  2VLP A;  5HGN A;  3GZL A;  3CCU P;  1YI2 P;  1S72 P;  4PH1 A;  1BXI A;  4XRO A;  1YIT P;  1KD1 Q;  2M8L A;  4DG9 A;  2XV6 A;  2KR5 A;  4CA3 A;  2MR8 A;  4BPH A;  2ROQ A;  2XZ1 C;  2GDY A;  4QNB A;  4IPY A;  2GDX A;  2L0Q A;  1VHN A;  1QVG O;  2N50 A;  1KC8 Q;  3DS5 A;  1EMV A;  1VQ5 P;  2JQ4 A;  2K0Y A;  1VQK P;  2GZE A;  1Q81 Q;  4U0F A;  2KOS A;  2KOD A;  2KOR A;  2FQ0 A;  2N5H A;  2FQ1 A;  1VQP P;  1RNI A;  4PH0 A;  2FVA A;  1QVF O;  2N6Z A;  3RG2 A;  3CME P;  4IZ6 A;  2LIU A;  5BS1 A;  3OW2 O;  3LMO A;  1BAJ A;  3RG6 C;  3CCQ P;  3DTJ A;  1KLP A;  1VQO P;  1Q7Y Q;  3G6E P;  1F80 D;  1AUM A;  1MZ8 A;  2LKI A;  2JU1 A;  3CPW O;  1GXH A;  3G71 P;  2GZF A;  4NEO A;  3G1I A;  2NO8 A;  1FR2 A;  2JAZ A;  3CCL P;  2KGA A;  3U43 A;  1L0H A;  1AYI A;  2LTE A;  2FQ2 A;  4COC A;  3CC2 P;  2ERH A;  1EOQ A;  2FVF A;  7CEI A;  2BHV A;  3CCS P;  4H2Y C;  2LF4 A;  1OR5 A;  1KQS O;  2EIA A;  2AFD A;  1M6E X;  3CCE P;  3M1M A;  1A43 A;  5F2N A;  3Q20 A;  1X3O A;  2GDW A;  2GZG A;  3DS4 A;  2M8N A;  2DNW A;  5BS2 A;  1ZNV A;  3G21 A;  2K93 A;  2PY8 A;  3NTE A;  4XFY A;  2MR7 A;  2QEX P;  1D1D A;  5HGO A;  1VQ6 P;  1N8R Q;  4UHP B;  1L0I A;  2FVE A;  1M74 A;  3G26 A;  3H47 A;  1K73 Q;  5KP8 B;  4MRT C;  2JB0 A;  1HQB A;  1Z6M A;  5I4T G;  2FAE A;  3CCM P;  1DV5 A;  2PEM A;  5CZD B;  3DS1 A;  2PEI A;  2AF8 A;  3G28 A;  4BPF A;  3LRY A;  3GJN A;  2MF4 A;  3G29 A;  2JO0 A;  2JYG A;  1CEI A;  2KGD A;  2EFJ A;  2WPT A;  1YHQ P;  1VQ7 P;  1M90 Q;  2N98 A;  2L6E A;  4PXH B;  4R0M A;  3G4S P;  3HYB A;  1GXG A;  1ZMB A;  1NJI Q;  1YJ9 P;  2KG6 A;  2KOO A;  3CC4 P;  3EJD A;  2MY5 A;  4XFX A;  5JPA A;  3G0V A;  2FHS C;  3I56 P;  1AF8 A;  1VQ9 P;  1NQ4 A;  2Z46 A;  1VKU A;  2AVA A;  2EHT A;  2MVV A;  4GR6 A;  1A8O A;  2GZJ A;  2ONT A;  1Q82 Q;  3CCV P;  2PEQ A;  2FAC A;  3G1G A;  3CXC O;  2KG8 A;  3CD6 P;  2BUO A;  2LOL A;  3CCJ P;  3CC7 P;  3NY7 B;  1IMP A;  2K92 A;  1W2B O;  3DPH A;  4M0I A;  2PEN A;  1RO0 A;  2Z45 A;  3CE7 A;  5EW5 E;  5F2K A;  5F2O A;  2PEO A;  2KGE A;  1HY8 A;  2QA4 P;  1M6N A;  2VSQ A;  3EJB A;  5DCK A;  2Z44 A;  2DGY A;  2LML A;  2K94 A;  1IMQ A;  4PWV B;  2KGC A;  2GZI A;  2KG9 A;  2N5I A;  5KP6 B;  2CQ8 A;  1QRJ A;  2K0D X;  2PNG A;  4U0C A;  1E0H A;  4COP A;  5EJD A;  2AFE A;  1VQ8 P;  2CWO A;  1IUQ A;  3HZQ A;  2L9F A;  1VQ4 P;  2CNR A;  1K9M Q;  2L22 A;  2JBG A;  3CCR P;  1K30 A;  1RO2 A;  1E6J P;  1EIA A;  2M5R A;  5HGM A;  2M8P A;  2VLQ A;  3H4E A;  2OAR A;  2E1M A;  1JJ2 O;  1VQN P;  4U0A A;  2LIW A;  2VLN A;  4XFZ A;  4BPG A;  2CGQ A;  4WYM A;  3DS3 A;  2P9X A;  4GR2 A;  2GYK A;  4QKO A;  1YJW P;  2LL8 A;  4XRQ A;  2JU2 A;  2EG5 A;  3E2D A; 
#chains in the Genus database with same CATH homology
 2ROQ A;  2XZ1 C;  2GDY A;  2LOL A;  2KOP A;  2GDX A;  1X3O A;  2L0Q A;  2GDW A;  2N50 A;  2EHS A;  3NY7 B;  2DNW A;  2K92 A;  2FAD A;  2K93 A;  2MR7 A;  2JQ4 A;  1DNY A;  2K0Y A;  3CE7 A;  2KOS A;  2KGE A;  1L0I A;  1HY8 A;  2FVE A;  2KOR A;  4H2W C;  2KOQ A;  2K0X A;  2FQ0 A;  2N5H A;  2VSQ A;  2FQ1 A;  3EJB A;  5KP8 B;  4MRT C;  2K2Q A;  2LML A;  2K94 A;  2FVA A;  4PWV B;  2LPK A;  3GZM A;  1HQB A;  2FAE A;  5HVC A;  2KW2 A;  1DV5 A;  2N6Z A;  2KGC A;  3RG2 A;  5CZD B;  2AF8 A;  4IZ6 A;  2LIU A;  2KG9 A;  4BPF A;  4HKG A;  2MD9 A;  2N5I A;  5KP6 B;  2CQ8 A;  3LMO A;  2MF4 A;  2X2B A;  2PNG A;  1KLP A;  5EJD A;  2KGD A;  4H2X C;  2AFE A;  2N6Y A;  1T8K A;  5HV8 A;  2L9F A;  1F80 D;  2CNR A;  2L22 A;  2QNW A;  2KWL A;  2N98 A;  2XZ0 D;  2LKI A;  2JU1 A;  2M5R A;  1ACP A;  4NEO A;  4PXH B;  4R0M A;  2MVU A;  2L4B A;  2KG6 A;  3EJE A;  2KOO A;  3EJD A;  2CG5 B;  2MY5 A;  2KGA A;  2FHS C;  1AF8 A;  2LIW A;  4BPG A;  1L0H A;  1NQ4 A;  5KP7 B;  2CGQ A;  2JGP A;  2LTE A;  2FQ2 A;  3GZL A;  1VKU A;  2AVA A;  2FVF A;  2EHT A;  2MVV A;  4H2Y C;  1OR5 A;  2LL8 A;  4DG9 A;  2FAC A;  2JU2 A;  2AFD A;  2KR5 A;  2KG8 A;  4CA3 A;  2MR8 A;  4BPH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...