1HY8A

Solution structure of b. subtilis acyl carrier protein
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
76
structure length
76
Chain Sequence
ADTLERVTKIIVDRLGVDEADVKLEASFKEDLGADSLDVVELVMELEDEFDMEISDEDAEKIATVGDAVNYIQNQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lipid binding protein
molecule keywords ACYL CARRIER PROTEIN
publication title Solution structure of B. subtilis acyl carrier protein.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 20
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2001-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 1hy8A00
2N6ZA 2KOSA 2LKIA 2KORA 2KOOA 2FQ1A 2VSQA 2N5IA 2FVEA 2N5HA 2QNWA 3LMOA 4BPHA 2JGPA 4BPFA 4HKGA 1ACPA 2KG6A 2CQ8A 4NEOA 1AF8A 2KOQA 4H2XC 2DNWA 2GDXA 2GDWA 2FQ0A 4MRTC 3EJBA 2FQ2A 2FACA 2MF4A 2LTEA 4H2YC 2L4BA 5HVCA 2FVAA 2EHTA 2AFEA 2KW2A 4PXHB 2K93A 3GZLA 5HV8A 1T8KA 2MVUA 2LIUA 2JU2A 2AFDA 2CGQA 2K0YA 2KOPA 2KGDA 2LMLA 2FAEA 1X3OA 4R0MA 2AVAA 2L0QA 3EJDA 2LIWA 2KG9A 2ROQA 3GZMA 2N98A 2KGCA 2K92A 2KG8A 2FHSC 3NY7B 5KP7B 1F80D 1KLPA 2XZ1C 4PWVB 5CZDB 2KWLA 2MVVA 2X2BA 5KP6B 4BPGA 2CG5B 5EJDA 4CA3A 2KGAA 2MY5A 2N6YA 4DG9A 3EJEA 1DNYA 2L22A 2K0XA 2N50A 2MR8A 2JU1A 2LPKA 1HY8A 2GDYA 1L0HA 4H2WC 2CNRA 2JQ4A 2XZ0D 2MD9A 1NQ4A 2L9FA 2K2QA 2K94A 4IZ6A 1VKUA 5KP8B 2AF8A 2LL8A 2M5RA 2FVFA 3CE7A 2FADA 2MR7A 3RG2A 2KR5A 2LOLA 2KGEA 2EHSA 2PNGA 1OR5A 1HQBA 1L0IA 1DV5A
chains in the Genus database with same CATH superfamily
2N6ZA 2KOSA 2FQ1A 2N5HA 2PEOA 1M90Q 1QRJA 2PENA 1ACPA 1VQ8P 5BS1A 3I56P 2KOQA 2GDXA 1VQ9P 1VQKP 3EJBA 2FQ2A 2JYLA 5EW5E 2LTEA 1VQNP 5HVCA 2FVAA 2EHTA 1KD1Q 5F2NA 2K93A 4U0CA 3CCUP 3CMEP 2OTJP 3DS3A 2LIUA 2JU2A 2CWOA 1QVFO 2Z46A 4XFYA 4R0MA 4M0IA 3EJDA 2GZIA 2JYGA 2DGYA 3NY7B 5KP7B 2WPTA 1EIAA 2XZ1C 1K30A 1VQLP 4CA3A 3EJEA 2N50A 1HY8A 2GDYA 1L0HA 4H2WC 2EG5A 2XZ0D 1YJNP 2L9FA 5HGLA 3G6EP 1VQMP 1K73Q 1VKUA 2M5RA 3CE7A 5HGOA 5HGMA 3RG2A 1AUMA 2KGEA 1W2BO 1FR2A 3G1IA 4XROA 2L6EA 3CCLP 3G1GA 1A8OA 1M1KQ 3G0VA 4QNBA 2QNWA 2GZJA 3CD6P 2KG6A 1JJ2O 2CQ8A 4NEOA 1ZMBA 2DNWA 4MRTC 4XFZA 1Q82Q 3CC2P 4GR2A 2L4BA 4UHPB 4PXHB 4WYMA 3GJNA 5HV8A 1A43A 3CCVP 2MVUA 3B5IA 2K0YA 2KGDA 3U43A 1X3OA 3CMAP 3MGEA 3RG6C 2AVAA 4U0FA 1E6JP 2OTLP 3GZMA 2N98A 2KGCA 2JAZA 2VLNA 2KG8A 1CEIA 5F2OA 2KODA 1F80D 1VQ6P 1KLPA 4PWVB 2VLPA 3CC7P 2X2BA 3VRLC 3G29A 1VQOP 2OARA 4U0DA 4BPGA 1Z6MA 5EJDA 3Q20A 1GXHA 4DG9A 2PY8A 2MR8A 2JU1A 2LPKA 1AYIA 1MZ8A 2CNRA 3DTJA 4XFXA 3DS1A 2K2QA 1KQSO 1E0HA 5KP8B 1RO2A 2PEKA 2LF4A 2FVFA 1S72P 2EHSA 1D1DA 1ZNVA 2PNGA 1N8RQ 3G21A 1RNIA 1M74A 2ERHA 1IMQA 1VQ4P 3WBHA 3CCJP 4IPYA 3G71P 1IMPA 2XXMA 2JB0A 4BPHA 2JGPA 1RO0A 5JPAA 1AF8A 2ONTA 2GDWA 2FQ0A 4PH1A 1NJIQ 3GKLC 2FACA 2MF4A 3DS4A 1BXIA 2JBGA 2AFEA 3OW2O 2M8LA 1VQ7P 4U0EA 2M8PA 3B4QA 2CGQA 2KOPA 7CEIA 2FAEA 2GZGA 2EFJA 2LIWA 2NO8A 2KG9A 2Z45A 2E1MA 2K92A 1YJ9P 1YI2P 3LRYA 3CPWO 5CZDB 1YITP 2CG5B 2Z44A 2MY5A 1UNKA 3DS0A 1VQ5P 2L22A 1DNYA 2K0XA 1Q7YQ 2GYKA 4QKOA 3CCRP 2EIAA 2MD9A 3H4EA 3CXCO 2K94A 4IZ6A 4F37A 3NTEA 2AF8A 2PEMA 2M8NA 2LL8A 3CCMP 5DCKA 1QVGO 2MR7A 3P05A 2LOLA 3I55P 3CCEP 1GXGA 1EMVA 5HGNA 1OR5A 1EOQA 1HQBA 3E2DA 2XV6A 2LKIA 2KORA 2KOOA 3DPHA 2VSQA 1YHQP 2N5IA 4U0AA 2FVEA 3LMOA 1K9MQ 4BPFA 4HKGA 2QA4P 2BHVA 3G4SP 3G26A 4H2XC 3H0DA 2K0DX 3G28A 5BS2A 3CCSP 1VQPP 2K5XA 2PEJA 1VHNA 4H2YC 2PEIA 1M6NA 4PH0A 2BUOA 2KW2A 1KC8Q 3GZLA 1T8KA 2GZFA 1IUQA 3CCQP 3HYBA 4XRQA 2AFDA 1Q86Q 2LMLA 3DS2A 3CC4P 3HZQA 1BAJA 2L0QA 1UJZA 3H47A 2ROQA 2VLOA 3DS5A 1YIJP 2GZEA 2FHSC 1YJWP 2KWLA 2MVVA 5I4TG 5KP6B 2KGAA 2N6YA 2XT1A 1M6EX 1GPJA 2JQ4A 4COCA 3M1MA 1NQ4A 4COPA 2JO0A 4U0BA 5F2KA 1Q81Q 2P9XA 2VLQA 2FADA 2QEXP 2KR5A 4GR6A 2PEQA 1K8AQ 1L0IA 1DV5A
chains in the Genus database with same CATH topology
2N6ZA 2KOSA 2LKIA 2KORA 2KOOA 2FQ1A 2VSQA 2N5IA 2FVEA 2N5HA 2QNWA 3LMOA 4BPHA 2JGPA 4BPFA 4HKGA 1ACPA 2KG6A 2CQ8A 4NEOA 1AF8A 2KOQA 4H2XC 2DNWA 2GDXA 2GDWA 2FQ0A 4MRTC 3EJBA 2FQ2A 2FACA 2MF4A 2LTEA 4H2YC 2L4BA 5HVCA 2FVAA 2EHTA 2AFEA 2KW2A 4PXHB 2K93A 3GZLA 5HV8A 1T8KA 2MVUA 2LIUA 2JU2A 2AFDA 2CGQA 2K0YA 2KOPA 2KGDA 2LMLA 2FAEA 1X3OA 4R0MA 2AVAA 2L0QA 3EJDA 2LIWA 2KG9A 2ROQA 3GZMA 2N98A 2KGCA 2K92A 2KG8A 2FHSC 3NY7B 5KP7B 1F80D 1KLPA 2XZ1C 4PWVB 5CZDB 2KWLA 2MVVA 2X2BA 5KP6B 4BPGA 2CG5B 5EJDA 4CA3A 2KGAA 2MY5A 2N6YA 4DG9A 3EJEA 1DNYA 2L22A 2K0XA 2N50A 2MR8A 2JU1A 2LPKA 1HY8A 2GDYA 1L0HA 4H2WC 2CNRA 2JQ4A 2XZ0D 2MD9A 1NQ4A 2L9FA 2K2QA 2K94A 4IZ6A 1VKUA 5KP8B 2AF8A 2LL8A 2M5RA 2FVFA 3CE7A 2FADA 2MR7A 3RG2A 2KR5A 2LOLA 2KGEA 2EHSA 2PNGA 1OR5A 1HQBA 1L0IA 1DV5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N6Z A;  2KOS A;  2LKI A;  2KOR A;  2KOO A;  2FQ1 A;  2VSQ A;  2N5I A;  2FVE A;  2N5H A;  2QNW A;  3LMO A;  4BPH A;  2JGP A;  4BPF A;  4HKG A;  1ACP A;  2KG6 A;  2CQ8 A;  4NEO A;  1AF8 A;  2KOQ A;  4H2X C;  2DNW A;  2GDX A;  2GDW A;  2FQ0 A;  4MRT C;  3EJB A;  2FQ2 A;  2FAC A;  2MF4 A;  2LTE A;  4H2Y C;  2L4B A;  5HVC A;  2FVA A;  2EHT A;  2AFE A;  2KW2 A;  4PXH B;  2K93 A;  3GZL A;  5HV8 A;  1T8K A;  2MVU A;  2LIU A;  2JU2 A;  2AFD A;  2CGQ A;  2K0Y A;  2KOP A;  2KGD A;  2LML A;  2FAE A;  1X3O A;  4R0M A;  2AVA A;  2L0Q A;  3EJD A;  2LIW A;  2KG9 A;  2ROQ A;  3GZM A;  2N98 A;  2KGC A;  2K92 A;  2KG8 A;  2FHS C;  3NY7 B;  5KP7 B;  1F80 D;  1KLP A;  2XZ1 C;  4PWV B;  5CZD B;  2KWL A;  2MVV A;  2X2B A;  5KP6 B;  4BPG A;  2CG5 B;  5EJD A;  4CA3 A;  2KGA A;  2MY5 A;  2N6Y A;  4DG9 A;  3EJE A;  1DNY A;  2L22 A;  2K0X A;  2N50 A;  2MR8 A;  2JU1 A;  2LPK A;  1HY8 A;  2GDY A;  1L0H A;  4H2W C;  2CNR A;  2JQ4 A;  2XZ0 D;  2MD9 A;  1NQ4 A;  2L9F A;  2K2Q A;  2K94 A;  4IZ6 A;  1VKU A;  5KP8 B;  2AF8 A;  2LL8 A;  2M5R A;  2FVF A;  3CE7 A;  2FAD A;  2MR7 A;  3RG2 A;  2KR5 A;  2LOL A;  2KGE A;  2EHS A;  2PNG A;  1OR5 A;  1HQB A;  1L0I A;  1DV5 A; 
#chains in the Genus database with same CATH topology
 2N6Z A;  2KOS A;  2FQ1 A;  2N5H A;  2PEO A;  1M90 Q;  1QRJ A;  2PEN A;  1ACP A;  1VQ8 P;  5BS1 A;  3I56 P;  2KOQ A;  2GDX A;  1VQ9 P;  1VQK P;  3EJB A;  2FQ2 A;  2JYL A;  5EW5 E;  2LTE A;  1VQN P;  5HVC A;  2FVA A;  2EHT A;  1KD1 Q;  5F2N A;  2K93 A;  4U0C A;  3CCU P;  3CME P;  2OTJ P;  3DS3 A;  2LIU A;  2JU2 A;  2CWO A;  1QVF O;  2Z46 A;  4XFY A;  4R0M A;  4M0I A;  3EJD A;  2GZI A;  2JYG A;  2DGY A;  3NY7 B;  5KP7 B;  2WPT A;  1EIA A;  2XZ1 C;  1K30 A;  1VQL P;  4CA3 A;  3EJE A;  2N50 A;  1HY8 A;  2GDY A;  1L0H A;  4H2W C;  2EG5 A;  2XZ0 D;  1YJN P;  2L9F A;  5HGL A;  3G6E P;  1VQM P;  1K73 Q;  1VKU A;  2M5R A;  3CE7 A;  5HGO A;  5HGM A;  3RG2 A;  1AUM A;  2KGE A;  1W2B O;  1FR2 A;  3G1I A;  4XRO A;  2L6E A;  3CCL P;  3G1G A;  1A8O A;  1M1K Q;  3G0V A;  4QNB A;  2QNW A;  2GZJ A;  3CD6 P;  2KG6 A;  1JJ2 O;  2CQ8 A;  4NEO A;  1ZMB A;  2DNW A;  4MRT C;  4XFZ A;  1Q82 Q;  3CC2 P;  4GR2 A;  2L4B A;  4UHP B;  4PXH B;  4WYM A;  3GJN A;  5HV8 A;  1A43 A;  3CCV P;  2MVU A;  3B5I A;  2K0Y A;  2KGD A;  3U43 A;  1X3O A;  3CMA P;  3MGE A;  3RG6 C;  2AVA A;  4U0F A;  1E6J P;  2OTL P;  3GZM A;  2N98 A;  2KGC A;  2JAZ A;  2VLN A;  2KG8 A;  1CEI A;  5F2O A;  2KOD A;  1F80 D;  1VQ6 P;  1KLP A;  4PWV B;  2VLP A;  3CC7 P;  2X2B A;  3VRL C;  3G29 A;  1VQO P;  2OAR A;  4U0D A;  4BPG A;  1Z6M A;  5EJD A;  3Q20 A;  1GXH A;  4DG9 A;  2PY8 A;  2MR8 A;  2JU1 A;  2LPK A;  1AYI A;  1MZ8 A;  2CNR A;  3DTJ A;  4XFX A;  3DS1 A;  2K2Q A;  1KQS O;  1E0H A;  5KP8 B;  1RO2 A;  2PEK A;  2LF4 A;  2FVF A;  1S72 P;  2EHS A;  1D1D A;  1ZNV A;  2PNG A;  1N8R Q;  3G21 A;  1RNI A;  1M74 A;  2ERH A;  1IMQ A;  1VQ4 P;  3WBH A;  3CCJ P;  4IPY A;  3G71 P;  1IMP A;  2XXM A;  2JB0 A;  4BPH A;  2JGP A;  1RO0 A;  5JPA A;  1AF8 A;  2ONT A;  2GDW A;  2FQ0 A;  4PH1 A;  1NJI Q;  3GKL C;  2FAC A;  2MF4 A;  3DS4 A;  1BXI A;  2JBG A;  2AFE A;  3OW2 O;  2M8L A;  1VQ7 P;  4U0E A;  2M8P A;  3B4Q A;  2CGQ A;  2KOP A;  7CEI A;  2FAE A;  2GZG A;  2EFJ A;  2LIW A;  2NO8 A;  2KG9 A;  2Z45 A;  2E1M A;  2K92 A;  1YJ9 P;  1YI2 P;  3LRY A;  3CPW O;  5CZD B;  1YIT P;  2CG5 B;  2Z44 A;  2MY5 A;  1UNK A;  3DS0 A;  1VQ5 P;  2L22 A;  1DNY A;  2K0X A;  1Q7Y Q;  2GYK A;  4QKO A;  3CCR P;  2EIA A;  2MD9 A;  3H4E A;  3CXC O;  2K94 A;  4IZ6 A;  4F37 A;  3NTE A;  2AF8 A;  2PEM A;  2M8N A;  2LL8 A;  3CCM P;  5DCK A;  1QVG O;  2MR7 A;  3P05 A;  2LOL A;  3I55 P;  3CCE P;  1GXG A;  1EMV A;  5HGN A;  1OR5 A;  1EOQ A;  1HQB A;  3E2D A;  2XV6 A;  2LKI A;  2KOR A;  2KOO A;  3DPH A;  2VSQ A;  1YHQ P;  2N5I A;  4U0A A;  2FVE A;  3LMO A;  1K9M Q;  4BPF A;  4HKG A;  2QA4 P;  2BHV A;  3G4S P;  3G26 A;  4H2X C;  3H0D A;  2K0D X;  3G28 A;  5BS2 A;  3CCS P;  1VQP P;  2K5X A;  2PEJ A;  1VHN A;  4H2Y C;  2PEI A;  1M6N A;  4PH0 A;  2BUO A;  2KW2 A;  1KC8 Q;  3GZL A;  1T8K A;  2GZF A;  1IUQ A;  3CCQ P;  3HYB A;  4XRQ A;  2AFD A;  1Q86 Q;  2LML A;  3DS2 A;  3CC4 P;  3HZQ A;  1BAJ A;  2L0Q A;  1UJZ A;  3H47 A;  2ROQ A;  2VLO A;  3DS5 A;  1YIJ P;  2GZE A;  2FHS C;  1YJW P;  2KWL A;  2MVV A;  5I4T G;  5KP6 B;  2KGA A;  2N6Y A;  2XT1 A;  1M6E X;  1GPJ A;  2JQ4 A;  4COC A;  3M1M A;  1NQ4 A;  4COP A;  2JO0 A;  4U0B A;  5F2K A;  1Q81 Q;  2P9X A;  2VLQ A;  2FAD A;  2QEX P;  2KR5 A;  4GR6 A;  2PEQ A;  1K8A Q;  1L0I A;  1DV5 A; 
#chains in the Genus database with same CATH homology
 2N6Z A;  2KOS A;  2LKI A;  2KOR A;  2KOO A;  2FQ1 A;  2VSQ A;  2N5I A;  2FVE A;  2N5H A;  2QNW A;  3LMO A;  4BPH A;  2JGP A;  4BPF A;  4HKG A;  1ACP A;  2KG6 A;  2CQ8 A;  4NEO A;  1AF8 A;  2KOQ A;  4H2X C;  2DNW A;  2GDX A;  2GDW A;  2FQ0 A;  4MRT C;  3EJB A;  2FQ2 A;  2FAC A;  2MF4 A;  2LTE A;  4H2Y C;  2L4B A;  5HVC A;  2FVA A;  2EHT A;  2AFE A;  2KW2 A;  4PXH B;  2K93 A;  3GZL A;  5HV8 A;  1T8K A;  2MVU A;  2LIU A;  2JU2 A;  2AFD A;  2CGQ A;  2K0Y A;  2KOP A;  2KGD A;  2LML A;  2FAE A;  1X3O A;  4R0M A;  2AVA A;  2L0Q A;  3EJD A;  2LIW A;  2KG9 A;  2ROQ A;  3GZM A;  2N98 A;  2KGC A;  2K92 A;  2KG8 A;  2FHS C;  3NY7 B;  5KP7 B;  1F80 D;  1KLP A;  2XZ1 C;  4PWV B;  5CZD B;  2KWL A;  2MVV A;  2X2B A;  5KP6 B;  4BPG A;  2CG5 B;  5EJD A;  4CA3 A;  2KGA A;  2MY5 A;  2N6Y A;  4DG9 A;  3EJE A;  1DNY A;  2L22 A;  2K0X A;  2N50 A;  2MR8 A;  2JU1 A;  2LPK A;  1HY8 A;  2GDY A;  1L0H A;  4H2W C;  2CNR A;  2JQ4 A;  2XZ0 D;  2MD9 A;  1NQ4 A;  2L9F A;  2K2Q A;  2K94 A;  4IZ6 A;  1VKU A;  5KP8 B;  2AF8 A;  2LL8 A;  2M5R A;  2FVF A;  3CE7 A;  2FAD A;  2MR7 A;  3RG2 A;  2KR5 A;  2LOL A;  2KGE A;  2EHS A;  2PNG A;  1OR5 A;  1HQB A;  1L0I A;  1DV5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...