3CCSP

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2482a
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
total genus 45
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3ccsP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 3ccsP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 3ccsP02
1KC8Q 1YJ9P 1VQMP 1YJWP 3CCUP 3CCLP 1M1KQ 1VQOP 3I56P 1M90Q 2QEXP 1S72P 3G4SP 1NJIQ 1K9MQ 1VQ8P 3CC2P 1QVFO 1KD1Q 1VQ4P 1JJ2O 1VQ9P 3CPWO 1QVGO 1YI2P 3CC7P 1VQ5P 1N8RQ 3CCQP 3CCJP 1VQPP 3OW2O 1YITP 1Q82Q 3G6EP 3CCRP 2OTLP 1Q86Q 1KQSO 3I55P 1K8AQ 1VQ7P 1VQ6P 3CXCO 3CC4P 3CCVP 3CMEP 1VQNP 3CMAP 3CD6P 3CCSP 3CCMP 1YIJP 1Q7YQ 3CCEP 2QA4P 1YHQP 3G71P 1W2BO 1Q81Q 1K73Q 1VQLP 2OTJP 1VQKP 1YJNP
chains in the Genus database with same CATH superfamily
2Q3IA 2HODB 4OH8B 2XV6A 1URQB 1DNYA 1SQPD 2BCCG 2FQ2A 5TISH 2XZ1C 3MHVA 2FYUE 3HRNA 4PD4H 4ASVA 4LGDE 1FZCC 1EZVG 5EJDA 5CCHD 1NAFA 2P10A 1BDDA 3GZLA 2PAJA 3LW5J 2N1TD 3M0DC 4RKUJ 2D2CD 2YO2A 1JOCA 3PJSK 2ZJSE 1AA0A 4LLHA 4CA3A 3L72J 2L5GB 1PP9G 1GK4A 1E0HA 4C46A 1BSNA 3RBXA 2C0WA 5JPAA 3EWKA 3IAOA 4QMAA 1NTZK 5APYA 3D71A 1LTBC 3B4SA 2FFDA 5CCHC 2KORA 1KB9I 1RO0A 2QJYB 2EG5A 3F89A 2FYUG 1SQVJ 2LXCB 3GHGB 4ZMDA 1SQBJ 2C0XA 3SWKA 3TF5A 2GUSA 2I1JA 1URQC 3DPHA 1JY2N 2IDBA 2JJLA 2LTEA 1EZVI 3C8VA 3AE8C 1BSHA 2KGCA 2LXBA 4L74A 2MVUA 1USDA 2AXCA 2QE7H 4AUWA 1NTMJ 1Q90D 3H1HG 3L70J 2Z46A 2WQYC 2HYNA 3B5NB 2OTKE 2CQ8A 4I6MC 2ZFCA 1KILE 1SQVK 1L0NE 4JYBA 4ASWA 3BCCE 3CX5H 1L4AD 7CEIA 1JY3N 4OGQC 2KS1A 2JQ4A 2ITAA 3C9IA 1GW3A 2GZJA 2K93A 1SLQA 2MKVA 3CWBJ 3A2AA 1EIAA 4HJGH 1SQQJ 1SFCA 3H1IG 1ZW0A 2M8RA 1PL5A 2E74B 3P8CE 1G2CA 2K2QA 1M74A 2KWLA 2FYNC 1A02J 2K0YA 2IX7C 3DS2A 3DS5A 2NPSB 4N3YB 2E1MA 3CE7A 3N7NA 2GUVA 4H13C 5KP7B 2B89A 3FXDA 3P8MC 4PH1A 2E75B 1M6NA 2PFXA 3U1CA 2A06D 4BRYA 2E43A 3LW5H 2IYPA 1CI6B 1RH5B 3R2PA 3IF4A 1AUMA 1QX8A 1L0LD 1RE3C 5BU5A 3CCJP 1QL1A 5AVXB 2W6AA 2VSQA 2XDJA 1RF1C 1ZR2A 2QIWA 3B5ND 3V2PA 1AVOA 3G71P 4PJ0H 1S2EA 3PRJA 1IFIA 2XXMA 1QEXA 1LT9A 1VQ5P 2OYHC 2N98A 1VQPP 2QRXA 3H1ID 5KJ7A 2M0BA 1MFZA 2L6EA 2LKMA 3ABVC 5BVZA 4H0LB 1J1EB 2QSIA 2JP3A 2NPSD 4IFFA 2KK7A 3L74G 2N1TC 2AFEA 1M1JB 1EMVA 2N6YA 2B88A 2AF8A 2HLOA 3CC2P 2QVAA 3L35A 2QJKB 1N86A 4PH0A 1L0LG 1ZN5A 2FXOA 1OXZA 1FU1A 2IBZG 4I1LA 2HG5D 1Q86Q 3L74J 3CXHI 5AW2B 1LTTC 3CD6P 3WUTA 2DW3A 2PEOA 4WY4A 2WSSH 2LIWA 1KC8Q 1M1JA 2L9FA 1GL2C 1WMKA 4NPEA 1Y47A 4NPDA 3L75D 1JB0J 2BHVA 5APVA 4JPZB 3L37A 5BU8B 3CCRP 4F37A 3FXEA 2CWOA 1HJ0A 3L70D 2ZYGA 4GKGA 5KLVE 3L73D 2Q3EA 3H4EA 3GHGC 1NH4A 1BGYD 1N73C 3B5IA 1URQA 1NKNA 1P84I 2P9XA 1KQSO 1VQNP 2N1TA 1DEBA 2WMMA 3A0BH 3H1JJ 1LTIC 5EFWB 5B5EH 1L0NG 1SQXG 2FHSC 1JM0A 3GLMA 1K05A 2C9NY 3L72E 1N7SD 1NTZD 4PD4I 5AVYB 3H1HE 3D6ZA 3MD0A 5KLVG 4JBZA 3WUUA 1SQXD 3AEDC 2VLNA 4H44B 3GW6A 2OYHA 1VQLP 4U0EA 2IPPA 3MZWB 4XA4A 5APUA 2Q7CA 4MRTC 3G3ZA 2Q5UA 2ONTA 1GU5A 2J59M 1J1DC 1LTJA 1RE4C 1KILD 1FDIA 2E76C 4IFMA 3KZIH 3O8ZA 2Y0EA 3RK2C 3FGAD 1L0LK 3H1LG 1YJ9P 3G1GA 3HYBA 1FE6A 2A45I 4BWNA 1N2DC 3TNUA 2YKPA 3JCUE 3MTUE 4PV1B 3SWYA 1PIXA 3H1JD 1EXJA 3U59A 3TGUD 4KT0J 5AVQB 2LIUA 1YQ4C 3SFDC 1CSBA 5CJ4A 1WT6A 1IFJA 3CX5D 1BE3J 1PEQA 2L0QA 4WB4A 4YXWH 2K5XA 1SQQE 2P1JA 3I55P 1KYOI 4Z1MH 2ZT9D 1PGPA 1JTHA 4EOTA 4OGQB 1KV4A 3HD7A 4M0IA 5KP6B 3M9BA 2LL8A 1FR2A 3H1LE 1JTHB 4U0FA 1NGMB 3LRYA 4GODA 2V4HA 5K5GB 2PRRA 1GPJA 3H47A 2IBZI 2XZ0D 5APWA 4YXDC 3MUDC 1RY3A 2IFNA 4K35A 2JO1A 3RK3D 4EIJA 1VDFA 4U0CA 2WSCJ 1LGHB 3H6PA 3Q5RA 1J1EC 4XFZA 1U7MA 3IFMA 1N7SC 1HUCA 1A02F 1EQ7A 2XV5A 3GHGA 2O1KA 5EW5E 1SQPE 1Y9BA 3VMAA 2LKIA 1RQUA 1BCCE 2M5RA 4XFYA 3V4WA 1NU1J 2KW2A 2V7QJ 1FOSE 1S72P 2KOOA 1SQXE 3CPWO 1BDCA 2KP8A 1JNMA 4EI2A 1H0TB 2YMKA 2A06E 4U3FJ 1NTZE 3Q5SA 1BE3D 2YKQA 2KODA 3L36A 2W27A 3CLQA 1JCCA 3QH9A 1NAYA 2WSEJ 3HE5B 2G8YA 3P8CD 1VQ7P 1LJ2A 3EJEA 2E42A 5GTIH 1H0TA 4IPYA 1PP9E 3WMM0 3VTPC 3PP5A 1M8OB 4EYYQ 3S4RA 3WBHA 5BS1A 5AVRB 2FYZA 2K9JA 3DS3A 2OYIC 2IFMA 3CCVP 3NY7B 3L71J 3L71D 1ZMEC 2FQ0A 2BCCJ 3FX0A 3AEEC 2QNWA 2KGAA 5CHXA 1URQD 4NEOA 4UB6E 2YMYA 1N7SB 3OJAB 2M3EA 4Y99C 4O9BA 2M8LA 4PV1D 2QJPB 3V2QA 2ROQA 1USEA 2AXTH 1EC5A 2QM7A 2MJZA 3AEGC 1XTCC 1SQBG 2H89C 3F5HA 1M6EX 2WPSA 3L74D 2J5UA 5CBOA 4N6JA 1E6JP 2CGQA 2WSFH 3H1JE 2GZIA 1MFTA 4ZKPA 1OW6A 4QNBA 3WU2H 4H0LC 1IK7A 1T8ZA 1GXHA 3RK2D 1KLPA 3BCCG 1BGYJ 3H25A 3DS4A 2KXPB 5CCGA 3VOPA 4U0BA 3H1HJ 3L70G 2GA1A 1HY8A 1YJWP 5KTBA 3PHLA 2JB0A 1KILC 5AW5B 1LNQA 2GDYA 3I5CA 3V4QA 2PP6A 2IZ0A 2WPVB 2FADA 4XRQA 1KILA 2AEJA 2XU6A 2WT7A 1K04A 3TSIA 4K3AA 1SFCC 1X9VA 1ZMBA 3G28A 2M8NA 3GMAA 3L4FA 3PLNA 2PEJA 1KORA 1YHQP 4WVZA 3IR9A 3CCLP 2K1AA 3O6QA 1RF1B 2ZVOB 4C7RA 3LMOA 1FZCA 1IMQA 1OVVA 2FXMA 1SFCD 3VRLC 3CXCO 2KNCA 3JSVC 1A43A 2E75D 5APXA 2X2BA 4H2YC 3NTEA 2DNWA 1GW4A 3SSUA 5F2OA 4COCA 2K94A 1Z6MA 1JMMA 1IO4A 2MR8A 5HGMA 4D6TJ 1Y8AA 3HTKB 1YITP 1SQXK 2XNDH 1L0ND 1FAVA 1L4AB 3T97B 1FOSF 5APSA 1GDTA 1HF9A 1JY3P 2QJPC 2BEQD 3FWNA 2FY8A 2ZT9C 3KQGA 1KYOE 2D2CC 3R4YA 3RK3B 4ZNCA 4D6TD 5H2FE 1VQOP 2ZXEB 2PEMA 2FFDB 4R4LA 3DS0A 3L73G 4B86A 2K9JB 2J58A 5AVTB 3BVHA 2KG6A 1FZFA 1SQQD 4Y28J 2W8ZA 1X3OA 3P05A 3CCUP 2VLOA 2XZRA 3GF7A 1S5LX 1YI2P 1KYOD 1NTKJ 4U0DA 4PD4D 5CZDB 2KOPA 5KAIH 2Z44A 4U0AA 3WUVA 1RE4A 3S9OA 5B5EE 5BS2A 4YTPC 3CX5E 4PV1C 3M0DA 3CI9A 3ITKA 5E79E 4XROA 2G3AA 1K9MQ 1KFNA 1OMIA 1EXIA 2N50A 2H8PD 2B87A 2KGDA 1PGOA 1OW8A 1FC2C 1YBKA 2Y0DA 2QJKC 1ZOYC 1M1KQ 4W80A 2E76B 1QVFO 1IC2A 3L75G 3CWBD 1EDIA 1LWUC 4U3FE 2NRGA 1BXIA 4GR2A 2K3RA 2R3CA 3II6A 1VPCA 1T2KD 2OYIA 2OTJP 1IZNB 1PZQA 4KHXA 1BCCG 2YIUC 3HZQA 2WPQA 2BCCD 2MD9A 3GJNA 4WY4C 3MP7B 3VYIA 3AEAC 3EFGA 2DGYA 5CBNA 3TGUG 2WPTA 2KOGA 1OZHA 5AVZB 1OIPA 5KLVK 1YYCA 2FFDC 1HJBA 3H1JG 2VLQA 1KQLA 1L0HA 2RKLA 4HH2A 1FDMA 1LT9B 1NU1G 1KD1Q 2MF4A 4GT1A 4BRYB 1PPJG 2L22A 2M8PA 1GTWA 1R5LA 3M0AA 5KAIE 1HQBA 5AW4B 1TU3F 1OWAA 5L8RJ 3USSA 2CK3H 2HPCA 3M06A 1KYOH 3HD7B 2K9YA 2KSEA 3MGNA 4EDFA 2R5BA 3EFFK 1OFCX 4GOEA 3A0HH 2OYOA 2JR8A 1A8OA 3CMEP 4U3FD 3CL3D 1IUQA 2EIAA 1R5SA 3HUSB 4OWFA 2JU1A 1SP4A 5TISE 3VN0A 2R5DA 3TGUE 4Y99B 2HPCB 5DCKA 1NU1D 1IJDB 2M5AB 2E74C 2H43A 1SFCB 5E79H 2FQ1A 3G29A 2PEIA 1SQVG 3SWFA 2UWJE 3V6IA 2YKOA 4H44D 2QA4P 1KZUB 3L71G 4WYMA 2KR5A 1EDLA 2WSEH 3H1KE 3AECC 1P84D 2YIUB 3NFQA 2D2CB 3RK3C 2E75C 1PFIA 1Z56A 1ZNVA 2KNCB 3CX5I 3HUSC 1LTAC 2FACA 3KZIE 1KILB 3E2DA 3DS1A 2B9BA 2V7QH 1PEUA 3L74E 4RJTA 3H1KD 4WBAA 2WSFJ 2JKVA 5F2NA 1KB9D 3SFEC 5CMZA 3BASA 1RF0C 1DH3A 3VP8A 4JF7A 1N73A 1NJIQ 3LIEA 3HE5A 3EJBA 3BRVB 1L0IA 4XFXA 1KQFB 1HBWA 2FYUJ 2FKWB 4I7ZB 3Q1MA 2WVRA 5AW8B 3CC4P 2N9YB 2Q9IA 2BUOA 2E74D 1SQPG 3H1HD 1YJNP 1NQ4A 1NTKD 1HWTC 5AW7B 1MZ8A 1BE3G 4DJGA 3A7OA 2GZFA 1DEEG 2W6BA 3A0HE 3B71A 3KHUA 2FXPA 2FVAA 1Q2NA 1RNIA 2A06G 3TYYA 1UIIA 4IOIH 2H7HA 3HD7D 3L73E 5HGOA 2RH0A 1SQVE 3VMYA 5KJ7D 2AVAA 2ZXXA 1LWUB 3AEBC 3L75E 1FJPA 2PENA 2PY8A 2K0DX 3RBZA 4M3LA 3BCCD 4JYCA 4WY4D 3H32A 1VF5B 2XKMA 5GTHH 3KPEA 4IFDK 2E76D 4H2XC 1IFPA 1X0TA 2O01H 1NO4A 1EZVE 3BRTB 1U57A 1HVVA 3KXDA 1S5LH 1SQXJ 1SQBD 1Q7YQ 1SQQK 3AE4C 5HGNA 1NTZJ 4YPCA 1JEKA 1PV3A 2ERHA 1OVUA 3Q20A 4HKZH 1IFDA 3P7KA 1GK6A 1VF5C 1KQGB 3EJDA 4H13B 4BXLA 2OGUA 4U7JA 3KYQA 3HE4B 1FJKA 2R32A 5AVWB 5AVVB 2ZVNB 2WWWA 2M3BA 2Q1KA 1PP9J 1NTZG 3MUDA 1P84H 3AE3C 5AW3B 3H1LD 1KN7A 2PEKA 2K37A 2Z5IA 1HTLC 2KZJA 3L71E 3RGUA 2KS1B 3UIAA 2O3JA 2JYGA 1ZRTE 1E5WA 2A45G 3WU2E 1VL2A 3CCSP 3V2NA 1L0LE 3AE7C 1DD4A 3NXSA 1N7SA 3A5TA 5AVUB 1W5CE 2JEEA 1NVOA 2AEFA 2JWDA 3LIDA 2MVVA 4R4MA 3L72D 3Q5PA 2RN0A 3AE9C 3VP9A 2JDIH 2KG8A 1MV8A 2JYLA 4H44C 2POHA 2NO8A 1MZ9A 1DIPA 2LPKA 2E5YA 4H2WC 1T3UA 1L0NJ 1AFOA 5GTIE 3G21A 1AVYA 1L4AA 4N78E 1NYHA 3B5NC 2IYOA 3CWBG 1G1JA 1SQQG 3EQ2A 3CWBE 3H1IJ 1J1DB 5C39A 3RK2B 1X22A 3TGUJ 1IK9A 1UNKA 1ACPA 2N1TB 4JQ0D 3CXHE 4W7YA 4XE5B 2LOLA 2O01N 2QM8A 1JY2P 1E79H 1NOHA 3B8EB 2E5TA 1FS0E 3CXHD 2FVFA 2ZAEB 4ZKUA 3RG6C 1LTGC 2HR3A 2QG4A 3CCEP 1N7LA 1T6AA 2NPSC 5AW0B 5DJTB 3H1LJ 4I2LC 1QLED 1YQ3C 3VMXA 1AJYA 1VHNA 1HGVA 1IMPA 1KB9E 1D7MA 3C1LA 1R8EA 1M57D 2L4BA 1ZV8A 3H32B 2EFJA 2IBZE 2GDWA 1U7JA 2BCCE 2KUBA 4W7ZA 2PNGA 1VQ4P 3L72G 1LP1B 1NKZB 3U43A 1XTGB 4C7NB 1GMJA 3E7KA 1K8AQ 1L2PA 1NTKG 2WTYA 3U1AA 1NTMG 2P7JA 5H2FH 1JO5A 3QWOC 5GTHE 2EHSA 1NU1E 2Y9YA 1SQPK 1GD2E 3PTZA 5KP8B 4UB8H 5CCGD 1NTME 1D1DA 1NWQA 1RHZB 4PJ0E 1WRGA 1NTMD 2JGPA 2KOSA 2XNXA 5CJ0A 3GF3A 3BCCJ 2KG9A 1GZLA 2P67A 1K30A 3I56P 4CPGA 5KLIB 2FAEA 1M1JC 3T97A 3L75J 3IN6A 4TT3H 1AQTA 1FZBA 3RL0D 3HUSA 2FBWC 3N4XA 2AFDA 5HVCA 2KOQA 1OW7A 3RL0C 2MR7A 3JC22 2SPZA 1AF8A 5I4TG 1X79B 3HE4A 1JJ2O 2HODA 2VRSA 1DX7A 3AE5C 1N8RQ 1FZGA 2K88A 1AQ5A 1LTJC 2H88C 2PEQA 3CXHH 1FZCB 2KSJA 5KLVJ 1KFMA 4UHPB 1DV5A 2HFED 2WPRA 1S4XA 4DT0A 4BPFA 1VQKP 2Z5HA 3G26A 1IFNA 4MN4C 1EDKA 2QEXP 2NPSA 1L0NK 1PP9D 1YTZT 2KB7P 3ZDMA 1PGQA 1J2JB 3RL0g 3TK1A 4D6TE 1JMBA 1F80D 2YXRB 2O01J 3AE6C 4KJMA 1CW5A 1SQVD 1AYIA 1SS1A 2KI7B 1SQBK 3B5NA 4DCKA 3DTJA 2WSCH 2I8DA 1KB9H 3AE1C 1GXGA 5CCHA 5AW1B 5APTA 2BEZF 3KDPB 1ZRTD 4GDOA 3HD7C 4HKGA 1GL2A 5B66E 1L0LJ 1FZAA 4GR6A 1VKUA 4QKOA 1CZQA 2Y0CA 4N78D 4PWVB 4UB8E 2LR2A 1S1CX 2FYUD 1ZR4A 3M9QA 1VF5D 1OVRA 2OQQA 1VQ9P 2Z45A 4H0LD 4L75A 2JBGA 5KAFE 3TNUB 1X8YA 3RK3E 5KKZB 1SVFA 2AEMA 1FDOA 3S1KA 3OA7A 3AEFC 2L91A 1LT1A 1FBMA 2JU2A 3E1IA 2RMZA 3G1IA 3M1MA 1PPJE 1JCDA 1EZVD 4UB6H 1VQ8P 2OYIB 2R44A 2WT7B 1BE3E 4L73A 5KLIC 3G0VA 4HYTB 3H1IE 5M1BA 2AXTE 2EHTA 2GDXA 4C7NA 1JY3O 1YTZI 2LMLA 2WITA 1LTSC 1LWUA 1EDJA 2CNRA 3D70A 1M56D 1PEMA 1S5LE 2P58A 2KGEA 1QVGO 3GZMA 2FYUK 1MUUA 1NTKK 3TDKA 2R3SA 2I1KA 1S3JA 3CCMP 4IL6E 1CI6A 2JWAA 2Y9ZA 3H1KG 1SQBE 5B66H 5KKZC 2W6JH 1T3JA 1T8KA 1S9KD 3O6QB 1RF1A 1CEIA 4A7PA 3M91A 5F2KA 2FVEA 1Q82Q 2OTLP 1NTKE 1FZEA 4D6TG 4I7ZC 3PH0A 2KLVA 1G1IA 2OARA 4TLFA 4AYCA 1ZLLA 3H0DA 1GL2D 2GZGA 3L70E 1M7LA 2K0XA 2KYVA 2N9BA 3A0BE 3CCQP 2BQ1E 3OW2O 3P32A 2JAZA 4RO0A 2N5HA 5DJUB 1BGYE 3CMAP 3D6YA 2W90A 3RL0B 4GIFA 1YIJP 4PXHB 3L73J 2YNYA 1Q81Q 2QJYC 2Q6QA 1H88A 1RO2A 1UIXA 2NZ2A 4XFJA 5KLVD 2BASA 3GG2A 2KZIA 4OVNF 4IL6X 5KJ7C 1HGZA 5APQA 3Q2YA 5HGLA 1AV1A 4BPGA 5HV8A 3B4QA 2ZT9B 2Z4EA 2VLPA 3MGEA 1H89A 4WY4B 1M90Q 2JO0A 2ZYAA 4BPHA 2M5AA 1G2CB 4DOJA 3MIWA 2N6ZA 1BAJA 1ZP0C 2XT1A 3NMDA 1MKMA 1LTJB 5TJHA 2FYNB 2PGDA 3AE2C 4GOFA 2LF4A 1GU4A 2MY5A 4PD4E 1UJZA 1OX3A 2K92A 3M9HA 2GZEA 2CG5B 3G4SP 3OAKA 2N5IA 4HB1A 1EOQA 3Q3DA 1W2EA 3VMZA 1JUNA 1PPJD 1T2KC 4L76A 1NTMK 2WZ7A 3G6EP 1JY2O 1P84E 3HTKA 4H13D 2CPBA 1NU1K 1N73B 2KIKA 1NHLA 5AVSB 1S9KE 1IFMA 1LT9C 1SQPJ 1OR5A 1L4AC 4OGQD 1KTMA 4DG9A 2YXQB 5AW6B 2CPSA 2IBZD 2W83C 1PEOA 4R0MA 1BCCJ 5KAFH 3CC7P 1BCCD 4IL6H 5AW9B 1BGYG 1VQ6P 3V2RA 4WWIA 3E1RA 1H8AA 2O1JA 2B87B 1KMIZ 4U3FG 1QRJA 1RF0A 3W67A 1RE3A 1VQMP 5CCGC 1GL2B 2GYKA 2GM4A 1QL2A 4COPA 1LP1A 3FWLA 2OYHB 1QGKB 1DD3A 3NTNA 1PGJA 2P2UA 2C9LY 3G9RA 3JCUH 1K73Q 2KLUA 3A3YB 1ZXGA 2IZ1A 3W68A 3RG2A 3GKLC 4NPFX 4LC1A 3H1KJ 2YO3A 1HH0A 3BATA 4RESB 4DZOA 4IZ6A 3V5BA 3K5BA 2ZYDA 1RQVA 2A45H 4AQRD 1W2BO
chains in the Genus database with same CATH topology
4M0IA 2XV6A 3CCLP 4XROA 1K30A 3I56P 4U0FA 3G4SP 1K9MQ 3LRYA 3WBHA 5BS1A 1EOQA 3H47A 5F2KA 3DS3A 1Q82Q 4GR6A 3G6EP 3VRLC 2OTLP 3RG6C 3CXCO 1RNIA 1A8OA 3CCVP 1A43A 3CMEP 2OARA 2PEKA 1EIAA 3CCEP 1IUQA 2EIAA 3NTEA 4U0CA 1VQLP 4U0EA 3CC2P 3H0DA 5F2OA 4COCA 4XFZA 5I4TG 1M1KQ 1QVFO 1M74A 4PH0A 1JJ2O 1VQ9P 2Z45A 2ONTA 1PEOA 3DS2A 5DCKA 5HGMA 3DS5A 3CC7P 5HGOA 1N8RQ 3CCQP 2BQ1E 2E1MA 2M8LA 4GR2A 3OW2O 1YITP 2JYGA 1Q86Q 1VQ6P 2PEQA 3CD6P 3CMAP 3G29A 3CCSP 2PEIA 2PEOA 1YIJP 2EFJA 4PH1A 1M6NA 4XFYA 2QA4P 1Q81Q 1QRJA 2OTJP 2PENA 2PY8A 5JPAA 1VQKP 1KC8Q 1YJ9P 1VQMP 1M6EX 3G1IA 3M1MA 1RO2A 4WYMA 3G26A 1VQOP 3G1GA 1VQ8P 2QEXP 1S72P 3G0VA 3HYBA 1VQ4P 3CPWO 1RO0A 3HZQA 1E6JP 2PEMA 1AUMA 2EG5A 4COPA 2BHVA 3CCJP 3DS0A 5HGLA 4QNBA 3CCRP 3E2DA 3DS1A 1K8AQ 1PEUA 2CWOA 2DGYA 2JYLA 1Q7YQ 3DS4A 4U0BA 5F2NA 3G71P 1K73Q 3DPHA 2KODA 3P05A 3H4EA 3MGEA 1YJWP 3CCUP 1M90Q 2JO0A 2XXMA 1NJIQ 5HGNA 1PEMA 1KD1Q 3G21A 4XFXA 1PEQA 3B5IA 4XRQA 3Q20A 1QVGO 2M8PA 1D1DA 1YI2P 1VQ5P 1BAJA 1VQPP 2P9XA 4U0DA 2XT1A 1KQSO 3I55P 1VQ7P 1ZMBA 3G28A 3CC4P 2Z44A 4U0AA 1VQNP 5BS2A 2M8NA 2Z46A 3CCMP 2LF4A 3DTJA 2PEJA 2BUOA 4IPYA 1YHQP 1W2BO 1YJNP 2L6EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KC8 Q;  1YJ9 P;  1VQM P;  1YJW P;  3CCU P;  3CCL P;  1M1K Q;  1VQO P;  3I56 P;  1M90 Q;  2QEX P;  1S72 P;  3G4S P;  1NJI Q;  1K9M Q;  1VQ8 P;  3CC2 P;  1QVF O;  1KD1 Q;  1VQ4 P;  1JJ2 O;  1VQ9 P;  3CPW O;  1QVG O;  1YI2 P;  3CC7 P;  1VQ5 P;  1N8R Q;  3CCQ P;  3CCJ P;  1VQP P;  3OW2 O;  1YIT P;  1Q82 Q;  3G6E P;  3CCR P;  2OTL P;  1Q86 Q;  1KQS O;  3I55 P;  1K8A Q;  1VQ7 P;  1VQ6 P;  3CXC O;  3CC4 P;  3CCV P;  3CME P;  1VQN P;  3CMA P;  3CD6 P;  3CCS P;  3CCM P;  1YIJ P;  1Q7Y Q;  3CCE P;  2QA4 P;  1YHQ P;  3G71 P;  1W2B O;  1Q81 Q;  1K73 Q;  1VQL P;  2OTJ P;  1VQK P;  1YJN P; 
#chains in the Genus database with same CATH topology
 2Q3I A;  2HOD B;  4OH8 B;  2XV6 A;  1URQ B;  1DNY A;  1SQP D;  2BCC G;  2FQ2 A;  5TIS H;  2XZ1 C;  3MHV A;  2FYU E;  3HRN A;  4PD4 H;  4ASV A;  4LGD E;  1FZC C;  1EZV G;  5EJD A;  5CCH D;  1NAF A;  2P10 A;  1BDD A;  3GZL A;  2PAJ A;  3LW5 J;  2N1T D;  3M0D C;  4RKU J;  2D2C D;  2YO2 A;  1JOC A;  3PJS K;  2ZJS E;  1AA0 A;  4LLH A;  4CA3 A;  3L72 J;  2L5G B;  1PP9 G;  1GK4 A;  1E0H A;  4C46 A;  1BSN A;  3RBX A;  2C0W A;  5JPA A;  3EWK A;  3IAO A;  4QMA A;  1NTZ K;  5APY A;  3D71 A;  1LTB C;  3B4S A;  2FFD A;  5CCH C;  2KOR A;  1KB9 I;  1RO0 A;  2QJY B;  2EG5 A;  3F89 A;  2FYU G;  1SQV J;  2LXC B;  3GHG B;  4ZMD A;  1SQB J;  2C0X A;  3SWK A;  3TF5 A;  2GUS A;  2I1J A;  1URQ C;  3DPH A;  1JY2 N;  2IDB A;  2JJL A;  2LTE A;  1EZV I;  3C8V A;  3AE8 C;  1BSH A;  2KGC A;  2LXB A;  4L74 A;  2MVU A;  1USD A;  2AXC A;  2QE7 H;  4AUW A;  1NTM J;  1Q90 D;  3H1H G;  3L70 J;  2Z46 A;  2WQY C;  2HYN A;  3B5N B;  2OTK E;  2CQ8 A;  4I6M C;  2ZFC A;  1KIL E;  1SQV K;  1L0N E;  4JYB A;  4ASW A;  3BCC E;  3CX5 H;  1L4A D;  7CEI A;  1JY3 N;  4OGQ C;  2KS1 A;  2JQ4 A;  2ITA A;  3C9I A;  1GW3 A;  2GZJ A;  2K93 A;  1SLQ A;  2MKV A;  3CWB J;  3A2A A;  1EIA A;  4HJG H;  1SQQ J;  1SFC A;  3H1I G;  1ZW0 A;  2M8R A;  1PL5 A;  2E74 B;  3P8C E;  1G2C A;  2K2Q A;  1M74 A;  2KWL A;  2FYN C;  1A02 J;  2K0Y A;  2IX7 C;  3DS2 A;  3DS5 A;  2NPS B;  4N3Y B;  2E1M A;  3CE7 A;  3N7N A;  2GUV A;  4H13 C;  5KP7 B;  2B89 A;  3FXD A;  3P8M C;  4PH1 A;  2E75 B;  1M6N A;  2PFX A;  3U1C A;  2A06 D;  4BRY A;  2E43 A;  3LW5 H;  2IYP A;  1CI6 B;  1RH5 B;  3R2P A;  3IF4 A;  1AUM A;  1QX8 A;  1L0L D;  1RE3 C;  5BU5 A;  3CCJ P;  1QL1 A;  5AVX B;  2W6A A;  2VSQ A;  2XDJ A;  1RF1 C;  1ZR2 A;  2QIW A;  3B5N D;  3V2P A;  1AVO A;  3G71 P;  4PJ0 H;  1S2E A;  3PRJ A;  1IFI A;  2XXM A;  1QEX A;  1LT9 A;  1VQ5 P;  2OYH C;  2N98 A;  1VQP P;  2QRX A;  3H1I D;  5KJ7 A;  2M0B A;  1MFZ A;  2L6E A;  2LKM A;  3ABV C;  5BVZ A;  4H0L B;  1J1E B;  2QSI A;  2JP3 A;  2NPS D;  4IFF A;  2KK7 A;  3L74 G;  2N1T C;  2AFE A;  1M1J B;  1EMV A;  2N6Y A;  2B88 A;  2AF8 A;  2HLO A;  3CC2 P;  2QVA A;  3L35 A;  2QJK B;  1N86 A;  4PH0 A;  1L0L G;  1ZN5 A;  2FXO A;  1OXZ A;  1FU1 A;  2IBZ G;  4I1L A;  2HG5 D;  1Q86 Q;  3L74 J;  3CXH I;  5AW2 B;  1LTT C;  3CD6 P;  3WUT A;  2DW3 A;  2PEO A;  4WY4 A;  2WSS H;  2LIW A;  1KC8 Q;  1M1J A;  2L9F A;  1GL2 C;  1WMK A;  4NPE A;  1Y47 A;  4NPD A;  3L75 D;  1JB0 J;  2BHV A;  5APV A;  4JPZ B;  3L37 A;  5BU8 B;  3CCR P;  4F37 A;  3FXE A;  2CWO A;  1HJ0 A;  3L70 D;  2ZYG A;  4GKG A;  5KLV E;  3L73 D;  2Q3E A;  3H4E A;  3GHG C;  1NH4 A;  1BGY D;  1N73 C;  3B5I A;  1URQ A;  1NKN A;  1P84 I;  2P9X A;  1KQS O;  1VQN P;  2N1T A;  1DEB A;  2WMM A;  3A0B H;  3H1J J;  1LTI C;  5EFW B;  5B5E H;  1L0N G;  1SQX G;  2FHS C;  1JM0 A;  3GLM A;  1K05 A;  2C9N Y;  3L72 E;  1N7S D;  1NTZ D;  4PD4 I;  5AVY B;  3H1H E;  3D6Z A;  3MD0 A;  5KLV G;  4JBZ A;  3WUU A;  1SQX D;  3AED C;  2VLN A;  4H44 B;  3GW6 A;  2OYH A;  1VQL P;  4U0E A;  2IPP A;  3MZW B;  4XA4 A;  5APU A;  2Q7C A;  4MRT C;  3G3Z A;  2Q5U A;  2ONT A;  1GU5 A;  2J59 M;  1J1D C;  1LTJ A;  1RE4 C;  1KIL D;  1FDI A;  2E76 C;  4IFM A;  3KZI H;  3O8Z A;  2Y0E A;  3RK2 C;  3FGA D;  1L0L K;  3H1L G;  1YJ9 P;  3G1G A;  3HYB A;  1FE6 A;  2A45 I;  4BWN A;  1N2D C;  3TNU A;  2YKP A;  3JCU E;  3MTU E;  4PV1 B;  3SWY A;  1PIX A;  3H1J D;  1EXJ A;  3U59 A;  3TGU D;  4KT0 J;  5AVQ B;  2LIU A;  1YQ4 C;  3SFD C;  1CSB A;  5CJ4 A;  1WT6 A;  1IFJ A;  3CX5 D;  1BE3 J;  1PEQ A;  2L0Q A;  4WB4 A;  4YXW H;  2K5X A;  1SQQ E;  2P1J A;  3I55 P;  1KYO I;  4Z1M H;  2ZT9 D;  1PGP A;  1JTH A;  4EOT A;  4OGQ B;  1KV4 A;  3HD7 A;  4M0I A;  5KP6 B;  3M9B A;  2LL8 A;  1FR2 A;  3H1L E;  1JTH B;  4U0F A;  1NGM B;  3LRY A;  4GOD A;  2V4H A;  5K5G B;  2PRR A;  1GPJ A;  3H47 A;  2IBZ I;  2XZ0 D;  5APW A;  4YXD C;  3MUD C;  1RY3 A;  2IFN A;  4K35 A;  2JO1 A;  3RK3 D;  4EIJ A;  1VDF A;  4U0C A;  2WSC J;  1LGH B;  3H6P A;  3Q5R A;  1J1E C;  4XFZ A;  1U7M A;  3IFM A;  1N7S C;  1HUC A;  1A02 F;  1EQ7 A;  2XV5 A;  3GHG A;  2O1K A;  5EW5 E;  1SQP E;  1Y9B A;  3VMA A;  2LKI A;  1RQU A;  1BCC E;  2M5R A;  4XFY A;  3V4W A;  1NU1 J;  2KW2 A;  2V7Q J;  1FOS E;  1S72 P;  2KOO A;  1SQX E;  3CPW O;  1BDC A;  2KP8 A;  1JNM A;  4EI2 A;  1H0T B;  2YMK A;  2A06 E;  4U3F J;  1NTZ E;  3Q5S A;  1BE3 D;  2YKQ A;  2KOD A;  3L36 A;  2W27 A;  3CLQ A;  1JCC A;  3QH9 A;  1NAY A;  2WSE J;  3HE5 B;  2G8Y A;  3P8C D;  1VQ7 P;  1LJ2 A;  3EJE A;  2E42 A;  5GTI H;  1H0T A;  4IPY A;  1PP9 E;  3WMM 0;  3VTP C;  3PP5 A;  1M8O B;  4EYY Q;  3S4R A;  3WBH A;  5BS1 A;  5AVR B;  2FYZ A;  2K9J A;  3DS3 A;  2OYI C;  2IFM A;  3CCV P;  3NY7 B;  3L71 J;  3L71 D;  1ZME C;  2FQ0 A;  2BCC J;  3FX0 A;  3AEE C;  2QNW A;  2KGA A;  5CHX A;  1URQ D;  4NEO A;  4UB6 E;  2YMY A;  1N7S B;  3OJA B;  2M3E A;  4Y99 C;  4O9B A;  2M8L A;  4PV1 D;  2QJP B;  3V2Q A;  2ROQ A;  1USE A;  2AXT H;  1EC5 A;  2QM7 A;  2MJZ A;  3AEG C;  1XTC C;  1SQB G;  2H89 C;  3F5H A;  1M6E X;  2WPS A;  3L74 D;  2J5U A;  5CBO A;  4N6J A;  1E6J P;  2CGQ A;  2WSF H;  3H1J E;  2GZI A;  1MFT A;  4ZKP A;  1OW6 A;  4QNB A;  3WU2 H;  4H0L C;  1IK7 A;  1T8Z A;  1GXH A;  3RK2 D;  1KLP A;  3BCC G;  1BGY J;  3H25 A;  3DS4 A;  2KXP B;  5CCG A;  3VOP A;  4U0B A;  3H1H J;  3L70 G;  2GA1 A;  1HY8 A;  1YJW P;  5KTB A;  3PHL A;  2JB0 A;  1KIL C;  5AW5 B;  1LNQ A;  2GDY A;  3I5C A;  3V4Q A;  2PP6 A;  2IZ0 A;  2WPV B;  2FAD A;  4XRQ A;  1KIL A;  2AEJ A;  2XU6 A;  2WT7 A;  1K04 A;  3TSI A;  4K3A A;  1SFC C;  1X9V A;  1ZMB A;  3G28 A;  2M8N A;  3GMA A;  3L4F A;  3PLN A;  2PEJ A;  1KOR A;  1YHQ P;  4WVZ A;  3IR9 A;  3CCL P;  2K1A A;  3O6Q A;  1RF1 B;  2ZVO B;  4C7R A;  3LMO A;  1FZC A;  1IMQ A;  1OVV A;  2FXM A;  1SFC D;  3VRL C;  3CXC O;  2KNC A;  3JSV C;  1A43 A;  2E75 D;  5APX A;  2X2B A;  4H2Y C;  3NTE A;  2DNW A;  1GW4 A;  3SSU A;  5F2O A;  4COC A;  2K94 A;  1Z6M A;  1JMM A;  1IO4 A;  2MR8 A;  5HGM A;  4D6T J;  1Y8A A;  3HTK B;  1YIT P;  1SQX K;  2XND H;  1L0N D;  1FAV A;  1L4A B;  3T97 B;  1FOS F;  5APS A;  1GDT A;  1HF9 A;  1JY3 P;  2QJP C;  2BEQ D;  3FWN A;  2FY8 A;  2ZT9 C;  3KQG A;  1KYO E;  2D2C C;  3R4Y A;  3RK3 B;  4ZNC A;  4D6T D;  5H2F E;  1VQO P;  2ZXE B;  2PEM A;  2FFD B;  4R4L A;  3DS0 A;  3L73 G;  4B86 A;  2K9J B;  2J58 A;  5AVT B;  3BVH A;  2KG6 A;  1FZF A;  1SQQ D;  4Y28 J;  2W8Z A;  1X3O A;  3P05 A;  3CCU P;  2VLO A;  2XZR A;  3GF7 A;  1S5L X;  1YI2 P;  1KYO D;  1NTK J;  4U0D A;  4PD4 D;  5CZD B;  2KOP A;  5KAI H;  2Z44 A;  4U0A A;  3WUV A;  1RE4 A;  3S9O A;  5B5E E;  5BS2 A;  4YTP C;  3CX5 E;  4PV1 C;  3M0D A;  3CI9 A;  3ITK A;  5E79 E;  4XRO A;  2G3A A;  1K9M Q;  1KFN A;  1OMI A;  1EXI A;  2N50 A;  2H8P D;  2B87 A;  2KGD A;  1PGO A;  1OW8 A;  1FC2 C;  1YBK A;  2Y0D A;  2QJK C;  1ZOY C;  1M1K Q;  4W80 A;  2E76 B;  1QVF O;  1IC2 A;  3L75 G;  3CWB D;  1EDI A;  1LWU C;  4U3F E;  2NRG A;  1BXI A;  4GR2 A;  2K3R A;  2R3C A;  3II6 A;  1VPC A;  1T2K D;  2OYI A;  2OTJ P;  1IZN B;  1PZQ A;  4KHX A;  1BCC G;  2YIU C;  3HZQ A;  2WPQ A;  2BCC D;  2MD9 A;  3GJN A;  4WY4 C;  3MP7 B;  3VYI A;  3AEA C;  3EFG A;  2DGY A;  5CBN A;  3TGU G;  2WPT A;  2KOG A;  1OZH A;  5AVZ B;  1OIP A;  5KLV K;  1YYC A;  2FFD C;  1HJB A;  3H1J G;  2VLQ A;  1KQL A;  1L0H A;  2RKL A;  4HH2 A;  1FDM A;  1LT9 B;  1NU1 G;  1KD1 Q;  2MF4 A;  4GT1 A;  4BRY B;  1PPJ G;  2L22 A;  2M8P A;  1GTW A;  1R5L A;  3M0A A;  5KAI E;  1HQB A;  5AW4 B;  1TU3 F;  1OWA A;  5L8R J;  3USS A;  2CK3 H;  2HPC A;  3M06 A;  1KYO H;  3HD7 B;  2K9Y A;  2KSE A;  3MGN A;  4EDF A;  2R5B A;  3EFF K;  1OFC X;  4GOE A;  3A0H H;  2OYO A;  2JR8 A;  1A8O A;  3CME P;  4U3F D;  3CL3 D;  1IUQ A;  2EIA A;  1R5S A;  3HUS B;  4OWF A;  2JU1 A;  1SP4 A;  5TIS E;  3VN0 A;  2R5D A;  3TGU E;  4Y99 B;  2HPC B;  5DCK A;  1NU1 D;  1IJD B;  2M5A B;  2E74 C;  2H43 A;  1SFC B;  5E79 H;  2FQ1 A;  3G29 A;  2PEI A;  1SQV G;  3SWF A;  2UWJ E;  3V6I A;  2YKO A;  4H44 D;  2QA4 P;  1KZU B;  3L71 G;  4WYM A;  2KR5 A;  1EDL A;  2WSE H;  3H1K E;  3AEC C;  1P84 D;  2YIU B;  3NFQ A;  2D2C B;  3RK3 C;  2E75 C;  1PFI A;  1Z56 A;  1ZNV A;  2KNC B;  3CX5 I;  3HUS C;  1LTA C;  2FAC A;  3KZI E;  1KIL B;  3E2D A;  3DS1 A;  2B9B A;  2V7Q H;  1PEU A;  3L74 E;  4RJT A;  3H1K D;  4WBA A;  2WSF J;  2JKV A;  5F2N A;  1KB9 D;  3SFE C;  5CMZ A;  3BAS A;  1RF0 C;  1DH3 A;  3VP8 A;  4JF7 A;  1N73 A;  1NJI Q;  3LIE A;  3HE5 A;  3EJB A;  3BRV B;  1L0I A;  4XFX A;  1KQF B;  1HBW A;  2FYU J;  2FKW B;  4I7Z B;  3Q1M A;  2WVR A;  5AW8 B;  3CC4 P;  2N9Y B;  2Q9I A;  2BUO A;  2E74 D;  1SQP G;  3H1H D;  1YJN P;  1NQ4 A;  1NTK D;  1HWT C;  5AW7 B;  1MZ8 A;  1BE3 G;  4DJG A;  3A7O A;  2GZF A;  1DEE G;  2W6B A;  3A0H E;  3B71 A;  3KHU A;  2FXP A;  2FVA A;  1Q2N A;  1RNI A;  2A06 G;  3TYY A;  1UII A;  4IOI H;  2H7H A;  3HD7 D;  3L73 E;  5HGO A;  2RH0 A;  1SQV E;  3VMY A;  5KJ7 D;  2AVA A;  2ZXX A;  1LWU B;  3AEB C;  3L75 E;  1FJP A;  2PEN A;  2PY8 A;  2K0D X;  3RBZ A;  4M3L A;  3BCC D;  4JYC A;  4WY4 D;  3H32 A;  1VF5 B;  2XKM A;  5GTH H;  3KPE A;  4IFD K;  2E76 D;  4H2X C;  1IFP A;  1X0T A;  2O01 H;  1NO4 A;  1EZV E;  3BRT B;  1U57 A;  1HVV A;  3KXD A;  1S5L H;  1SQX J;  1SQB D;  1Q7Y Q;  1SQQ K;  3AE4 C;  5HGN A;  1NTZ J;  4YPC A;  1JEK A;  1PV3 A;  2ERH A;  1OVU A;  3Q20 A;  4HKZ H;  1IFD A;  3P7K A;  1GK6 A;  1VF5 C;  1KQG B;  3EJD A;  4H13 B;  4BXL A;  2OGU A;  4U7J A;  3KYQ A;  3HE4 B;  1FJK A;  2R32 A;  5AVW B;  5AVV B;  2ZVN B;  2WWW A;  2M3B A;  2Q1K A;  1PP9 J;  1NTZ G;  3MUD A;  1P84 H;  3AE3 C;  5AW3 B;  3H1L D;  1KN7 A;  2PEK A;  2K37 A;  2Z5I A;  1HTL C;  2KZJ A;  3L71 E;  3RGU A;  2KS1 B;  3UIA A;  2O3J A;  2JYG A;  1ZRT E;  1E5W A;  2A45 G;  3WU2 E;  1VL2 A;  3CCS P;  3V2N A;  1L0L E;  3AE7 C;  1DD4 A;  3NXS A;  1N7S A;  3A5T A;  5AVU B;  1W5C E;  2JEE A;  1NVO A;  2AEF A;  2JWD A;  3LID A;  2MVV A;  4R4M A;  3L72 D;  3Q5P A;  2RN0 A;  3AE9 C;  3VP9 A;  2JDI H;  2KG8 A;  1MV8 A;  2JYL A;  4H44 C;  2POH A;  2NO8 A;  1MZ9 A;  1DIP A;  2LPK A;  2E5Y A;  4H2W C;  1T3U A;  1L0N J;  1AFO A;  5GTI E;  3G21 A;  1AVY A;  1L4A A;  4N78 E;  1NYH A;  3B5N C;  2IYO A;  3CWB G;  1G1J A;  1SQQ G;  3EQ2 A;  3CWB E;  3H1I J;  1J1D B;  5C39 A;  3RK2 B;  1X22 A;  3TGU J;  1IK9 A;  1UNK A;  1ACP A;  2N1T B;  4JQ0 D;  3CXH E;  4W7Y A;  4XE5 B;  2LOL A;  2O01 N;  2QM8 A;  1JY2 P;  1E79 H;  1NOH A;  3B8E B;  2E5T A;  1FS0 E;  3CXH D;  2FVF A;  2ZAE B;  4ZKU A;  3RG6 C;  1LTG C;  2HR3 A;  2QG4 A;  3CCE P;  1N7L A;  1T6A A;  2NPS C;  5AW0 B;  5DJT B;  3H1L J;  4I2L C;  1QLE D;  1YQ3 C;  3VMX A;  1AJY A;  1VHN A;  1HGV A;  1IMP A;  1KB9 E;  1D7M A;  3C1L A;  1R8E A;  1M57 D;  2L4B A;  1ZV8 A;  3H32 B;  2EFJ A;  2IBZ E;  2GDW A;  1U7J A;  2BCC E;  2KUB A;  4W7Z A;  2PNG A;  1VQ4 P;  3L72 G;  1LP1 B;  1NKZ B;  3U43 A;  1XTG B;  4C7N B;  1GMJ A;  3E7K A;  1K8A Q;  1L2P A;  1NTK G;  2WTY A;  3U1A A;  1NTM G;  2P7J A;  5H2F H;  1JO5 A;  3QWO C;  5GTH E;  2EHS A;  1NU1 E;  2Y9Y A;  1SQP K;  1GD2 E;  3PTZ A;  5KP8 B;  4UB8 H;  5CCG D;  1NTM E;  1D1D A;  1NWQ A;  1RHZ B;  4PJ0 E;  1WRG A;  1NTM D;  2JGP A;  2KOS A;  2XNX A;  5CJ0 A;  3GF3 A;  3BCC J;  2KG9 A;  1GZL A;  2P67 A;  1K30 A;  3I56 P;  4CPG A;  5KLI B;  2FAE A;  1M1J C;  3T97 A;  3L75 J;  3IN6 A;  4TT3 H;  1AQT A;  1FZB A;  3RL0 D;  3HUS A;  2FBW C;  3N4X A;  2AFD A;  5HVC A;  2KOQ A;  1OW7 A;  3RL0 C;  2MR7 A;  3JC2 2;  2SPZ A;  1AF8 A;  5I4T G;  1X79 B;  3HE4 A;  1JJ2 O;  2HOD A;  2VRS A;  1DX7 A;  3AE5 C;  1N8R Q;  1FZG A;  2K88 A;  1AQ5 A;  1LTJ C;  2H88 C;  2PEQ A;  3CXH H;  1FZC B;  2KSJ A;  5KLV J;  1KFM A;  4UHP B;  1DV5 A;  2HFE D;  2WPR A;  1S4X A;  4DT0 A;  4BPF A;  1VQK P;  2Z5H A;  3G26 A;  1IFN A;  4MN4 C;  1EDK A;  2QEX P;  2NPS A;  1L0N K;  1PP9 D;  1YTZ T;  2KB7 P;  3ZDM A;  1PGQ A;  1J2J B;  3RL0 g;  3TK1 A;  4D6T E;  1JMB A;  1F80 D;  2YXR B;  2O01 J;  3AE6 C;  4KJM A;  1CW5 A;  1SQV D;  1AYI A;  1SS1 A;  2KI7 B;  1SQB K;  3B5N A;  4DCK A;  3DTJ A;  2WSC H;  2I8D A;  1KB9 H;  3AE1 C;  1GXG A;  5CCH A;  5AW1 B;  5APT A;  2BEZ F;  3KDP B;  1ZRT D;  4GDO A;  3HD7 C;  4HKG A;  1GL2 A;  5B66 E;  1L0L J;  1FZA A;  4GR6 A;  1VKU A;  4QKO A;  1CZQ A;  2Y0C A;  4N78 D;  4PWV B;  4UB8 E;  2LR2 A;  1S1C X;  2FYU D;  1ZR4 A;  3M9Q A;  1VF5 D;  1OVR A;  2OQQ A;  1VQ9 P;  2Z45 A;  4H0L D;  4L75 A;  2JBG A;  5KAF E;  3TNU B;  1X8Y A;  3RK3 E;  5KKZ B;  1SVF A;  2AEM A;  1FDO A;  3S1K A;  3OA7 A;  3AEF C;  2L91 A;  1LT1 A;  1FBM A;  2JU2 A;  3E1I A;  2RMZ A;  3G1I A;  3M1M A;  1PPJ E;  1JCD A;  1EZV D;  4UB6 H;  1VQ8 P;  2OYI B;  2R44 A;  2WT7 B;  1BE3 E;  4L73 A;  5KLI C;  3G0V A;  4HYT B;  3H1I E;  5M1B A;  2AXT E;  2EHT A;  2GDX A;  4C7N A;  1JY3 O;  1YTZ I;  2LML A;  2WIT A;  1LTS C;  1LWU A;  1EDJ A;  2CNR A;  3D70 A;  1M56 D;  1PEM A;  1S5L E;  2P58 A;  2KGE A;  1QVG O;  3GZM A;  2FYU K;  1MUU A;  1NTK K;  3TDK A;  2R3S A;  2I1K A;  1S3J A;  3CCM P;  4IL6 E;  1CI6 A;  2JWA A;  2Y9Z A;  3H1K G;  1SQB E;  5B66 H;  5KKZ C;  2W6J H;  1T3J A;  1T8K A;  1S9K D;  3O6Q B;  1RF1 A;  1CEI A;  4A7P A;  3M91 A;  5F2K A;  2FVE A;  1Q82 Q;  2OTL P;  1NTK E;  1FZE A;  4D6T G;  4I7Z C;  3PH0 A;  2KLV A;  1G1I A;  2OAR A;  4TLF A;  4AYC A;  1ZLL A;  3H0D A;  1GL2 D;  2GZG A;  3L70 E;  1M7L A;  2K0X A;  2KYV A;  2N9B A;  3A0B E;  3CCQ P;  2BQ1 E;  3OW2 O;  3P32 A;  2JAZ A;  4RO0 A;  2N5H A;  5DJU B;  1BGY E;  3CMA P;  3D6Y A;  2W90 A;  3RL0 B;  4GIF A;  1YIJ P;  4PXH B;  3L73 J;  2YNY A;  1Q81 Q;  2QJY C;  2Q6Q A;  1H88 A;  1RO2 A;  1UIX A;  2NZ2 A;  4XFJ A;  5KLV D;  2BAS A;  3GG2 A;  2KZI A;  4OVN F;  4IL6 X;  5KJ7 C;  1HGZ A;  5APQ A;  3Q2Y A;  5HGL A;  1AV1 A;  4BPG A;  5HV8 A;  3B4Q A;  2ZT9 B;  2Z4E A;  2VLP A;  3MGE A;  1H89 A;  4WY4 B;  1M90 Q;  2JO0 A;  2ZYA A;  4BPH A;  2M5A A;  1G2C B;  4DOJ A;  3MIW A;  2N6Z A;  1BAJ A;  1ZP0 C;  2XT1 A;  3NMD A;  1MKM A;  1LTJ B;  5TJH A;  2FYN B;  2PGD A;  3AE2 C;  4GOF A;  2LF4 A;  1GU4 A;  2MY5 A;  4PD4 E;  1UJZ A;  1OX3 A;  2K92 A;  3M9H A;  2GZE A;  2CG5 B;  3G4S P;  3OAK A;  2N5I A;  4HB1 A;  1EOQ A;  3Q3D A;  1W2E A;  3VMZ A;  1JUN A;  1PPJ D;  1T2K C;  4L76 A;  1NTM K;  2WZ7 A;  3G6E P;  1JY2 O;  1P84 E;  3HTK A;  4H13 D;  2CPB A;  1NU1 K;  1N73 B;  2KIK A;  1NHL A;  5AVS B;  1S9K E;  1IFM A;  1LT9 C;  1SQP J;  1OR5 A;  1L4A C;  4OGQ D;  1KTM A;  4DG9 A;  2YXQ B;  5AW6 B;  2CPS A;  2IBZ D;  2W83 C;  1PEO A;  4R0M A;  1BCC J;  5KAF H;  3CC7 P;  1BCC D;  4IL6 H;  5AW9 B;  1BGY G;  1VQ6 P;  3V2R A;  4WWI A;  3E1R A;  1H8A A;  2O1J A;  2B87 B;  1KMI Z;  4U3F G;  1QRJ A;  1RF0 A;  3W67 A;  1RE3 A;  1VQM P;  5CCG C;  1GL2 B;  2GYK A;  2GM4 A;  1QL2 A;  4COP A;  1LP1 A;  3FWL A;  2OYH B;  1QGK B;  1DD3 A;  3NTN A;  1PGJ A;  2P2U A;  2C9L Y;  3G9R A;  3JCU H;  1K73 Q;  2KLU A;  3A3Y B;  1ZXG A;  2IZ1 A;  3W68 A;  3RG2 A;  3GKL C;  4NPF X;  4LC1 A;  3H1K J;  2YO3 A;  1HH0 A;  3BAT A;  4RES B;  4DZO A;  4IZ6 A;  3V5B A;  3K5B A;  2ZYD A;  1RQV A;  2A45 H;  4AQR D;  1W2B O; 
#chains in the Genus database with same CATH homology
 4M0I A;  2XV6 A;  3CCL P;  4XRO A;  1K30 A;  3I56 P;  4U0F A;  3G4S P;  1K9M Q;  3LRY A;  3WBH A;  5BS1 A;  1EOQ A;  3H47 A;  5F2K A;  3DS3 A;  1Q82 Q;  4GR6 A;  3G6E P;  3VRL C;  2OTL P;  3RG6 C;  3CXC O;  1RNI A;  1A8O A;  3CCV P;  1A43 A;  3CME P;  2OAR A;  2PEK A;  1EIA A;  3CCE P;  1IUQ A;  2EIA A;  3NTE A;  4U0C A;  1VQL P;  4U0E A;  3CC2 P;  3H0D A;  5F2O A;  4COC A;  4XFZ A;  5I4T G;  1M1K Q;  1QVF O;  1M74 A;  4PH0 A;  1JJ2 O;  1VQ9 P;  2Z45 A;  2ONT A;  1PEO A;  3DS2 A;  5DCK A;  5HGM A;  3DS5 A;  3CC7 P;  5HGO A;  1N8R Q;  3CCQ P;  2BQ1 E;  2E1M A;  2M8L A;  4GR2 A;  3OW2 O;  1YIT P;  2JYG A;  1Q86 Q;  1VQ6 P;  2PEQ A;  3CD6 P;  3CMA P;  3G29 A;  3CCS P;  2PEI A;  2PEO A;  1YIJ P;  2EFJ A;  4PH1 A;  1M6N A;  4XFY A;  2QA4 P;  1Q81 Q;  1QRJ A;  2OTJ P;  2PEN A;  2PY8 A;  5JPA A;  1VQK P;  1KC8 Q;  1YJ9 P;  1VQM P;  1M6E X;  3G1I A;  3M1M A;  1RO2 A;  4WYM A;  3G26 A;  1VQO P;  3G1G A;  1VQ8 P;  2QEX P;  1S72 P;  3G0V A;  3HYB A;  1VQ4 P;  3CPW O;  1RO0 A;  3HZQ A;  1E6J P;  2PEM A;  1AUM A;  2EG5 A;  4COP A;  2BHV A;  3CCJ P;  3DS0 A;  5HGL A;  4QNB A;  3CCR P;  3E2D A;  3DS1 A;  1K8A Q;  1PEU A;  2CWO A;  2DGY A;  2JYL A;  1Q7Y Q;  3DS4 A;  4U0B A;  5F2N A;  3G71 P;  1K73 Q;  3DPH A;  2KOD A;  3P05 A;  3H4E A;  3MGE A;  1YJW P;  3CCU P;  1M90 Q;  2JO0 A;  2XXM A;  1NJI Q;  5HGN A;  1PEM A;  1KD1 Q;  3G21 A;  4XFX A;  1PEQ A;  3B5I A;  4XRQ A;  3Q20 A;  1QVG O;  2M8P A;  1D1D A;  1YI2 P;  1VQ5 P;  1BAJ A;  1VQP P;  2P9X A;  4U0D A;  2XT1 A;  1KQS O;  3I55 P;  1VQ7 P;  1ZMB A;  3G28 A;  3CC4 P;  2Z44 A;  4U0A A;  1VQN P;  5BS2 A;  2M8N A;  2Z46 A;  3CCM P;  2LF4 A;  3DTJ A;  2PEJ A;  2BUO A;  4IPY A;  1YHQ P;  1W2B O;  1YJN P;  2L6E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...