2KOPA

Nmr solution structures of 3-oxooctanyl-acp from streptomyces coelicolor fatty acid synthase
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
81
structure length
81
Chain Sequence
AATQEEIVAGLAEIVNEIAGIPVEDVKLDKSFTDDLDVDSLSMVEVVVAAEERFDVKIPDDDVKNLKTVGDATKYILDHQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Acyl carrier protein
publication title Recognition of intermediate functionality by acyl carrier protein over a complete cycle of fatty acid biosynthesis
pubmed doi rcsb
source organism Streptomyces coelicolor
total genus 24
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2009-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2kopA00
2K93A 2VSQA 2LL8A 2LTEA 2FQ0A 4IZ6A 2KOSA 4PXHB 2KG6A 2LOLA 2KOOA 2FQ1A 2MR8A 2AFDA 2KORA 5EJDA 2GDYA 2CG5B 2KGEA 1AF8A 2K2QA 2FVFA 2LIUA 2KGCA 3NY7B 5KP7B 2N50A 4R0MA 1HQBA 1VKUA 2KGDA 2XZ0D 3CE7A 2AVAA 1X3OA 2PNGA 2N6ZA 2QNWA 2X2BA 2N5HA 2XZ1C 1HY8A 1KLPA 3GZMA 2FAEA 4NEOA 2DNWA 2L9FA 2L0QA 2N6YA 2N98A 2FVEA 4HKGA 1DNYA 1F80D 4BPFA 4CA3A 4BPGA 2KWLA 2N5IA 2ROQA 1ACPA 2MR7A 2EHTA 2L22A 2JQ4A 1OR5A 4DG9A 1L0IA 3GZLA 3LMOA 2M5RA 5HVCA 2JU2A 3EJDA 2KGAA 5KP6B 1T8KA 1L0HA 2KR5A 4H2WC 1DV5A 2K92A 2CNRA 2MY5A 2KW2A 2K94A 2KOQA 2MF4A 2LPKA 2AF8A 2GDXA 2MD9A 2MVUA 2AFEA 2FHSC 2L4BA 3EJBA 2K0XA 2FVAA 2KOPA 2LKIA 4H2YC 2LIWA 5CZDB 2JU1A 2LMLA 2KG8A 3EJEA 4PWVB 4H2XC 2KG9A 5HV8A 2FACA 4MRTC 2FQ2A 5KP8B 3RG2A 2CGQA 2EHSA 2JGPA 2MVVA 2CQ8A 1NQ4A 4BPHA 2K0YA 2GDWA 2FADA
chains in the Genus database with same CATH superfamily
2VSQA 1YJWP 2GYKA 2LTEA 2XXMA 1VQ8P 2FQ0A 4PXHB 4XFYA 2GZGA 2KOOA 2FQ1A 2EG5A 2AFDA 2K5XA 4U0AA 1GXHA 3CCMP 2K2QA 2ONTA 2BUOA 2KGCA 1YHQP 1S72P 1K8AQ 1X3OA 3B4QA 1UJZA 2M8PA 2N5HA 1HY8A 4UHPB 4F37A 1M6EX 3DS4A 3CCUP 2L9FA 3CC7P 3CCJP 1F80D 2WPTA 2OARA 2KODA 1KD1Q 1MZ8A 2MR7A 4M0IA 1QVGO 3LMOA 4XRQA 5HVCA 4COPA 1YJ9P 3EJDA 2VLOA 4U0DA 1QRJA 2CNRA 3CCLP 2AF8A 2MD9A 2MVUA 2BHVA 2M8NA 3G1IA 1N8RQ 2PENA 3EJBA 5HGNA 1Q82Q 1A8OA 2LKIA 1E6JP 2LMLA 3CCQP 3B5IA 3HZQA 2MVVA 1NQ4A 1D1DA 3H4EA 2K93A 2LL8A 4IZ6A 2KOSA 2VLPA 1W2BO 2EFJA 5BS1A 3GKLC 2MR8A 1Q7YQ 3CMAP 2KORA 5EJDA 2CG5B 1GPJA 1AF8A 2FVFA 1IUQA 2LIUA 3DTJA 1VKUA 3OW2O 1JJ2O 3CD6P 3U43A 1KQSO 3GZMA 2DNWA 2N98A 4IPYA 4GR2A 1M90Q 3CC2P 2QA4P 4BPGA 2KWLA 2N5IA 3MGEA 3H0DA 2JO0A 1E0HA 4DG9A 5DCKA 2M5RA 4XFZA 2JBGA 3G21A 4WYMA 5KP6B 1L0HA 5HGOA 1EMVA 2E1MA 2CWOA 2M8LA 2EIAA 2K92A 2K94A 2KOQA 2MF4A 2LPKA 1VQKP 2GDXA 3WBHA 3G0VA 1CEIA 4QKOA 1AUMA 1M1KQ 4U0FA 1VQMP 2JU1A 2K0DX 1YJNP 2KG8A 4PWVB 4H2XC 2PEQA 3RG2A 3G29A 1AYIA 2PY8A 1YI2P 2VLNA 1VQ9P 4BPHA 3G1GA 2FADA 1DNYA 1VQOP 4GR6A 3G4SP 2PEMA 3G6EP 2KG6A 3I55P 1M6NA 5F2KA 2GDYA 1KC8Q 4U0BA 2KGEA 1RO0A 3NY7B 3DPHA 2N50A 1ZNVA 3DS5A 3DS1A 2KGDA 1VQ5P 2AVAA 3M1MA 2P9XA 1VQ4P 2X2BA 1FR2A 2XZ1C 4XROA 3DS0A 2DGYA 3P05A 1BAJA 3LRYA 4HKGA 2Z45A 4U0EA 4CA3A 2ROQA 1ACPA 4XFXA 2L22A 1OR5A 1RNIA 1VHNA 2KGAA 2KR5A 2LF4A 2MY5A 5I4TG 2KW2A 2AFEA 2GZEA 5BS2A 2PEIA 5JPAA 3CC4P 2PEJA 2FHSC 2GZJA 2FVAA 2KOPA 3G71P 2LIWA 3EJEA 5HV8A 4MRTC 2FQ2A 5EW5E 1BXIA 2JAZA 1NJIQ 2JGPA 2XV6A 1IMPA 2QEXP 3RG6C 3I56P 2JYLA 2L6EA 5HGMA 1A43A 2JB0A 1YIJP 3H47A 1RO2A 4PH1A 2PEKA 2LOLA 1K9MQ 5HGLA 5F2OA 1VQNP 2GZFA 5KP7B 3G26A 4QNBA 1QVFO 2NO8A 4R0MA 1HQBA 2GZIA 2OTJP 3CMEP 2XZ0D 3CE7A 2PNGA 1K30A 2N6ZA 2QNWA 3VRLC 4U0CA 1KLPA 1Q81Q 3CCVP 2FAEA 4NEOA 2PEOA 3Q20A 2OTLP 1VQ7P 2L0QA 2N6YA 2FVEA 1Z6MA 1K73Q 4BPFA 2JYGA 1EIAA 2EHTA 2JQ4A 2ERHA 3CCEP 1L0IA 3GZLA 3CCRP 2JU2A 2XT1A 3CPWO 1T8KA 2VLQA 1EOQA 1M74A 4H2WC 1VQLP 1Q86Q 1DV5A 1VQPP 3G28A 7CEIA 3CXCO 3DS2A 3GJNA 3CCSP 1ZMBA 3DS3A 1UNKA 2L4BA 2K0XA 4H2YC 5CZDB 2KG9A 1GXGA 3NTEA 2FACA 5KP8B 4COCA 2CGQA 2EHSA 2Z44A 1VQ6P 5F2NA 1IMQA 2CQ8A 4PH0A 1YITP 3E2DA 2Z46A 3HYBA 2K0YA 2GDWA
chains in the Genus database with same CATH topology
2K93A 2VSQA 2LL8A 2LTEA 2FQ0A 4IZ6A 2KOSA 4PXHB 2KG6A 2LOLA 2KOOA 2FQ1A 2MR8A 2AFDA 2KORA 5EJDA 2GDYA 2CG5B 2KGEA 1AF8A 2K2QA 2FVFA 2LIUA 2KGCA 3NY7B 5KP7B 2N50A 4R0MA 1HQBA 1VKUA 2KGDA 2XZ0D 3CE7A 2AVAA 1X3OA 2PNGA 2N6ZA 2QNWA 2X2BA 2N5HA 2XZ1C 1HY8A 1KLPA 3GZMA 2FAEA 4NEOA 2DNWA 2L9FA 2L0QA 2N6YA 2N98A 2FVEA 4HKGA 1DNYA 1F80D 4BPFA 4CA3A 4BPGA 2KWLA 2N5IA 2ROQA 1ACPA 2MR7A 2EHTA 2L22A 2JQ4A 1OR5A 4DG9A 1L0IA 3GZLA 3LMOA 2M5RA 5HVCA 2JU2A 3EJDA 2KGAA 5KP6B 1T8KA 1L0HA 2KR5A 4H2WC 1DV5A 2K92A 2CNRA 2MY5A 2KW2A 2K94A 2KOQA 2MF4A 2LPKA 2AF8A 2GDXA 2MD9A 2MVUA 2AFEA 2FHSC 2L4BA 3EJBA 2K0XA 2FVAA 2KOPA 2LKIA 4H2YC 2LIWA 5CZDB 2JU1A 2LMLA 2KG8A 3EJEA 4PWVB 4H2XC 2KG9A 5HV8A 2FACA 4MRTC 2FQ2A 5KP8B 3RG2A 2CGQA 2EHSA 2JGPA 2MVVA 2CQ8A 1NQ4A 4BPHA 2K0YA 2GDWA 2FADA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K93 A;  2VSQ A;  2LL8 A;  2LTE A;  2FQ0 A;  4IZ6 A;  2KOS A;  4PXH B;  2KG6 A;  2LOL A;  2KOO A;  2FQ1 A;  2MR8 A;  2AFD A;  2KOR A;  5EJD A;  2GDY A;  2CG5 B;  2KGE A;  1AF8 A;  2K2Q A;  2FVF A;  2LIU A;  2KGC A;  3NY7 B;  5KP7 B;  2N50 A;  4R0M A;  1HQB A;  1VKU A;  2KGD A;  2XZ0 D;  3CE7 A;  2AVA A;  1X3O A;  2PNG A;  2N6Z A;  2QNW A;  2X2B A;  2N5H A;  2XZ1 C;  1HY8 A;  1KLP A;  3GZM A;  2FAE A;  4NEO A;  2DNW A;  2L9F A;  2L0Q A;  2N6Y A;  2N98 A;  2FVE A;  4HKG A;  1DNY A;  1F80 D;  4BPF A;  4CA3 A;  4BPG A;  2KWL A;  2N5I A;  2ROQ A;  1ACP A;  2MR7 A;  2EHT A;  2L22 A;  2JQ4 A;  1OR5 A;  4DG9 A;  1L0I A;  3GZL A;  3LMO A;  2M5R A;  5HVC A;  2JU2 A;  3EJD A;  2KGA A;  5KP6 B;  1T8K A;  1L0H A;  2KR5 A;  4H2W C;  1DV5 A;  2K92 A;  2CNR A;  2MY5 A;  2KW2 A;  2K94 A;  2KOQ A;  2MF4 A;  2LPK A;  2AF8 A;  2GDX A;  2MD9 A;  2MVU A;  2AFE A;  2FHS C;  2L4B A;  3EJB A;  2K0X A;  2FVA A;  2KOP A;  2LKI A;  4H2Y C;  2LIW A;  5CZD B;  2JU1 A;  2LML A;  2KG8 A;  3EJE A;  4PWV B;  4H2X C;  2KG9 A;  5HV8 A;  2FAC A;  4MRT C;  2FQ2 A;  5KP8 B;  3RG2 A;  2CGQ A;  2EHS A;  2JGP A;  2MVV A;  2CQ8 A;  1NQ4 A;  4BPH A;  2K0Y A;  2GDW A;  2FAD A; 
#chains in the Genus database with same CATH topology
 2VSQ A;  1YJW P;  2GYK A;  2LTE A;  2XXM A;  1VQ8 P;  2FQ0 A;  4PXH B;  4XFY A;  2GZG A;  2KOO A;  2FQ1 A;  2EG5 A;  2AFD A;  2K5X A;  4U0A A;  1GXH A;  3CCM P;  2K2Q A;  2ONT A;  2BUO A;  2KGC A;  1YHQ P;  1S72 P;  1K8A Q;  1X3O A;  3B4Q A;  1UJZ A;  2M8P A;  2N5H A;  1HY8 A;  4UHP B;  4F37 A;  1M6E X;  3DS4 A;  3CCU P;  2L9F A;  3CC7 P;  3CCJ P;  1F80 D;  2WPT A;  2OAR A;  2KOD A;  1KD1 Q;  1MZ8 A;  2MR7 A;  4M0I A;  1QVG O;  3LMO A;  4XRQ A;  5HVC A;  4COP A;  1YJ9 P;  3EJD A;  2VLO A;  4U0D A;  1QRJ A;  2CNR A;  3CCL P;  2AF8 A;  2MD9 A;  2MVU A;  2BHV A;  2M8N A;  3G1I A;  1N8R Q;  2PEN A;  3EJB A;  5HGN A;  1Q82 Q;  1A8O A;  2LKI A;  1E6J P;  2LML A;  3CCQ P;  3B5I A;  3HZQ A;  2MVV A;  1NQ4 A;  1D1D A;  3H4E A;  2K93 A;  2LL8 A;  4IZ6 A;  2KOS A;  2VLP A;  1W2B O;  2EFJ A;  5BS1 A;  3GKL C;  2MR8 A;  1Q7Y Q;  3CMA P;  2KOR A;  5EJD A;  2CG5 B;  1GPJ A;  1AF8 A;  2FVF A;  1IUQ A;  2LIU A;  3DTJ A;  1VKU A;  3OW2 O;  1JJ2 O;  3CD6 P;  3U43 A;  1KQS O;  3GZM A;  2DNW A;  2N98 A;  4IPY A;  4GR2 A;  1M90 Q;  3CC2 P;  2QA4 P;  4BPG A;  2KWL A;  2N5I A;  3MGE A;  3H0D A;  2JO0 A;  1E0H A;  4DG9 A;  5DCK A;  2M5R A;  4XFZ A;  2JBG A;  3G21 A;  4WYM A;  5KP6 B;  1L0H A;  5HGO A;  1EMV A;  2E1M A;  2CWO A;  2M8L A;  2EIA A;  2K92 A;  2K94 A;  2KOQ A;  2MF4 A;  2LPK A;  1VQK P;  2GDX A;  3WBH A;  3G0V A;  1CEI A;  4QKO A;  1AUM A;  1M1K Q;  4U0F A;  1VQM P;  2JU1 A;  2K0D X;  1YJN P;  2KG8 A;  4PWV B;  4H2X C;  2PEQ A;  3RG2 A;  3G29 A;  1AYI A;  2PY8 A;  1YI2 P;  2VLN A;  1VQ9 P;  4BPH A;  3G1G A;  2FAD A;  1DNY A;  1VQO P;  4GR6 A;  3G4S P;  2PEM A;  3G6E P;  2KG6 A;  3I55 P;  1M6N A;  5F2K A;  2GDY A;  1KC8 Q;  4U0B A;  2KGE A;  1RO0 A;  3NY7 B;  3DPH A;  2N50 A;  1ZNV A;  3DS5 A;  3DS1 A;  2KGD A;  1VQ5 P;  2AVA A;  3M1M A;  2P9X A;  1VQ4 P;  2X2B A;  1FR2 A;  2XZ1 C;  4XRO A;  3DS0 A;  2DGY A;  3P05 A;  1BAJ A;  3LRY A;  4HKG A;  2Z45 A;  4U0E A;  4CA3 A;  2ROQ A;  1ACP A;  4XFX A;  2L22 A;  1OR5 A;  1RNI A;  1VHN A;  2KGA A;  2KR5 A;  2LF4 A;  2MY5 A;  5I4T G;  2KW2 A;  2AFE A;  2GZE A;  5BS2 A;  2PEI A;  5JPA A;  3CC4 P;  2PEJ A;  2FHS C;  2GZJ A;  2FVA A;  2KOP A;  3G71 P;  2LIW A;  3EJE A;  5HV8 A;  4MRT C;  2FQ2 A;  5EW5 E;  1BXI A;  2JAZ A;  1NJI Q;  2JGP A;  2XV6 A;  1IMP A;  2QEX P;  3RG6 C;  3I56 P;  2JYL A;  2L6E A;  5HGM A;  1A43 A;  2JB0 A;  1YIJ P;  3H47 A;  1RO2 A;  4PH1 A;  2PEK A;  2LOL A;  1K9M Q;  5HGL A;  5F2O A;  1VQN P;  2GZF A;  5KP7 B;  3G26 A;  4QNB A;  1QVF O;  2NO8 A;  4R0M A;  1HQB A;  2GZI A;  2OTJ P;  3CME P;  2XZ0 D;  3CE7 A;  2PNG A;  1K30 A;  2N6Z A;  2QNW A;  3VRL C;  4U0C A;  1KLP A;  1Q81 Q;  3CCV P;  2FAE A;  4NEO A;  2PEO A;  3Q20 A;  2OTL P;  1VQ7 P;  2L0Q A;  2N6Y A;  2FVE A;  1Z6M A;  1K73 Q;  4BPF A;  2JYG A;  1EIA A;  2EHT A;  2JQ4 A;  2ERH A;  3CCE P;  1L0I A;  3GZL A;  3CCR P;  2JU2 A;  2XT1 A;  3CPW O;  1T8K A;  2VLQ A;  1EOQ A;  1M74 A;  4H2W C;  1VQL P;  1Q86 Q;  1DV5 A;  1VQP P;  3G28 A;  7CEI A;  3CXC O;  3DS2 A;  3GJN A;  3CCS P;  1ZMB A;  3DS3 A;  1UNK A;  2L4B A;  2K0X A;  4H2Y C;  5CZD B;  2KG9 A;  1GXG A;  3NTE A;  2FAC A;  5KP8 B;  4COC A;  2CGQ A;  2EHS A;  2Z44 A;  1VQ6 P;  5F2N A;  1IMQ A;  2CQ8 A;  4PH0 A;  1YIT P;  3E2D A;  2Z46 A;  3HYB A;  2K0Y A;  2GDW A; 
#chains in the Genus database with same CATH homology
 2K93 A;  2VSQ A;  2LL8 A;  2LTE A;  2FQ0 A;  4IZ6 A;  2KOS A;  4PXH B;  2KG6 A;  2LOL A;  2KOO A;  2FQ1 A;  2MR8 A;  2AFD A;  2KOR A;  5EJD A;  2GDY A;  2CG5 B;  2KGE A;  1AF8 A;  2K2Q A;  2FVF A;  2LIU A;  2KGC A;  3NY7 B;  5KP7 B;  2N50 A;  4R0M A;  1HQB A;  1VKU A;  2KGD A;  2XZ0 D;  3CE7 A;  2AVA A;  1X3O A;  2PNG A;  2N6Z A;  2QNW A;  2X2B A;  2N5H A;  2XZ1 C;  1HY8 A;  1KLP A;  3GZM A;  2FAE A;  4NEO A;  2DNW A;  2L9F A;  2L0Q A;  2N6Y A;  2N98 A;  2FVE A;  4HKG A;  1DNY A;  1F80 D;  4BPF A;  4CA3 A;  4BPG A;  2KWL A;  2N5I A;  2ROQ A;  1ACP A;  2MR7 A;  2EHT A;  2L22 A;  2JQ4 A;  1OR5 A;  4DG9 A;  1L0I A;  3GZL A;  3LMO A;  2M5R A;  5HVC A;  2JU2 A;  3EJD A;  2KGA A;  5KP6 B;  1T8K A;  1L0H A;  2KR5 A;  4H2W C;  1DV5 A;  2K92 A;  2CNR A;  2MY5 A;  2KW2 A;  2K94 A;  2KOQ A;  2MF4 A;  2LPK A;  2AF8 A;  2GDX A;  2MD9 A;  2MVU A;  2AFE A;  2FHS C;  2L4B A;  3EJB A;  2K0X A;  2FVA A;  2KOP A;  2LKI A;  4H2Y C;  2LIW A;  5CZD B;  2JU1 A;  2LML A;  2KG8 A;  3EJE A;  4PWV B;  4H2X C;  2KG9 A;  5HV8 A;  2FAC A;  4MRT C;  2FQ2 A;  5KP8 B;  3RG2 A;  2CGQ A;  2EHS A;  2JGP A;  2MVV A;  2CQ8 A;  1NQ4 A;  4BPH A;  2K0Y A;  2GDW A;  2FAD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...