2KOPA

Nmr solution structures of 3-oxooctanyl-acp from streptomyces coelicolor fatty acid synthase
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
81
structure length
81
Chain Sequence
b'AATQEEIVAGLAEIVNEIAGIPVEDVKLDKSFTDDLDVDSLSMVEVVVAAEERFDVKIPDDDVKNLKTVGDATKYILDHQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acyl carrier protein
publication title Recognition of intermediate functionality by acyl carrier protein over a complete cycle of fatty acid biosynthesis
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Transport protein
total genus 24
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2009-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2kopA00
2N50A 2MR7A 2K0XA 2KGCA 5KP6B 2AFDA 2KG8A 2VSQA 1F80D 1DV5A 2N5IA 2KOQA 2FHSC 2FQ2A 2KGDA 2N6YA 2FADA 4H2WC 2MVVA 2FVAA 2K92A 2PNGA 5CZDB 4H2XC 2AFEA 3EJDA 5HV8A 2M5RA 2LPKA 2KGAA 1ACPA 4H2YC 2JQ4A 4IZ6A 1X3OA 2CGQA 2EHSA 2GDYA 2MF4A 2ROQA 3NY7B 2LL8A 2FQ0A 3EJEA 2N5HA 2FQ1A 1HQBA 2JGPA 2L9FA 5KP7B 1AF8A 2LMLA 1VKUA 2KG9A 2DNWA 2EHTA 2JU1A 2MY5A 4PXHB 1L0HA 2GDWA 2CQ8A 2KORA 2LOLA 1DNYA 1OR5A 2AVAA 2FVFA 1L0IA 2XZ1C 2K2QA 3GZLA 1T8KA 2KOOA 2QNWA 2MVUA 5EJDA 3CE7A 4BPHA 2CNRA 2L4BA 2X2BA 2LIWA 2FACA 4R0MA 1NQ4A 2LTEA 4DG9A 2KWLA 3LMOA 4BPGA 1HY8A 4BPFA 1KLPA 4NEOA 2MD9A 4CA3A 2KW2A 4PWVB 2K93A 2N98A 3RG2A 2AF8A 2L0QA 2LIUA 2XZ0D 2FVEA 2L22A 2FAEA 2K0YA 3GZMA 2KOPA 5KP8B 2KGEA 2KG6A 2GDXA 2N6ZA 5HVCA 2JU2A 4HKGA 4MRTC 2KOSA 2LKIA 3EJBA 2K94A 2CG5B 2MR8A 2KR5A
chains in the Genus database with same CATH superfamily
3CCLP 2AFDA 1DV5A 2N5IA 1UNKA 3I56P 4F37A 1VQKP 4U0AA 2N6YA 2CWOA 1YJ9P 3DS0A 4H2WC 2FVAA 2K92A 1CEIA 3DS4A 4H2XC 5BS2A 1A8OA 2AFEA 2BHVA 1MZ8A 3H47A 3CMEP 3CPWO 2JQ4A 2CGQA 1Q82Q 3G29A 2EHSA 3GJNA 2PEQA 3WBHA 2LL8A 3G26A 1Q7YQ 1KD1Q 5F2NA 1HQBA 4GR6A 3DPHA 4U0DA 1ZMBA 3I55P 3G4SP 2M8PA 2LMLA 2DNWA 3MGEA 4PXHB 5HGLA 1L0HA 5HGMA 2GDWA 2GZJA 1EMVA 1L0IA 2XZ1C 2K2QA 3GZLA 2KOOA 3G0VA 2Z44A 2K0DX 2MVUA 3CE7A 1EOQA 2CNRA 3B5IA 3B4QA 4GR2A 2LIWA 1RO2A 4IPYA 2VLPA 2P9XA 4DG9A 2JYGA 1K30A 4BPGA 3GKLC 4BPFA 2QEXP 1VQ5P 5JPAA 1S72P 1JJ2O 4QKOA 2N98A 2LIUA 4WYMA 1BAJA 2FAEA 2K0YA 3RG6C 2KOPA 2KGEA 2EIAA 2LKIA 3G28A 1K73Q 2K94A 2MR8A 4XFXA 1W2BO 4UHPB 2VLQA 3CCSP 5KP6B 2KG8A 2KOQA 2FQ2A 1VQ9P 2PEIA 3NTEA 5HGNA 2PNGA 5CZDB 1VQPP 3EJDA 3CMAP 1KC8Q 2ONTA 2LPKA 2KGAA 4H2YC 4IZ6A 5I4TG 2MF4A 3G6EP 2N5HA 2FQ1A 3CCQP 1BXIA 2M8LA 2JGPA 2GYKA 1RO0A 7CEIA 4M0IA 5KP7B 1Z6MA 1AF8A 1M6NA 3DS3A 5F2OA 2EHTA 1FR2A 2MY5A 2PEOA 2CQ8A 1YJWP 2KORA 4PH1A 2LOLA 4U0CA 1OR5A 2AVAA 3CCRP 2JBGA 2JB0A 1VQ8P 1VHNA 2GZGA 3U43A 2OTLP 1VQ6P 1YJNP 1GXHA 1E6JP 3OW2O 4COPA 5HGOA 5F2KA 1GPJA 2KWLA 2Z46A 1HY8A 2L6EA 4NEOA 2MD9A 3G21A 4CA3A 1KQSO 1E0HA 2WPTA 3RG2A 2AF8A 2L0QA 2PY8A 2XZ0D 2GDXA 5HVCA 2JU2A 4HKGA 4MRTC 2KR5A 4XFZA 1VQ7P 2K0XA 3CXCO 3M1MA 2VSQA 1F80D 2QA4P 1VQNP 3HYBA 2KGDA 3CC7P 3G1GA 5BS1A 2VLOA 4XFYA 5HV8A 4PH0A 2XT1A 1AUMA 2KODA 1VQ4P 2ROQA 3CCJP 3NY7B 1IUQA 2FQ0A 3DS2A 3EJEA 2PEKA 2L9FA 2GZEA 3VRLC 1GXGA 3G71P 1YIJP 2KG9A 3CC2P 1QRJA 1K8AQ 1DNYA 2GZFA 1Q86Q 2PEJA 2OTJP 1YITP 1D1DA 2QNWA 4XRQA 1A43A 2L4BA 2LF4A 1YHQP 3P05A 2FACA 2JO0A 1VQMP 2PEMA 3H4EA 3LMOA 2OARA 1Q81Q 1QVFO 1K9MQ 3G1IA 4QNBA 3CCMP 2JAZA 3DS1A 2K93A 2DGYA 4U0BA 2FVEA 3DS5A 3GZMA 2N6ZA 4U0EA 1QVGO 2KOSA 1VQOP 2EG5A 3CCEP 1N8RQ 2N50A 2MR7A 2KGCA 1M1KQ 2FHSC 1M90Q 2FADA 3CD6P 4U0FA 2MVVA 2NO8A 5EW5E 1YI2P 1AYIA 2M5RA 2JYLA 1ACPA 3E2DA 1X3OA 2GDYA 2XV6A 1IMQA 1M6EX 2GZIA 2Z45A 1EIAA 2M8NA 1VKUA 1M74A 2JU1A 3H0DA 1IMPA 1NJIQ 2FVFA 1UJZA 1T8KA 5EJDA 2BUOA 4BPHA 3HZQA 2EFJA 2X2BA 3CC4P 2PENA 4R0MA 1NQ4A 2LTEA 3LRYA 2VLNA 5DCKA 1KLPA 3Q20A 3DTJA 3CCVP 2KW2A 2ERHA 4PWVB 4XROA 2XXMA 2L22A 5KP8B 2KG6A 1VQLP 3CCUP 1RNIA 4COCA 2K5XA 3EJBA 1ZNVA 2E1MA 2CG5B
chains in the Genus database with same CATH topology
2N50A 2MR7A 2K0XA 2KGCA 5KP6B 2AFDA 2KG8A 2VSQA 1F80D 1DV5A 2N5IA 2KOQA 2FHSC 2FQ2A 2KGDA 2N6YA 2FADA 4H2WC 2MVVA 2FVAA 2K92A 2PNGA 5CZDB 4H2XC 2AFEA 3EJDA 5HV8A 2M5RA 2LPKA 2KGAA 1ACPA 4H2YC 2JQ4A 4IZ6A 1X3OA 2CGQA 2EHSA 2GDYA 2MF4A 2ROQA 3NY7B 2LL8A 2FQ0A 3EJEA 2N5HA 2FQ1A 1HQBA 2JGPA 2L9FA 5KP7B 1AF8A 2LMLA 1VKUA 2KG9A 2DNWA 2EHTA 2JU1A 2MY5A 4PXHB 1L0HA 2GDWA 2CQ8A 2KORA 2LOLA 1DNYA 1OR5A 2AVAA 2FVFA 1L0IA 2XZ1C 2K2QA 3GZLA 1T8KA 2KOOA 2QNWA 2MVUA 5EJDA 3CE7A 4BPHA 2CNRA 2L4BA 2X2BA 2LIWA 2FACA 4R0MA 1NQ4A 2LTEA 4DG9A 2KWLA 3LMOA 4BPGA 1HY8A 4BPFA 1KLPA 4NEOA 2MD9A 4CA3A 2KW2A 4PWVB 2K93A 2N98A 3RG2A 2AF8A 2L0QA 2LIUA 2XZ0D 2FVEA 2L22A 2FAEA 2K0YA 3GZMA 2KOPA 5KP8B 2KGEA 2KG6A 2GDXA 2N6ZA 5HVCA 2JU2A 4HKGA 4MRTC 2KOSA 2LKIA 3EJBA 2K94A 2CG5B 2MR8A 2KR5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N50 A;  2MR7 A;  2K0X A;  2KGC A;  5KP6 B;  2AFD A;  2KG8 A;  2VSQ A;  1F80 D;  1DV5 A;  2N5I A;  2KOQ A;  2FHS C;  2FQ2 A;  2KGD A;  2N6Y A;  2FAD A;  4H2W C;  2MVV A;  2FVA A;  2K92 A;  2PNG A;  5CZD B;  4H2X C;  2AFE A;  3EJD A;  5HV8 A;  2M5R A;  2LPK A;  2KGA A;  1ACP A;  4H2Y C;  2JQ4 A;  4IZ6 A;  1X3O A;  2CGQ A;  2EHS A;  2GDY A;  2MF4 A;  2ROQ A;  3NY7 B;  2LL8 A;  2FQ0 A;  3EJE A;  2N5H A;  2FQ1 A;  1HQB A;  2JGP A;  2L9F A;  5KP7 B;  1AF8 A;  2LML A;  1VKU A;  2KG9 A;  2DNW A;  2EHT A;  2JU1 A;  2MY5 A;  4PXH B;  1L0H A;  2GDW A;  2CQ8 A;  2KOR A;  2LOL A;  1DNY A;  1OR5 A;  2AVA A;  2FVF A;  1L0I A;  2XZ1 C;  2K2Q A;  3GZL A;  1T8K A;  2KOO A;  2QNW A;  2MVU A;  5EJD A;  3CE7 A;  4BPH A;  2CNR A;  2L4B A;  2X2B A;  2LIW A;  2FAC A;  4R0M A;  1NQ4 A;  2LTE A;  4DG9 A;  2KWL A;  3LMO A;  4BPG A;  1HY8 A;  4BPF A;  1KLP A;  4NEO A;  2MD9 A;  4CA3 A;  2KW2 A;  4PWV B;  2K93 A;  2N98 A;  3RG2 A;  2AF8 A;  2L0Q A;  2LIU A;  2XZ0 D;  2FVE A;  2L22 A;  2FAE A;  2K0Y A;  3GZM A;  2KOP A;  5KP8 B;  2KGE A;  2KG6 A;  2GDX A;  2N6Z A;  5HVC A;  2JU2 A;  4HKG A;  4MRT C;  2KOS A;  2LKI A;  3EJB A;  2K94 A;  2CG5 B;  2MR8 A;  2KR5 A; 
#chains in the Genus database with same CATH topology
 3CCL P;  2AFD A;  1DV5 A;  2N5I A;  1UNK A;  3I56 P;  4F37 A;  1VQK P;  4U0A A;  2N6Y A;  2CWO A;  1YJ9 P;  3DS0 A;  4H2W C;  2FVA A;  2K92 A;  1CEI A;  3DS4 A;  4H2X C;  5BS2 A;  1A8O A;  2AFE A;  2BHV A;  1MZ8 A;  3H47 A;  3CME P;  3CPW O;  2JQ4 A;  2CGQ A;  1Q82 Q;  3G29 A;  2EHS A;  3GJN A;  2PEQ A;  3WBH A;  2LL8 A;  3G26 A;  1Q7Y Q;  1KD1 Q;  5F2N A;  1HQB A;  4GR6 A;  3DPH A;  4U0D A;  1ZMB A;  3I55 P;  3G4S P;  2M8P A;  2LML A;  2DNW A;  3MGE A;  4PXH B;  5HGL A;  1L0H A;  5HGM A;  2GDW A;  2GZJ A;  1EMV A;  1L0I A;  2XZ1 C;  2K2Q A;  3GZL A;  2KOO A;  3G0V A;  2Z44 A;  2K0D X;  2MVU A;  3CE7 A;  1EOQ A;  2CNR A;  3B5I A;  3B4Q A;  4GR2 A;  2LIW A;  1RO2 A;  4IPY A;  2VLP A;  2P9X A;  4DG9 A;  2JYG A;  1K30 A;  4BPG A;  3GKL C;  4BPF A;  2QEX P;  1VQ5 P;  5JPA A;  1S72 P;  1JJ2 O;  4QKO A;  2N98 A;  2LIU A;  4WYM A;  1BAJ A;  2FAE A;  2K0Y A;  3RG6 C;  2KOP A;  2KGE A;  2EIA A;  2LKI A;  3G28 A;  1K73 Q;  2K94 A;  2MR8 A;  4XFX A;  1W2B O;  4UHP B;  2VLQ A;  3CCS P;  5KP6 B;  2KG8 A;  2KOQ A;  2FQ2 A;  1VQ9 P;  2PEI A;  3NTE A;  5HGN A;  2PNG A;  5CZD B;  1VQP P;  3EJD A;  3CMA P;  1KC8 Q;  2ONT A;  2LPK A;  2KGA A;  4H2Y C;  4IZ6 A;  5I4T G;  2MF4 A;  3G6E P;  2N5H A;  2FQ1 A;  3CCQ P;  1BXI A;  2M8L A;  2JGP A;  2GYK A;  1RO0 A;  7CEI A;  4M0I A;  5KP7 B;  1Z6M A;  1AF8 A;  1M6N A;  3DS3 A;  5F2O A;  2EHT A;  1FR2 A;  2MY5 A;  2PEO A;  2CQ8 A;  1YJW P;  2KOR A;  4PH1 A;  2LOL A;  4U0C A;  1OR5 A;  2AVA A;  3CCR P;  2JBG A;  2JB0 A;  1VQ8 P;  1VHN A;  2GZG A;  3U43 A;  2OTL P;  1VQ6 P;  1YJN P;  1GXH A;  1E6J P;  3OW2 O;  4COP A;  5HGO A;  5F2K A;  1GPJ A;  2KWL A;  2Z46 A;  1HY8 A;  2L6E A;  4NEO A;  2MD9 A;  3G21 A;  4CA3 A;  1KQS O;  1E0H A;  2WPT A;  3RG2 A;  2AF8 A;  2L0Q A;  2PY8 A;  2XZ0 D;  2GDX A;  5HVC A;  2JU2 A;  4HKG A;  4MRT C;  2KR5 A;  4XFZ A;  1VQ7 P;  2K0X A;  3CXC O;  3M1M A;  2VSQ A;  1F80 D;  2QA4 P;  1VQN P;  3HYB A;  2KGD A;  3CC7 P;  3G1G A;  5BS1 A;  2VLO A;  4XFY A;  5HV8 A;  4PH0 A;  2XT1 A;  1AUM A;  2KOD A;  1VQ4 P;  2ROQ A;  3CCJ P;  3NY7 B;  1IUQ A;  2FQ0 A;  3DS2 A;  3EJE A;  2PEK A;  2L9F A;  2GZE A;  3VRL C;  1GXG A;  3G71 P;  1YIJ P;  2KG9 A;  3CC2 P;  1QRJ A;  1K8A Q;  1DNY A;  2GZF A;  1Q86 Q;  2PEJ A;  2OTJ P;  1YIT P;  1D1D A;  2QNW A;  4XRQ A;  1A43 A;  2L4B A;  2LF4 A;  1YHQ P;  3P05 A;  2FAC A;  2JO0 A;  1VQM P;  2PEM A;  3H4E A;  3LMO A;  2OAR A;  1Q81 Q;  1QVF O;  1K9M Q;  3G1I A;  4QNB A;  3CCM P;  2JAZ A;  3DS1 A;  2K93 A;  2DGY A;  4U0B A;  2FVE A;  3DS5 A;  3GZM A;  2N6Z A;  4U0E A;  1QVG O;  2KOS A;  1VQO P;  2EG5 A;  3CCE P;  1N8R Q;  2N50 A;  2MR7 A;  2KGC A;  1M1K Q;  2FHS C;  1M90 Q;  2FAD A;  3CD6 P;  4U0F A;  2MVV A;  2NO8 A;  5EW5 E;  1YI2 P;  1AYI A;  2M5R A;  2JYL A;  1ACP A;  3E2D A;  1X3O A;  2GDY A;  2XV6 A;  1IMQ A;  1M6E X;  2GZI A;  2Z45 A;  1EIA A;  2M8N A;  1VKU A;  1M74 A;  2JU1 A;  3H0D A;  1IMP A;  1NJI Q;  2FVF A;  1UJZ A;  1T8K A;  5EJD A;  2BUO A;  4BPH A;  3HZQ A;  2EFJ A;  2X2B A;  3CC4 P;  2PEN A;  4R0M A;  1NQ4 A;  2LTE A;  3LRY A;  2VLN A;  5DCK A;  1KLP A;  3Q20 A;  3DTJ A;  3CCV P;  2KW2 A;  2ERH A;  4PWV B;  4XRO A;  2XXM A;  2L22 A;  5KP8 B;  2KG6 A;  1VQL P;  3CCU P;  1RNI A;  4COC A;  2K5X A;  3EJB A;  1ZNV A;  2E1M A;  2CG5 B; 
#chains in the Genus database with same CATH homology
 2N50 A;  2MR7 A;  2K0X A;  2KGC A;  5KP6 B;  2AFD A;  2KG8 A;  2VSQ A;  1F80 D;  1DV5 A;  2N5I A;  2KOQ A;  2FHS C;  2FQ2 A;  2KGD A;  2N6Y A;  2FAD A;  4H2W C;  2MVV A;  2FVA A;  2K92 A;  2PNG A;  5CZD B;  4H2X C;  2AFE A;  3EJD A;  5HV8 A;  2M5R A;  2LPK A;  2KGA A;  1ACP A;  4H2Y C;  2JQ4 A;  4IZ6 A;  1X3O A;  2CGQ A;  2EHS A;  2GDY A;  2MF4 A;  2ROQ A;  3NY7 B;  2LL8 A;  2FQ0 A;  3EJE A;  2N5H A;  2FQ1 A;  1HQB A;  2JGP A;  2L9F A;  5KP7 B;  1AF8 A;  2LML A;  1VKU A;  2KG9 A;  2DNW A;  2EHT A;  2JU1 A;  2MY5 A;  4PXH B;  1L0H A;  2GDW A;  2CQ8 A;  2KOR A;  2LOL A;  1DNY A;  1OR5 A;  2AVA A;  2FVF A;  1L0I A;  2XZ1 C;  2K2Q A;  3GZL A;  1T8K A;  2KOO A;  2QNW A;  2MVU A;  5EJD A;  3CE7 A;  4BPH A;  2CNR A;  2L4B A;  2X2B A;  2LIW A;  2FAC A;  4R0M A;  1NQ4 A;  2LTE A;  4DG9 A;  2KWL A;  3LMO A;  4BPG A;  1HY8 A;  4BPF A;  1KLP A;  4NEO A;  2MD9 A;  4CA3 A;  2KW2 A;  4PWV B;  2K93 A;  2N98 A;  3RG2 A;  2AF8 A;  2L0Q A;  2LIU A;  2XZ0 D;  2FVE A;  2L22 A;  2FAE A;  2K0Y A;  3GZM A;  2KOP A;  5KP8 B;  2KGE A;  2KG6 A;  2GDX A;  2N6Z A;  5HVC A;  2JU2 A;  4HKG A;  4MRT C;  2KOS A;  2LKI A;  3EJB A;  2K94 A;  2CG5 B;  2MR8 A;  2KR5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...