1HY8A

Solution structure of b. subtilis acyl carrier protein
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
76
structure length
76
Chain Sequence
ADTLERVTKIIVDRLGVDEADVKLEASFKEDLGADSLDVVELVMELEDEFDMEISDEDAEKIATVGDAVNYIQNQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACYL CARRIER PROTEIN
publication title Solution structure of B. subtilis acyl carrier protein.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Lipid binding protein
total genus 20
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2001-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 1hy8A00
2QNWA 3LMOA 1T8KA 5KP7B 2L9FA 1X3OA 2MVUA 5HV8A 5HVCA 2ROQA 1F80D 2N98A 3RG2A 2JGPA 4BPFA 2EHSA 2LPKA 2MVVA 2N6YA 2KOPA 2N5HA 5KP8B 2K92A 2VSQA 1ACPA 4BPGA 2FAEA 2KWLA 2KGAA 2MR8A 4CA3A 4HKGA 2KOSA 2MD9A 2K2QA 2N6ZA 3NY7B 4R0MA 2KOOA 1NQ4A 2DNWA 1DNYA 2K94A 3GZMA 2LOLA 2MY5A 2LTEA 2N5IA 2FACA 2KGCA 4PXHB 5EJDA 1HQBA 4H2YC 2KR5A 2PNGA 2KG8A 1L0HA 1L0IA 4H2WC 2LIUA 2LKIA 1DV5A 2FADA 2CNRA 1HY8A 4BPHA 1VKUA 2FVAA 2KOQA 2KG9A 2XZ1C 2L22A 2GDYA 2FQ0A 2XZ0D 2FHSC 2X2BA 3CE7A 2AVAA 2LL8A 2K0XA 2K93A 4H2XC 2JQ4A 2GDXA 2KGDA 2CGQA 2JU1A 3EJEA 2JU2A 3EJDA 2MR7A 2M5RA 2AF8A 2L4BA 2FVEA 3GZLA 2EHTA 2KW2A 2FQ2A 5KP6B 4NEOA 2CQ8A 4DG9A 2AFDA 1KLPA 2N50A 1AF8A 2FVFA 2KG6A 2LIWA 2L0QA 2KGEA 2LMLA 2K0YA 2GDWA 2FQ1A 2CG5B 3EJBA 2AFEA 4IZ6A 4MRTC 5CZDB 2MF4A 4PWVB 2KORA 1OR5A
chains in the Genus database with same CATH superfamily
2PEJA 1EIAA 4XFXA 3LMOA 3DPHA 5KP7B 1VQOP 1FR2A 2OTLP 1X3OA 5HGNA 2M8PA 2KODA 2N98A 3H4EA 3RG2A 2JGPA 4BPFA 2QEXP 2PEQA 4U0CA 1ACPA 2FAEA 3CC2P 4CA3A 3NY7B 2KOOA 3G28A 1NQ4A 3CMAP 5F2KA 3CCLP 1KC8Q 3H0DA 1UJZA 2ONTA 1VQ8P 1VQMP 2KR5A 2KG8A 1Q81Q 2GYKA 2LIUA 3CCJP 2FADA 3GJNA 1YJ9P 3CCRP 3G71P 1QRJA 1A8OA 3G4SP 2X2BA 2JAZA 1VQPP 3CE7A 2AVAA 2VLNA 3HYBA 2GZEA 2GDXA 2JQ4A 2GZIA 2AF8A 1K8AQ 3HZQA 3CCVP 1M6EX 2P9XA 2Z45A 3MGEA 4PH1A 5BS1A 2BHVA 3DS2A 3G21A 2KG6A 4U0BA 2L0QA 1GPJA 3B5IA 2QA4P 1W2BO 1MZ8A 2AFEA 4MRTC 3CCQP 2PEOA 1Q82Q 2EFJA 1BXIA 4XRQA 5HV8A 5HVCA 2LPKA 3CCEP 2MVVA 3CXCO 2N6YA 5KP8B 1BAJA 1GXHA 2KWLA 2MR8A 2KOSA 3G26A 1K30A 4R0MA 5EW5E 3DS3A 1D1DA 2XXMA 1K73Q 3GZMA 3NTEA 2ERHA 2N5IA 2KGCA 4PXHB 3RG6C 1N8RQ 2K0DX 2PNGA 1L0IA 2VLOA 1Q7YQ 4XROA 1S72P 2CNRA 1CEIA 3E2DA 2GZJA 2KG9A 2Z46A 2GDYA 4H2XC 2CGQA 2MR7A 3DS0A 1RO0A 2FVEA 3DS1A 2KW2A 4COPA 4U0DA 1VQ4P 2CQ8A 3G0VA 2AFDA 1KLPA 2VLQA 3DS4A 3VRLC 2N50A 4QKOA 2FVFA 3OW2O 2KGEA 2LMLA 2PEMA 1M90Q 2CG5B 1YIJP 1AUMA 1E6JP 1VQKP 2MF4A 1Z6MA 5F2NA 1EOQA 1YI2P 1A43A 2L9FA 7CEIA 1E0HA 1F80D 1QVFO 1KD1Q 2M8LA 1VHNA 1YJWP 1ZMBA 2EHSA 1VQNP 1Q86Q 4U0EA 1RO2A 2VLPA 2VSQA 5I4TG 2KGAA 3M1MA 2JBGA 1K9MQ 1IMPA 2MD9A 2N6ZA 1NJIQ 2DNWA 2JO0A 3I56P 1DNYA 2MY5A 2LTEA 2FACA 3GKLC 5EJDA 1HQBA 2XT1A 2XV6A 5BS2A 3P05A 2DGYA 2LKIA 1GXGA 1UNKA 4IPYA 1VKUA 1IUQA 2FVAA 4XFYA 2PENA 5JPAA 2PY8A 1IMQA 2FQ0A 2OTJP 2LL8A 2K93A 5DCKA 3CC7P 3EJEA 1RNIA 3CD6P 2JU2A 3EJDA 2M5RA 4F37A 2EHTA 3G6EP 5HGOA 4DG9A 2LF4A 1YJNP 1AF8A 4GR2A 2LIWA 3U43A 2JYLA 2GZGA 2FQ1A 3CC4P 2E1MA 3EJBA 5CZDB 2Z44A 3CCMP 1OR5A 3CMEP 3Q20A 2QNWA 1T8KA 1VQLP 4M0IA 2MVUA 1M74A 5HGMA 5F2OA 2ROQA 3CPWO 2JYGA 1M1KQ 1VQ9P 4U0AA 2KOPA 2N5HA 2K92A 4QNBA 4BPGA 2BUOA 3G1IA 4HKGA 2K2QA 1M6NA 2EG5A 5HGLA 3LRYA 2K94A 2OARA 4XFZA 2LOLA 2M8NA 3CCUP 2L6EA 1ZNVA 1KQSO 3B4QA 2WPTA 4WYMA 4H2YC 1L0HA 1JJ2O 4H2WC 2EIAA 3CCSP 1YHQP 2PEKA 1DV5A 1HY8A 4BPHA 3H47A 3DS5A 4UHPB 2KOQA 2XZ1C 2L22A 3WBHA 2XZ0D 2FHSC 1VQ6P 2NO8A 3G1GA 2K0XA 2KGDA 4GR6A 1VQ5P 2JB0A 4U0FA 2JU1A 4PH0A 3DTJA 2L4BA 3GZLA 2FQ2A 5KP6B 3I55P 4NEOA 2PEIA 3G29A 2K5XA 4COCA 1VQ7P 1EMVA 1YITP 2K0YA 2GDWA 1AYIA 2CWOA 4IZ6A 2GZFA 4PWVB 2KORA 1QVGO
chains in the Genus database with same CATH topology
2QNWA 3LMOA 1T8KA 5KP7B 2L9FA 1X3OA 2MVUA 5HV8A 5HVCA 2ROQA 1F80D 2N98A 3RG2A 2JGPA 4BPFA 2EHSA 2LPKA 2MVVA 2N6YA 2KOPA 2N5HA 5KP8B 2K92A 2VSQA 1ACPA 4BPGA 2FAEA 2KWLA 2KGAA 2MR8A 4CA3A 4HKGA 2KOSA 2MD9A 2K2QA 2N6ZA 3NY7B 4R0MA 2KOOA 1NQ4A 2DNWA 1DNYA 2K94A 3GZMA 2LOLA 2MY5A 2LTEA 2N5IA 2FACA 2KGCA 4PXHB 5EJDA 1HQBA 4H2YC 2KR5A 2PNGA 2KG8A 1L0HA 1L0IA 4H2WC 2LIUA 2LKIA 1DV5A 2FADA 2CNRA 1HY8A 4BPHA 1VKUA 2FVAA 2KOQA 2KG9A 2XZ1C 2L22A 2GDYA 2FQ0A 2XZ0D 2FHSC 2X2BA 3CE7A 2AVAA 2LL8A 2K0XA 2K93A 4H2XC 2JQ4A 2GDXA 2KGDA 2CGQA 2JU1A 3EJEA 2JU2A 3EJDA 2MR7A 2M5RA 2AF8A 2L4BA 2FVEA 3GZLA 2EHTA 2KW2A 2FQ2A 5KP6B 4NEOA 2CQ8A 4DG9A 2AFDA 1KLPA 2N50A 1AF8A 2FVFA 2KG6A 2LIWA 2L0QA 2KGEA 2LMLA 2K0YA 2GDWA 2FQ1A 2CG5B 3EJBA 2AFEA 4IZ6A 4MRTC 5CZDB 2MF4A 4PWVB 2KORA 1OR5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QNW A;  3LMO A;  1T8K A;  5KP7 B;  2L9F A;  1X3O A;  2MVU A;  5HV8 A;  5HVC A;  2ROQ A;  1F80 D;  2N98 A;  3RG2 A;  2JGP A;  4BPF A;  2EHS A;  2LPK A;  2MVV A;  2N6Y A;  2KOP A;  2N5H A;  5KP8 B;  2K92 A;  2VSQ A;  1ACP A;  4BPG A;  2FAE A;  2KWL A;  2KGA A;  2MR8 A;  4CA3 A;  4HKG A;  2KOS A;  2MD9 A;  2K2Q A;  2N6Z A;  3NY7 B;  4R0M A;  2KOO A;  1NQ4 A;  2DNW A;  1DNY A;  2K94 A;  3GZM A;  2LOL A;  2MY5 A;  2LTE A;  2N5I A;  2FAC A;  2KGC A;  4PXH B;  5EJD A;  1HQB A;  4H2Y C;  2KR5 A;  2PNG A;  2KG8 A;  1L0H A;  1L0I A;  4H2W C;  2LIU A;  2LKI A;  1DV5 A;  2FAD A;  2CNR A;  1HY8 A;  4BPH A;  1VKU A;  2FVA A;  2KOQ A;  2KG9 A;  2XZ1 C;  2L22 A;  2GDY A;  2FQ0 A;  2XZ0 D;  2FHS C;  2X2B A;  3CE7 A;  2AVA A;  2LL8 A;  2K0X A;  2K93 A;  4H2X C;  2JQ4 A;  2GDX A;  2KGD A;  2CGQ A;  2JU1 A;  3EJE A;  2JU2 A;  3EJD A;  2MR7 A;  2M5R A;  2AF8 A;  2L4B A;  2FVE A;  3GZL A;  2EHT A;  2KW2 A;  2FQ2 A;  5KP6 B;  4NEO A;  2CQ8 A;  4DG9 A;  2AFD A;  1KLP A;  2N50 A;  1AF8 A;  2FVF A;  2KG6 A;  2LIW A;  2L0Q A;  2KGE A;  2LML A;  2K0Y A;  2GDW A;  2FQ1 A;  2CG5 B;  3EJB A;  2AFE A;  4IZ6 A;  4MRT C;  5CZD B;  2MF4 A;  4PWV B;  2KOR A;  1OR5 A; 
#chains in the Genus database with same CATH topology
 2PEJ A;  1EIA A;  4XFX A;  3LMO A;  3DPH A;  5KP7 B;  1VQO P;  1FR2 A;  2OTL P;  1X3O A;  5HGN A;  2M8P A;  2KOD A;  2N98 A;  3H4E A;  3RG2 A;  2JGP A;  4BPF A;  2QEX P;  2PEQ A;  4U0C A;  1ACP A;  2FAE A;  3CC2 P;  4CA3 A;  3NY7 B;  2KOO A;  3G28 A;  1NQ4 A;  3CMA P;  5F2K A;  3CCL P;  1KC8 Q;  3H0D A;  1UJZ A;  2ONT A;  1VQ8 P;  1VQM P;  2KR5 A;  2KG8 A;  1Q81 Q;  2GYK A;  2LIU A;  3CCJ P;  2FAD A;  3GJN A;  1YJ9 P;  3CCR P;  3G71 P;  1QRJ A;  1A8O A;  3G4S P;  2X2B A;  2JAZ A;  1VQP P;  3CE7 A;  2AVA A;  2VLN A;  3HYB A;  2GZE A;  2GDX A;  2JQ4 A;  2GZI A;  2AF8 A;  1K8A Q;  3HZQ A;  3CCV P;  1M6E X;  2P9X A;  2Z45 A;  3MGE A;  4PH1 A;  5BS1 A;  2BHV A;  3DS2 A;  3G21 A;  2KG6 A;  4U0B A;  2L0Q A;  1GPJ A;  3B5I A;  2QA4 P;  1W2B O;  1MZ8 A;  2AFE A;  4MRT C;  3CCQ P;  2PEO A;  1Q82 Q;  2EFJ A;  1BXI A;  4XRQ A;  5HV8 A;  5HVC A;  2LPK A;  3CCE P;  2MVV A;  3CXC O;  2N6Y A;  5KP8 B;  1BAJ A;  1GXH A;  2KWL A;  2MR8 A;  2KOS A;  3G26 A;  1K30 A;  4R0M A;  5EW5 E;  3DS3 A;  1D1D A;  2XXM A;  1K73 Q;  3GZM A;  3NTE A;  2ERH A;  2N5I A;  2KGC A;  4PXH B;  3RG6 C;  1N8R Q;  2K0D X;  2PNG A;  1L0I A;  2VLO A;  1Q7Y Q;  4XRO A;  1S72 P;  2CNR A;  1CEI A;  3E2D A;  2GZJ A;  2KG9 A;  2Z46 A;  2GDY A;  4H2X C;  2CGQ A;  2MR7 A;  3DS0 A;  1RO0 A;  2FVE A;  3DS1 A;  2KW2 A;  4COP A;  4U0D A;  1VQ4 P;  2CQ8 A;  3G0V A;  2AFD A;  1KLP A;  2VLQ A;  3DS4 A;  3VRL C;  2N50 A;  4QKO A;  2FVF A;  3OW2 O;  2KGE A;  2LML A;  2PEM A;  1M90 Q;  2CG5 B;  1YIJ P;  1AUM A;  1E6J P;  1VQK P;  2MF4 A;  1Z6M A;  5F2N A;  1EOQ A;  1YI2 P;  1A43 A;  2L9F A;  7CEI A;  1E0H A;  1F80 D;  1QVF O;  1KD1 Q;  2M8L A;  1VHN A;  1YJW P;  1ZMB A;  2EHS A;  1VQN P;  1Q86 Q;  4U0E A;  1RO2 A;  2VLP A;  2VSQ A;  5I4T G;  2KGA A;  3M1M A;  2JBG A;  1K9M Q;  1IMP A;  2MD9 A;  2N6Z A;  1NJI Q;  2DNW A;  2JO0 A;  3I56 P;  1DNY A;  2MY5 A;  2LTE A;  2FAC A;  3GKL C;  5EJD A;  1HQB A;  2XT1 A;  2XV6 A;  5BS2 A;  3P05 A;  2DGY A;  2LKI A;  1GXG A;  1UNK A;  4IPY A;  1VKU A;  1IUQ A;  2FVA A;  4XFY A;  2PEN A;  5JPA A;  2PY8 A;  1IMQ A;  2FQ0 A;  2OTJ P;  2LL8 A;  2K93 A;  5DCK A;  3CC7 P;  3EJE A;  1RNI A;  3CD6 P;  2JU2 A;  3EJD A;  2M5R A;  4F37 A;  2EHT A;  3G6E P;  5HGO A;  4DG9 A;  2LF4 A;  1YJN P;  1AF8 A;  4GR2 A;  2LIW A;  3U43 A;  2JYL A;  2GZG A;  2FQ1 A;  3CC4 P;  2E1M A;  3EJB A;  5CZD B;  2Z44 A;  3CCM P;  1OR5 A;  3CME P;  3Q20 A;  2QNW A;  1T8K A;  1VQL P;  4M0I A;  2MVU A;  1M74 A;  5HGM A;  5F2O A;  2ROQ A;  3CPW O;  2JYG A;  1M1K Q;  1VQ9 P;  4U0A A;  2KOP A;  2N5H A;  2K92 A;  4QNB A;  4BPG A;  2BUO A;  3G1I A;  4HKG A;  2K2Q A;  1M6N A;  2EG5 A;  5HGL A;  3LRY A;  2K94 A;  2OAR A;  4XFZ A;  2LOL A;  2M8N A;  3CCU P;  2L6E A;  1ZNV A;  1KQS O;  3B4Q A;  2WPT A;  4WYM A;  4H2Y C;  1L0H A;  1JJ2 O;  4H2W C;  2EIA A;  3CCS P;  1YHQ P;  2PEK A;  1DV5 A;  1HY8 A;  4BPH A;  3H47 A;  3DS5 A;  4UHP B;  2KOQ A;  2XZ1 C;  2L22 A;  3WBH A;  2XZ0 D;  2FHS C;  1VQ6 P;  2NO8 A;  3G1G A;  2K0X A;  2KGD A;  4GR6 A;  1VQ5 P;  2JB0 A;  4U0F A;  2JU1 A;  4PH0 A;  3DTJ A;  2L4B A;  3GZL A;  2FQ2 A;  5KP6 B;  3I55 P;  4NEO A;  2PEI A;  3G29 A;  2K5X A;  4COC A;  1VQ7 P;  1EMV A;  1YIT P;  2K0Y A;  2GDW A;  1AYI A;  2CWO A;  4IZ6 A;  2GZF A;  4PWV B;  2KOR A;  1QVG O; 
#chains in the Genus database with same CATH homology
 2QNW A;  3LMO A;  1T8K A;  5KP7 B;  2L9F A;  1X3O A;  2MVU A;  5HV8 A;  5HVC A;  2ROQ A;  1F80 D;  2N98 A;  3RG2 A;  2JGP A;  4BPF A;  2EHS A;  2LPK A;  2MVV A;  2N6Y A;  2KOP A;  2N5H A;  5KP8 B;  2K92 A;  2VSQ A;  1ACP A;  4BPG A;  2FAE A;  2KWL A;  2KGA A;  2MR8 A;  4CA3 A;  4HKG A;  2KOS A;  2MD9 A;  2K2Q A;  2N6Z A;  3NY7 B;  4R0M A;  2KOO A;  1NQ4 A;  2DNW A;  1DNY A;  2K94 A;  3GZM A;  2LOL A;  2MY5 A;  2LTE A;  2N5I A;  2FAC A;  2KGC A;  4PXH B;  5EJD A;  1HQB A;  4H2Y C;  2KR5 A;  2PNG A;  2KG8 A;  1L0H A;  1L0I A;  4H2W C;  2LIU A;  2LKI A;  1DV5 A;  2FAD A;  2CNR A;  1HY8 A;  4BPH A;  1VKU A;  2FVA A;  2KOQ A;  2KG9 A;  2XZ1 C;  2L22 A;  2GDY A;  2FQ0 A;  2XZ0 D;  2FHS C;  2X2B A;  3CE7 A;  2AVA A;  2LL8 A;  2K0X A;  2K93 A;  4H2X C;  2JQ4 A;  2GDX A;  2KGD A;  2CGQ A;  2JU1 A;  3EJE A;  2JU2 A;  3EJD A;  2MR7 A;  2M5R A;  2AF8 A;  2L4B A;  2FVE A;  3GZL A;  2EHT A;  2KW2 A;  2FQ2 A;  5KP6 B;  4NEO A;  2CQ8 A;  4DG9 A;  2AFD A;  1KLP A;  2N50 A;  1AF8 A;  2FVF A;  2KG6 A;  2LIW A;  2L0Q A;  2KGE A;  2LML A;  2K0Y A;  2GDW A;  2FQ1 A;  2CG5 B;  3EJB A;  2AFE A;  4IZ6 A;  4MRT C;  5CZD B;  2MF4 A;  4PWV B;  2KOR A;  1OR5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...