3CCSP

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2482a
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 45
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3ccsP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 3ccsP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 3ccsP02
3CCEP 1M1KQ 1S72P 1VQKP 1YI2P 1K8AQ 1VQ7P 3CD6P 1K73Q 3CC2P 1VQMP 1KQSO 3OW2O 3CMAP 1QVFO 1VQ6P 1VQPP 3CCLP 3CCVP 1Q82Q 2QEXP 3CXCO 1YJWP 1VQ4P 1QVGO 1Q86Q 3CC4P 1VQNP 3CCMP 1VQ5P 1YHQP 1Q81Q 1K9MQ 1Q7YQ 2OTJP 3CCSP 3CCRP 1YIJP 1YJ9P 1YJNP 3CCUP 3CCQP 1VQOP 2QA4P 1M90Q 3CMEP 1JJ2O 3CCJP 1KC8Q 3CC7P 3G71P 1N8RQ 3I55P 1VQ9P 3G6EP 3I56P 1NJIQ 1KD1Q 2OTLP 3G4SP 1YITP 3CPWO 1W2BO 1VQ8P 1VQLP
chains in the Genus database with same CATH superfamily
2K3RA 3AE7C 3B4SA 3SFEC 4QKOA 4H13C 2XXMA 4R4MA 2B9BA 2WSFJ 1NOHA 1FJPA 1URQB 3GJNA 4COPA 1X0TA 1NTZJ 4PV1D 2W83C 2WTYA 4PV1C 1NU1D 3P7KA 1KILE 1KQSO 3AE5C 1VQ4P 3L71J 2WPSA 2R5DA 2EFJA 1G1IA 3L75E 1NTZG 1KC8Q 1JNMA 1GPJA 4TLFA 4BPHA 1VQLP 5APSA 4QNBA 1DV5A 3H0DA 3L71G 2M8PA 3EWKA 3PLNA 5AW4B 1PIXA 4U0EA 2Z46A 1P84I 5AVVB 2X2BA 1YJNP 4RKUJ 1MZ9A 2G8YA 1X79B 1YITP 1IJDB 4NPEA 4GKGA 2XZ1C 1CI6B 3NTNA 3CD6P 4ZNCA 3H1LD 1SQQJ 1QVFO 3M06A 5BVZA 1URQC 1IZNB 1NTKD 3HD7D 3HZQA 1ZP0C 3EJDA 3VMZA 4JPZB 1QL2A 2RMZA 1GL2B 5E79H 2I1KA 2WPVB 2QRXA 3HE5B 1T6AA 2O1KA 2PEOA 2IBZD 2FYZA 1SQQG 2HODA 2KR5A 2QG4A 2XZRA 1KV4A 4OH8B 5AW0B 1BE3D 3G1IA 3HE4A 2YNYA 3H1ID 2KIKA 1GDTA 1LTIC 1BCCG 1KILB 2IZ0A 1FBMA 3A5TA 2O1JA 2WSFH 4U3FG 1R5LA 3CE7A 2N98A 3TGUJ 3G0VA 2M3EA 1CSBA 5K5GB 2KG8A 5HGLA 3M9BA 2WSCH 4WBAA 4XFYA 1LWUA 1SFCB 2C0WA 1EDJA 2E43A 1QVGO 1EC5A 1JTHA 2NRGA 2SPZA 2OQQA 1VF5B 2LKIA 1LTJA 1GK6A 2FFDA 1H88A 1KB9I 2K94A 2PEQA 1GL2C 2GDYA 2QM8A 1KORA 1EDIA 1NTZD 2MD9A 1T8KA 5APVA 2EG5A 1PEQA 1N2DC 3GMAA 4I1LA 2KLUA 1X8YA 3F89A 1HGZA 1HWTC 1RF1A 2IDBA 5KP7B 1KILC 3KYQA 3W68A 3U1CA 1SQBK 2N9BA 1DD3A 1SQXE 3L70J 2QEXP 2ZYGA 5AW8B 3CC4P 2Q7CA 1S9KE 1QL1A 4IL6X 2OTKE 1VL2A 1YJ9P 3O6QA 5H2FH 1SFCC 3M9HA 4XA4A 3A0BH 2E42A 3CPWO 1L0NE 3H1KG 1VF5D 2OGUA 1VF5C 4PXHB 3G21A 3VMAA 1UJZA 3IR9A 1CW5A 1FZBA 3VOPA 3RBZA 1P84E 2JGPA 2PEMA 1SQQD 2PEIA 2WITA 3V2PA 2OYIB 2CQ8A 3G28A 3HRNA 5AW6B 4U0BA 3CC2P 2GUSA 3Q5SA 1EZVE 3IN6A 3IAOA 2XNXA 3MUDC 3AE2C 1S4XA 3F5HA 3W67A 2J5UA 1RY3A 1ZW0A 3ITKA 5AVQB 2YXRB 1URQA 4CPGA 1AVYA 2PEKA 3ABVC 2Z5HA 3H47A 4ASVA 1HF9A 3HD7A 4UB8E 1E0HA 3TGUD 4ZMDA 1AQTA 2WPRA 2HLOA 2OTJP 3MZWB 2FHSC 1LJ2A 2FY8A 2YKOA 3RL0g 4PD4D 1LP1B 2A45H 1PPJE 1RO0A 2BEZF 2BCCE 1NAFA 2FYUE 1SQPE 1U7MA 2BASA 2GDXA 3MP7B 2BCCJ 2NPSD 1WRGA 2OYIC 1QLED 4DOJA 2ERHA 2R44A 2A06G 2MJZA 2QSIA 2P58A 3KDPB 1IMQA 2LF4A 1KB9E 1USEA 3M1MA 2WPTA 2N6YA 5BS1A 1Z56A 3CMAP 3CCVP 1E5WA 1BXIA 5AVWB 4H2XC 3L74G 3H1HE 1LNQA 3L70D 1GL2A 1NTMJ 3LMOA 1X22A 3GKLC 1NWQA 3V2QA 5AVYB 3KPEA 3HE5A 1XTCC 1IFDA 1S9KD 3FWLA 1DD4A 3AE8C 1Q81Q 1GZLA 1Q7YQ 5APTA 5CCHD 4AUWA 4OWFA 1FDOA 1KILA 3V5BA 4L74A 4GR6A 7CEIA 2HPCA 1S5LE 1FZCC 5KLVE 1LTSC 4AYCA 1P84D 2P7JA 4Y99B 4F37A 5KLVJ 1T2KC 1SFCA 5DCKA 2LIWA 2L22A 3CWBE 2LMLA 1T8ZA 1NAYA 2V4HA 1KFMA 3DS2A 2Q5UA 4MRTC 1JCDA 2GDWA 1DNYA 2Y0EA 3JSVC 4H0LB 1AF8A 2JU2A 2E5TA 3AEBC 2FXMA 5AVSB 2P9XA 1UNKA 2ZXXA 1D1DA 5CMZA 1JJ2O 1VQ9P 3WUUA 5CCGC 1CZQA 2N5IA 2E76D 3FXEA 4I6MC 1H8AA 2A06D 3E2DA 1PEUA 2KK7A 3H1JJ 1OVRA 1PEMA 1WT6A 4PH0A 1NU1E 2ITAA 2D2CB 2KGDA 4AQRD 4EOTA 3BCCJ 2BCCD 3NMDA 5TISH 1RE3C 1OIPA 4Y99C 3C9IA 2CGQA 2Y9YA 3GZLA 3Q5PA 2KGCA 2L0QA 2JWDA 2WWWA 1S72P 3H1JG 1LWUB 4PWVB 5KAFE 1BDCA 3V4QA 2XNDH 1A02J 1GMJA 1IFPA 3Q3DA 3LRYA 2OYHB 2W27A 4IFFA 2FFDB 5KP6B 2E75D 3D71A 4H0LC 1SQVK 3MIWA 2OYIA 2Z4EA 2NPSA 3RK2B 5APUA 3L72G 1L4AB 1BSHA 4H2YC 2VLOA 1NTMD 3CX5H 4C46A 3H1HD 2FAEA 5CJ0A 3N7NA 3DS1A 4MN4C 1NGMB 3H1LE 4UHPB 3MGNA 1RF1B 2MR8A 1NTKE 1UIXA 3WUVA 3EFGA 3FX0A 1H0TB 2HFED 2D2CC 2MVVA 5GTHH 1HY8A 2IBZE 4GR2A 2K88A 4GODA 1LWUC 1FZAA 3CCUP 3H1IE 1PL5A 5KLVD 2OYHC 1LP1A 3VYIA 3RL0D 1YI2P 1L0IA 4RJTA 2FXOA 1PP9G 1Y9BA 2FFDC 1L0HA 1IFIA 1X3OA 3EJEA 3RK2D 1L4AD 3CCMP 2KS1A 1NH4A 3GW6A 1L4AC 2WMMA 1SQBJ 3CCEP 1K8AQ 3UIAA 3MHVA 4LC1A 1RF1C 2VSQA 3WBHA 4N6JA 4IPYA 2H43A 2N6ZA 2ZJSE 3R4YA 2KZJA 1MFZA 2A45I 1SQBG 2AXCA 1QEXA 1NTZE 3CMEP 3H1JD 3A0HE 1W2BO 4PJ0H 3A2AA 3BCCD 2IFMA 2Z44A 4IFMA 3HD7B 3L71E 2I8DA 2WSCJ 1RQUA 3DS5A 2LXBA 2VLPA 2PFXA 2E74D 2AVAA 5CCGA 4IL6H 3M0AA 2QM7A 2NO8A 2N50A 1HTLC 2W6AA 5AW5B 3H32B 3S4RA 3IFMA 2FQ2A 3SSUA 4XFZA 1DX7A 1RE3A 3CXHH 4YPCA 2WT7A 5BU5A 2KNCB 1JO5A 1OZHA 2JR8A 1GU5A 3GG2A 2R3CA 1IO4A 3RG6C 5B66E 1SQQE 2EHSA 2XKMA 1RHZB 4UB6H 1AV1A 1HVVA 1IMPA 5B5EH 1A8OA 1NYHA 3TSIA 2PP6A 3KQGA 1HJ0A 3L75G 1BCCJ 3HD7C 2IZ1A 4U3FJ 4B86A 5AVRB 5C39A 2FQ0A 1KN7A 1JY3N 3WU2E 1AUMA 1KYOH 2K92A 4BPGA 2IFNA 2AEFA 4HKZH 4XROA 5EJDA 3L73J 3CCQP 3TGUE 2QA4P 2HPCB 1LTBC 3EFFK 2VLNA 3I56P 4I2LC 1YBKA 3PHLA 2C0XA 1OXZA 5I4TG 2K9JA 4L73A 1T3UA 1ZXGA 4PD4E 1FU1A 1JMMA 1SQBD 1L0LK 3L73G 3G9RA 4HKGA 2M8RA 3BASA 1FJKA 1MV8A 3BRVB 2OYHA 1FOSE 2LR2A 3TDKA 2K5XA 3VRLC 5APXA 4DCKA 3U59A 4WB4A 3P8CD 1L4AA 1Q82Q 5HGNA 3BRTB 1NKZB 1BGYJ 3HTKB 4LGDE 1FZFA 1SVFA 3KZIE 3L71D 1VQ8P 3ZDMA 3H1KE 4YXDC 3DS4A 2AEJA 1OVVA 4JYBA 1IFJA 3L70E 1H0TA 3H1KJ 2CPBA 2FKWB 3V2NA 5KJ7D 1BGYG 1FZEA 2ZVNB 3H4EA 4GIFA 1AFOA 1KLPA 1OWAA 4IOIH 2A45G 1KD1Q 3AE1C 2PRRA 2B87B 1R8EA 3JCUE 2AEMA 1D7MA 3CX5I 2JAZA 3RK3E 2GZGA 1QX8A 1YQ3C 2K1AA 3AE9C 1Q86Q 1BDDA 1A43A 2WSEJ 2KOQA 1JUNA 5JPAA 3L36A 2NPSB 4Z1MH 1M6NA 1BCCD 1ZRTD 2YO2A 3G29A 1W2EA 1IK7A 2JJLA 1VQ6P 5AW2B 4U3FD 1FR2A 1KQFB 2Y0CA 1OW7A 2M8LA 2RH0A 2WZ7A 1M90Q 1ZLLA 1KQLA 1KFNA 2V7QH 2ZYDA 3I55P 1L0NG 2FVEA 4K3AA 1DEEG 4D6TJ 2K93A 3L73D 3EQ2A 3CCLP 1MFTA 4JF7A 2BEQD 1SQVJ 2KZIA 2A06E 1ZMBA 1VHNA 4D6TG 1NJIQ 2N1TB 3H6PA 1VQMP 3H32A 3AEEC 1EZVG 3BVHA 1SP4A 2KS1B 2NPSC 2ZFCA 1SQVG 2GYKA 3MGEA 3RK3B 4U0CA 2HYNA 4GDOA 2KNCA 4OGQD 3L74J 2GZJA 1ZMEC 1RNIA 1K05A 2H89C 1ZOYC 2WQYC 5DJUB 1BGYD 3PTZA 5KP8B 1M7LA 4U7JA 2K0DX 1UIIA 1LTAC 2JU1A 4C7RA 5AVUB 4DG9A 2QJYB 2WSEH 1VQNP 3WMM0 2B89A 3VP8A 4WY4D 1NTME 3H1KD 1M8OB 1N8RQ 2R5BA 1PPJG 4GT1A 1SS1A 2E1MA 2H8PD 1DH3A 1MKMA 4NEOA 2LIUA 1NO4A 3CXHI 1WMKA 2N1TD 2Q3IA 3V6IA 3NTEA 2N1TC 1PV3A 2P1JA 1RF0C 2WSSH 2L6EA 3M0DA 2E76B 4XRQA 5CCHC 2WPQA 2B88A 1QRJA 1TU3F 3M91A 3RK3D 3RK3C 1OX3A 4COCA 5KJ7A 2FBWC 2L4BA 5KKZB 2POHA 2WT7B 1K30A 2DGYA 1RE4A 2LKMA 2ZYAA 4LLHA 3M9QA 3P05A 2QJYC 5EW5E 1VDFA 5GTHE 1KQGB 1GXHA 4HH2A 1KYOI 1MZ8A 2CWOA 3DTJA 2YXQB 2E75B 3SWFA 1JY2O 1GD2E 1SQXK 3HTKA 1S1CX 2JO0A 1EDLA 3L4FA 3MD0A 1VQ7P 3H1JE 3JC22 3SWKA 2E76C 1GK4A 2JDIH 2EHTA 2ROQA 5APWA 3BCCE 5KTBA 1L0NK 2G3AA 4YXWH 2CK3H 2KP8A 3PH0A 1EXIA 5KKZC 1PZQA 2R3SA 2K9JB 1KB9H 2M3BA 2B87A 2J58A 3WUTA 5APYA 3L74D 3L72J 1Q90D 1JCCA 2LPKA 2C9LY 4N78D 2VRSA 1BAJA 5CJ4A 1M57D 3L37A 3RL0B 3O8ZA 4PJ0E 4WVZA 3AEAC 2FYNB 4TT3H 5HGMA 3VP9A 5GTIH 2E75C 3SWYA 4C7NA 1PEOA 2BUOA 2KW2A 2KB7P 2ZT9D 2E5YA 5CBOA 4IL6E 5F2OA 4EIJA 1K9MQ 4OVNF 1NHLA 1EIAA 2OYOA 2Q1KA 1MUUA 5AVZB 4N3YB 2KOPA 3TK1A 1S5LH 1L0LJ 3QH9A 3S1KA 4EYYQ 3G26A 5KAIH 2XU6A 3TF5A 4WY4A 1PP9J 4RO0A 4PH1A 2FYUK 1SQPK 1GU4A 4M0IA 2P10A 4H13B 1GW4A 1L0LG 3CX5D 4EDFA 2K0YA 2QNWA 2H88C 4R4LA 3OAKA 2N1TA 1OW8A 2K9YA 1K73Q 2E74B 1IUQA 2M8NA 3RL0C 1RF0A 4ZKUA 1JMBA 2XT1A 1JY3O 4CA3A 2FYNC 5CCHA 4NPFX 4BRYA 2FVFA 5E79E 1JY2N 3RK2C 2MVUA 3HYBA 1SQBE 1DEBA 3GHGB 3CCJP 1GW3A 3VMXA 1ZR4A 3RG2A 2KLVA 2O01N 2AXTH 4L76A 1M1JB 2GA1A 3B5IA 2OARA 3IF4A 1KYOE 2IBZG 2J59M 1GXGA 1FOSF 2O01J 1H89A 2K0XA 5AVTB 1BE3G 1FS0E 3HUSA 2UWJE 3P8CE 1GTWA 1ZN5A 1J1DB 3BATA 1T3JA 3B5NB 1G2CA 3AEGC 2M0BA 4H13D 2Q9IA 3V4WA 3AEDC 5KAFH 3E1IA 3LW5H 2KUBA 1YHQP 5KLVK 3E1RA 1RO2A 2Q3EA 2E74C 1AQ5A 3L72D 3GZMA 2C9NY 5EFWB 2Q6QA 2W8ZA 4DT0A 3GHGC 3GF3A 1HBWA 4A7PA 1ZV8A 1KZUB 1M1JC 2HG5D 4NPDA 2ZVOB 2IPPA 3CC7P 1AA0A 3C1LA 3L75J 1EQ7A 1YQ4C 2PENA 5BU8B 2QJKB 1M74A 3DS3A 3T97A 2GUVA 3Q1MA 1J1DC 3VN0A 2YO3A 3B5ND 5APQA 3D70A 3B5NC 1BCCE 1L0LD 2JYLA 1ZRTE 5H2FE 2PGDA 4U3FE 5HVCA 5CZDB 1LT9A 1SLQA 3A0BE 4Y28J 1PP9D 4W7ZA 1S5LX 1NU1K 2JEEA 3CXHD 3TNUB 1HJBA 1URQD 2M5AA 1EZVI 1IK9A 1KMIZ 4M3LA 3VTPC 2O01H 3L73E 3L35A 3PJSK 1QGKB 3EJBA 3DPHA 2I1JA 5TJHA 2KI7B 2R32A 4RESB 2CPSA 3CL3D 3II6A 1N7SB 2FACA 1HQBA 1AVOA 1E79H 2VLQA 2L91A 1AJYA 2QJKC 1OW6A 3CCSP 1KTMA 2AFDA 2QE7H 2JP3A 1YTZT 3NFQA 3A0HH 2V7QJ 1KYOD 2PEJA 1FE6A 2FXPA 1OFCX 2CG5B 2DNWA 1NTKK 1BGYE 2IYOA 2LL8A 4JBZA 1M56D 3FWNA 2LXCB 3TGUG 1PFIA 2P2UA 2L5GB 5KLIB 5CHXA 1GL2D 1OR5A 3M0DC 1N73B 2K2QA 3GF7A 5AW1B 2BHVA 4U0FA 2RN0A 4IZ6A 4KHXA 2YMKA 5HV8A 4K35A 2DW3A 1N7SD 1R5SA 2CNRA 2FVAA 5KJ7C 5AVXB 1N7SC 2GM4A 2KSJA 2MR7A 1U7JA 4JYCA 1KILD 2Y0DA 2PY8A 2KGAA 1J1EB 1JB0J 2YKQA 5F2NA 5B66H 2ONTA 1RE4C 4DJGA 3NXSA 3L75D 3A7OA 1LTGC 1YTZI 3A3YB 1SQXJ 3PRJA 1SFCD 3V2RA 1JY2P 5AW9B 3RGUA 1VPCA 1EDKA 3GHGA 4C7NB 1ZNVA 1ZR2A 2QIWA 3L70G 1M1JA 1L0NJ 1NVOA 1NTZK 1F80D 3FXDA 1SQXG 3GLMA 5KLIC 3WU2H 4OGQB 1S2EA 1N73C 4EI2A 5F2KA 4W80A 3H25A 2MKVA 2ZAEB 4D6TE 3G6EP 1ACPA 2Z45A 3OJAB 3B5NA 1FC2C 2KOGA 3P8MC 3USSA 5BS2A 1RH5B 4PD4H 4WY4B 1VQPP 1CEIA 1M6EX 1SQVE 3VMYA 1J1EC 1EOQA 2XV6A 3TYYA 1XTGB 3Q2YA 1RQVA 1EXJA 1IFMA 3Q5RA 3FGAD 3R2PA 5L8RJ 3B71A 3P32A 2GZEA 2KGEA 3OW2O 2JWAA 1DIPA 3PP5A 5CBNA 2KOOA 1VKUA 1G1JA 4BRYB 1FDMA 4DZOA 1SQQK 3L74E 3LIDA 1A02F 4GOFA 4N78E 3DS0A 4OGQC 2O3JA 3KZIH 1Y8AA 1LTTC 5DJTB 1PGQA 2FYUJ 1SQPJ 1EMVA 1FZCB 1BSNA 3HUSB 4ZKPA 4GOEA 5TISE 2JB0A 4JQ0D 2QJPB 2W6BA 4WY4C 3U43A 1G2CB 3I5CA 2QVAA 1N86A 3OA7A 2BCCG 1W5CE 2W90A 4BWNA 3S9OA 2FYUG 1SQPG 2RKLA 2XV5A 3JCUH 3TNUA 1CI6A 2YMYA 1JY3P 1OMIA 1S3JA 2YIUB 3C8VA 1FAVA 1OVUA 4L75A 1P84H 4U0AA 2Y9ZA 5GTIE 1FZGA 3K5BA 3H1HJ 1PGPA 1SQXD 2HR3A 1IFNA 2PNGA 2MY5A 3CX5E 2IBZI 3CLQA 1HGVA 1IC2A 1N7SA 1Z6MA 1PGOA 5AW3B 1NTMG 1L0ND 3H1HG 4HYTB 2KODA 2GZIA 1NQ4A 3HUSC 1N7LA 5KAIE 3T97B 2JKVA 2QJPC 2KYVA 1T2KD 4BXLA 2IYPA 1NKNA 3AECC 4UB8H 4D6TD 3AE4C 1HH0A 1LT9B 1Y47A 2FQ1A 4O9BA 3G71P 1J2JB 3CWBJ 2EIAA 2ZT9B 1EZVD 2YIUC 2M5AB 1SQVD 5KLVG 4H44B 1N73A 2W6JH 1HUCA 4R0MA 2WVRA 3MTUE 3B4QA 5M1BA 2PAJA 2KG9A 2Z5IA 2KXPB 4H2WC 3AE3C 3CWBG 4HJGH 5CCGD 4KJMA 2AXTE 2HODB 3KXDA 3G4SP 4IFDK 3MUDA 1JOCA 3L72E 3HE4B 3AEFC 4QMAA 3CXCO 1YJWP 4WWIA 4XFJA 2YKPA 2JBGA 4WYMA 1PPJD 1NU1J 2KWLA 2JYGA 2FYUD 1SQPD 1AYIA 2JO1A 2K37A 2OTLP 2H7HA 4YTPC 4KT0J 1LT9C 1YYCA 3QWOC 3RBXA 1JTHB 2LOLA 3BCCG 2ZT9C 3LW5J 1NU1G 4XFXA 2N9YB 4H44D 1LTJB 1FDIA 1KB9D 1LT1A 4H44C 4U0DA 1JEKA 4H0LD 2LTEA 1L0LE 1U57A 1Q2NA 4I7ZB 3CI9A 3B8EB 1M1KQ 2AFEA 3G1GA 1JM0A 1PP9E 4BPFA 3CXHE 3AE6C 1LGHB 2NZ2A 2MF4A 1YIJP 5HGOA 3H1LJ 2KOSA 1K04A 2XDJA 4ASWA 2D2CD 3U1AA 2IX7C 1NTKJ 4UB6E 1VQKP 3KHUA 5B5EE 2KORA 3Q20A 3N4XA 2KG6A 4XE5B 3O6QB 1BE3E 4HB1A 3H1LG 4PV1B 1USDA 2GZFA 2AF8A 2KSEA 1VQOP 1BE3J 1NTKG 3H1IJ 2JQ4A 3NY7B 3LIEA 2XZ0D 1E6JP 1LTJC 4PD4I 1NTMK 3E7KA 2BQ1E 2ZXEB 4W7YA 2M5RA 3CWBD 2P67A 3SFDC 1X9VA 4I7ZC 2FADA 2L9FA 1VQ5P 1FZCA 1L2PA 3CCRP 3D6ZA 3H1IG 3D6YA 3G3ZA 5AW7B 2N5HA 1PGJA
chains in the Genus database with same CATH topology
3M1MA 2PEJA 1YI2P 3G26A 3G21A 5BS1A 1VQMP 5BS2A 3G1IA 3CMAP 3E2DA 1PEUA 1VQPP 3CCVP 1A8OA 1M6EX 1PEMA 2XXMA 4PH0A 2CWOA 3DTJA 1EOQA 4PH1A 2XV6A 3CCMP 4XFXA 3H4EA 2PEMA 3MGEA 2PEIA 4U0CA 4U0DA 4M0IA 3CC7P 1RNIA 2JO0A 1KD1Q 4COPA 2KODA 3G0VA 2PENA 3G28A 5HGLA 3CCEP 1M1KQ 1S72P 1K8AQ 1VQ7P 1M74A 4U0BA 3G1GA 3DS3A 1K73Q 3CC2P 1IUQA 2M8NA 3WBHA 2BHVA 4IPYA 4U0FA 4XFYA 3OW2O 1KQSO 2XT1A 1AUMA 1VQ4P 1QVGO 1Q86Q 3LRYA 1A43A 2JYLA 1Q81Q 1VQNP 2EFJA 4XROA 1Q7YQ 3HYBA 5JPAA 1YIJP 3CCQP 5HGOA 2QA4P 3CMEP 3CCJP 4GR6A 1KC8Q 3G71P 1N8RQ 2EIAA 3I56P 3DS0A 2PY8A 1W2BO 1VQLP 2E1MA 5F2NA 1VQKP 2PEKA 3B5IA 4QNBA 1M6NA 2Z44A 5I4TG 2OARA 2PEQA 2ONTA 3H0DA 3H47A 3G29A 3DS5A 3Q20A 1VQ6P 2M8PA 3NTEA 4U0EA 2Z46A 3DS1A 5DCKA 1BAJA 2M8LA 2EG5A 1PEQA 2OTJP 2L6EA 1YJNP 3DPHA 1VQOP 1M90Q 4XRQA 3VRLC 3I55P 3G4SP 1YITP 1QRJA 3DS2A 1RO0A 5HGMA 1E6JP 3CD6P 2BUOA 1PEOA 4COCA 2BQ1E 1QVFO 3CCLP 1Q82Q 4GR2A 4XFZA 2QEXP 3CXCO 1YJWP 5HGNA 3CC4P 1K30A 1VQ5P 4WYMA 2DGYA 3HZQA 5F2OA 1YHQP 2P9XA 5F2KA 1K9MQ 1D1DA 3CCSP 3CCRP 1YJ9P 1RO2A 1ZMBA 3CCUP 2JYGA 1EIAA 1JJ2O 4U0AA 3RG6C 1VQ9P 3G6EP 2LF4A 1NJIQ 2OTLP 3P05A 3CPWO 1VQ8P 2PEOA 2Z45A 3DS4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCE P;  1M1K Q;  1S72 P;  1VQK P;  1YI2 P;  1K8A Q;  1VQ7 P;  3CD6 P;  1K73 Q;  3CC2 P;  1VQM P;  1KQS O;  3OW2 O;  3CMA P;  1QVF O;  1VQ6 P;  1VQP P;  3CCL P;  3CCV P;  1Q82 Q;  2QEX P;  3CXC O;  1YJW P;  1VQ4 P;  1QVG O;  1Q86 Q;  3CC4 P;  1VQN P;  3CCM P;  1VQ5 P;  1YHQ P;  1Q81 Q;  1K9M Q;  1Q7Y Q;  2OTJ P;  3CCS P;  3CCR P;  1YIJ P;  1YJ9 P;  1YJN P;  3CCU P;  3CCQ P;  1VQO P;  2QA4 P;  1M90 Q;  3CME P;  1JJ2 O;  3CCJ P;  1KC8 Q;  3CC7 P;  3G71 P;  1N8R Q;  3I55 P;  1VQ9 P;  3G6E P;  3I56 P;  1NJI Q;  1KD1 Q;  2OTL P;  3G4S P;  1YIT P;  3CPW O;  1W2B O;  1VQ8 P;  1VQL P; 
#chains in the Genus database with same CATH topology
 2K3R A;  3AE7 C;  3B4S A;  3SFE C;  4QKO A;  4H13 C;  2XXM A;  4R4M A;  2B9B A;  2WSF J;  1NOH A;  1FJP A;  1URQ B;  3GJN A;  4COP A;  1X0T A;  1NTZ J;  4PV1 D;  2W83 C;  2WTY A;  4PV1 C;  1NU1 D;  3P7K A;  1KIL E;  1KQS O;  3AE5 C;  1VQ4 P;  3L71 J;  2WPS A;  2R5D A;  2EFJ A;  1G1I A;  3L75 E;  1NTZ G;  1KC8 Q;  1JNM A;  1GPJ A;  4TLF A;  4BPH A;  1VQL P;  5APS A;  4QNB A;  1DV5 A;  3H0D A;  3L71 G;  2M8P A;  3EWK A;  3PLN A;  5AW4 B;  1PIX A;  4U0E A;  2Z46 A;  1P84 I;  5AVV B;  2X2B A;  1YJN P;  4RKU J;  1MZ9 A;  2G8Y A;  1X79 B;  1YIT P;  1IJD B;  4NPE A;  4GKG A;  2XZ1 C;  1CI6 B;  3NTN A;  3CD6 P;  4ZNC A;  3H1L D;  1SQQ J;  1QVF O;  3M06 A;  5BVZ A;  1URQ C;  1IZN B;  1NTK D;  3HD7 D;  3HZQ A;  1ZP0 C;  3EJD A;  3VMZ A;  4JPZ B;  1QL2 A;  2RMZ A;  1GL2 B;  5E79 H;  2I1K A;  2WPV B;  2QRX A;  3HE5 B;  1T6A A;  2O1K A;  2PEO A;  2IBZ D;  2FYZ A;  1SQQ G;  2HOD A;  2KR5 A;  2QG4 A;  2XZR A;  1KV4 A;  4OH8 B;  5AW0 B;  1BE3 D;  3G1I A;  3HE4 A;  2YNY A;  3H1I D;  2KIK A;  1GDT A;  1LTI C;  1BCC G;  1KIL B;  2IZ0 A;  1FBM A;  3A5T A;  2O1J A;  2WSF H;  4U3F G;  1R5L A;  3CE7 A;  2N98 A;  3TGU J;  3G0V A;  2M3E A;  1CSB A;  5K5G B;  2KG8 A;  5HGL A;  3M9B A;  2WSC H;  4WBA A;  4XFY A;  1LWU A;  1SFC B;  2C0W A;  1EDJ A;  2E43 A;  1QVG O;  1EC5 A;  1JTH A;  2NRG A;  2SPZ A;  2OQQ A;  1VF5 B;  2LKI A;  1LTJ A;  1GK6 A;  2FFD A;  1H88 A;  1KB9 I;  2K94 A;  2PEQ A;  1GL2 C;  2GDY A;  2QM8 A;  1KOR A;  1EDI A;  1NTZ D;  2MD9 A;  1T8K A;  5APV A;  2EG5 A;  1PEQ A;  1N2D C;  3GMA A;  4I1L A;  2KLU A;  1X8Y A;  3F89 A;  1HGZ A;  1HWT C;  1RF1 A;  2IDB A;  5KP7 B;  1KIL C;  3KYQ A;  3W68 A;  3U1C A;  1SQB K;  2N9B A;  1DD3 A;  1SQX E;  3L70 J;  2QEX P;  2ZYG A;  5AW8 B;  3CC4 P;  2Q7C A;  1S9K E;  1QL1 A;  4IL6 X;  2OTK E;  1VL2 A;  1YJ9 P;  3O6Q A;  5H2F H;  1SFC C;  3M9H A;  4XA4 A;  3A0B H;  2E42 A;  3CPW O;  1L0N E;  3H1K G;  1VF5 D;  2OGU A;  1VF5 C;  4PXH B;  3G21 A;  3VMA A;  1UJZ A;  3IR9 A;  1CW5 A;  1FZB A;  3VOP A;  3RBZ A;  1P84 E;  2JGP A;  2PEM A;  1SQQ D;  2PEI A;  2WIT A;  3V2P A;  2OYI B;  2CQ8 A;  3G28 A;  3HRN A;  5AW6 B;  4U0B A;  3CC2 P;  2GUS A;  3Q5S A;  1EZV E;  3IN6 A;  3IAO A;  2XNX A;  3MUD C;  3AE2 C;  1S4X A;  3F5H A;  3W67 A;  2J5U A;  1RY3 A;  1ZW0 A;  3ITK A;  5AVQ B;  2YXR B;  1URQ A;  4CPG A;  1AVY A;  2PEK A;  3ABV C;  2Z5H A;  3H47 A;  4ASV A;  1HF9 A;  3HD7 A;  4UB8 E;  1E0H A;  3TGU D;  4ZMD A;  1AQT A;  2WPR A;  2HLO A;  2OTJ P;  3MZW B;  2FHS C;  1LJ2 A;  2FY8 A;  2YKO A;  3RL0 g;  4PD4 D;  1LP1 B;  2A45 H;  1PPJ E;  1RO0 A;  2BEZ F;  2BCC E;  1NAF A;  2FYU E;  1SQP E;  1U7M A;  2BAS A;  2GDX A;  3MP7 B;  2BCC J;  2NPS D;  1WRG A;  2OYI C;  1QLE D;  4DOJ A;  2ERH A;  2R44 A;  2A06 G;  2MJZ A;  2QSI A;  2P58 A;  3KDP B;  1IMQ A;  2LF4 A;  1KB9 E;  1USE A;  3M1M A;  2WPT A;  2N6Y A;  5BS1 A;  1Z56 A;  3CMA P;  3CCV P;  1E5W A;  1BXI A;  5AVW B;  4H2X C;  3L74 G;  3H1H E;  1LNQ A;  3L70 D;  1GL2 A;  1NTM J;  3LMO A;  1X22 A;  3GKL C;  1NWQ A;  3V2Q A;  5AVY B;  3KPE A;  3HE5 A;  1XTC C;  1IFD A;  1S9K D;  3FWL A;  1DD4 A;  3AE8 C;  1Q81 Q;  1GZL A;  1Q7Y Q;  5APT A;  5CCH D;  4AUW A;  4OWF A;  1FDO A;  1KIL A;  3V5B A;  4L74 A;  4GR6 A;  7CEI A;  2HPC A;  1S5L E;  1FZC C;  5KLV E;  1LTS C;  4AYC A;  1P84 D;  2P7J A;  4Y99 B;  4F37 A;  5KLV J;  1T2K C;  1SFC A;  5DCK A;  2LIW A;  2L22 A;  3CWB E;  2LML A;  1T8Z A;  1NAY A;  2V4H A;  1KFM A;  3DS2 A;  2Q5U A;  4MRT C;  1JCD A;  2GDW A;  1DNY A;  2Y0E A;  3JSV C;  4H0L B;  1AF8 A;  2JU2 A;  2E5T A;  3AEB C;  2FXM A;  5AVS B;  2P9X A;  1UNK A;  2ZXX A;  1D1D A;  5CMZ A;  1JJ2 O;  1VQ9 P;  3WUU A;  5CCG C;  1CZQ A;  2N5I A;  2E76 D;  3FXE A;  4I6M C;  1H8A A;  2A06 D;  3E2D A;  1PEU A;  2KK7 A;  3H1J J;  1OVR A;  1PEM A;  1WT6 A;  4PH0 A;  1NU1 E;  2ITA A;  2D2C B;  2KGD A;  4AQR D;  4EOT A;  3BCC J;  2BCC D;  3NMD A;  5TIS H;  1RE3 C;  1OIP A;  4Y99 C;  3C9I A;  2CGQ A;  2Y9Y A;  3GZL A;  3Q5P A;  2KGC A;  2L0Q A;  2JWD A;  2WWW A;  1S72 P;  3H1J G;  1LWU B;  4PWV B;  5KAF E;  1BDC A;  3V4Q A;  2XND H;  1A02 J;  1GMJ A;  1IFP A;  3Q3D A;  3LRY A;  2OYH B;  2W27 A;  4IFF A;  2FFD B;  5KP6 B;  2E75 D;  3D71 A;  4H0L C;  1SQV K;  3MIW A;  2OYI A;  2Z4E A;  2NPS A;  3RK2 B;  5APU A;  3L72 G;  1L4A B;  1BSH A;  4H2Y C;  2VLO A;  1NTM D;  3CX5 H;  4C46 A;  3H1H D;  2FAE A;  5CJ0 A;  3N7N A;  3DS1 A;  4MN4 C;  1NGM B;  3H1L E;  4UHP B;  3MGN A;  1RF1 B;  2MR8 A;  1NTK E;  1UIX A;  3WUV A;  3EFG A;  3FX0 A;  1H0T B;  2HFE D;  2D2C C;  2MVV A;  5GTH H;  1HY8 A;  2IBZ E;  4GR2 A;  2K88 A;  4GOD A;  1LWU C;  1FZA A;  3CCU P;  3H1I E;  1PL5 A;  5KLV D;  2OYH C;  1LP1 A;  3VYI A;  3RL0 D;  1YI2 P;  1L0I A;  4RJT A;  2FXO A;  1PP9 G;  1Y9B A;  2FFD C;  1L0H A;  1IFI A;  1X3O A;  3EJE A;  3RK2 D;  1L4A D;  3CCM P;  2KS1 A;  1NH4 A;  3GW6 A;  1L4A C;  2WMM A;  1SQB J;  3CCE P;  1K8A Q;  3UIA A;  3MHV A;  4LC1 A;  1RF1 C;  2VSQ A;  3WBH A;  4N6J A;  4IPY A;  2H43 A;  2N6Z A;  2ZJS E;  3R4Y A;  2KZJ A;  1MFZ A;  2A45 I;  1SQB G;  2AXC A;  1QEX A;  1NTZ E;  3CME P;  3H1J D;  3A0H E;  1W2B O;  4PJ0 H;  3A2A A;  3BCC D;  2IFM A;  2Z44 A;  4IFM A;  3HD7 B;  3L71 E;  2I8D A;  2WSC J;  1RQU A;  3DS5 A;  2LXB A;  2VLP A;  2PFX A;  2E74 D;  2AVA A;  5CCG A;  4IL6 H;  3M0A A;  2QM7 A;  2NO8 A;  2N50 A;  1HTL C;  2W6A A;  5AW5 B;  3H32 B;  3S4R A;  3IFM A;  2FQ2 A;  3SSU A;  4XFZ A;  1DX7 A;  1RE3 A;  3CXH H;  4YPC A;  2WT7 A;  5BU5 A;  2KNC B;  1JO5 A;  1OZH A;  2JR8 A;  1GU5 A;  3GG2 A;  2R3C A;  1IO4 A;  3RG6 C;  5B66 E;  1SQQ E;  2EHS A;  2XKM A;  1RHZ B;  4UB6 H;  1AV1 A;  1HVV A;  1IMP A;  5B5E H;  1A8O A;  1NYH A;  3TSI A;  2PP6 A;  3KQG A;  1HJ0 A;  3L75 G;  1BCC J;  3HD7 C;  2IZ1 A;  4U3F J;  4B86 A;  5AVR B;  5C39 A;  2FQ0 A;  1KN7 A;  1JY3 N;  3WU2 E;  1AUM A;  1KYO H;  2K92 A;  4BPG A;  2IFN A;  2AEF A;  4HKZ H;  4XRO A;  5EJD A;  3L73 J;  3CCQ P;  3TGU E;  2QA4 P;  2HPC B;  1LTB C;  3EFF K;  2VLN A;  3I56 P;  4I2L C;  1YBK A;  3PHL A;  2C0X A;  1OXZ A;  5I4T G;  2K9J A;  4L73 A;  1T3U A;  1ZXG A;  4PD4 E;  1FU1 A;  1JMM A;  1SQB D;  1L0L K;  3L73 G;  3G9R A;  4HKG A;  2M8R A;  3BAS A;  1FJK A;  1MV8 A;  3BRV B;  2OYH A;  1FOS E;  2LR2 A;  3TDK A;  2K5X A;  3VRL C;  5APX A;  4DCK A;  3U59 A;  4WB4 A;  3P8C D;  1L4A A;  1Q82 Q;  5HGN A;  3BRT B;  1NKZ B;  1BGY J;  3HTK B;  4LGD E;  1FZF A;  1SVF A;  3KZI E;  3L71 D;  1VQ8 P;  3ZDM A;  3H1K E;  4YXD C;  3DS4 A;  2AEJ A;  1OVV A;  4JYB A;  1IFJ A;  3L70 E;  1H0T A;  3H1K J;  2CPB A;  2FKW B;  3V2N A;  5KJ7 D;  1BGY G;  1FZE A;  2ZVN B;  3H4E A;  4GIF A;  1AFO A;  1KLP A;  1OWA A;  4IOI H;  2A45 G;  1KD1 Q;  3AE1 C;  2PRR A;  2B87 B;  1R8E A;  3JCU E;  2AEM A;  1D7M A;  3CX5 I;  2JAZ A;  3RK3 E;  2GZG A;  1QX8 A;  1YQ3 C;  2K1A A;  3AE9 C;  1Q86 Q;  1BDD A;  1A43 A;  2WSE J;  2KOQ A;  1JUN A;  5JPA A;  3L36 A;  2NPS B;  4Z1M H;  1M6N A;  1BCC D;  1ZRT D;  2YO2 A;  3G29 A;  1W2E A;  1IK7 A;  2JJL A;  1VQ6 P;  5AW2 B;  4U3F D;  1FR2 A;  1KQF B;  2Y0C A;  1OW7 A;  2M8L A;  2RH0 A;  2WZ7 A;  1M90 Q;  1ZLL A;  1KQL A;  1KFN A;  2V7Q H;  2ZYD A;  3I55 P;  1L0N G;  2FVE A;  4K3A A;  1DEE G;  4D6T J;  2K93 A;  3L73 D;  3EQ2 A;  3CCL P;  1MFT A;  4JF7 A;  2BEQ D;  1SQV J;  2KZI A;  2A06 E;  1ZMB A;  1VHN A;  4D6T G;  1NJI Q;  2N1T B;  3H6P A;  1VQM P;  3H32 A;  3AEE C;  1EZV G;  3BVH A;  1SP4 A;  2KS1 B;  2NPS C;  2ZFC A;  1SQV G;  2GYK A;  3MGE A;  3RK3 B;  4U0C A;  2HYN A;  4GDO A;  2KNC A;  4OGQ D;  3L74 J;  2GZJ A;  1ZME C;  1RNI A;  1K05 A;  2H89 C;  1ZOY C;  2WQY C;  5DJU B;  1BGY D;  3PTZ A;  5KP8 B;  1M7L A;  4U7J A;  2K0D X;  1UII A;  1LTA C;  2JU1 A;  4C7R A;  5AVU B;  4DG9 A;  2QJY B;  2WSE H;  1VQN P;  3WMM 0;  2B89 A;  3VP8 A;  4WY4 D;  1NTM E;  3H1K D;  1M8O B;  1N8R Q;  2R5B A;  1PPJ G;  4GT1 A;  1SS1 A;  2E1M A;  2H8P D;  1DH3 A;  1MKM A;  4NEO A;  2LIU A;  1NO4 A;  3CXH I;  1WMK A;  2N1T D;  2Q3I A;  3V6I A;  3NTE A;  2N1T C;  1PV3 A;  2P1J A;  1RF0 C;  2WSS H;  2L6E A;  3M0D A;  2E76 B;  4XRQ A;  5CCH C;  2WPQ A;  2B88 A;  1QRJ A;  1TU3 F;  3M91 A;  3RK3 D;  3RK3 C;  1OX3 A;  4COC A;  5KJ7 A;  2FBW C;  2L4B A;  5KKZ B;  2POH A;  2WT7 B;  1K30 A;  2DGY A;  1RE4 A;  2LKM A;  2ZYA A;  4LLH A;  3M9Q A;  3P05 A;  2QJY C;  5EW5 E;  1VDF A;  5GTH E;  1KQG B;  1GXH A;  4HH2 A;  1KYO I;  1MZ8 A;  2CWO A;  3DTJ A;  2YXQ B;  2E75 B;  3SWF A;  1JY2 O;  1GD2 E;  1SQX K;  3HTK A;  1S1C X;  2JO0 A;  1EDL A;  3L4F A;  3MD0 A;  1VQ7 P;  3H1J E;  3JC2 2;  3SWK A;  2E76 C;  1GK4 A;  2JDI H;  2EHT A;  2ROQ A;  5APW A;  3BCC E;  5KTB A;  1L0N K;  2G3A A;  4YXW H;  2CK3 H;  2KP8 A;  3PH0 A;  1EXI A;  5KKZ C;  1PZQ A;  2R3S A;  2K9J B;  1KB9 H;  2M3B A;  2B87 A;  2J58 A;  3WUT A;  5APY A;  3L74 D;  3L72 J;  1Q90 D;  1JCC A;  2LPK A;  2C9L Y;  4N78 D;  2VRS A;  1BAJ A;  5CJ4 A;  1M57 D;  3L37 A;  3RL0 B;  3O8Z A;  4PJ0 E;  4WVZ A;  3AEA C;  2FYN B;  4TT3 H;  5HGM A;  3VP9 A;  5GTI H;  2E75 C;  3SWY A;  4C7N A;  1PEO A;  2BUO A;  2KW2 A;  2KB7 P;  2ZT9 D;  2E5Y A;  5CBO A;  4IL6 E;  5F2O A;  4EIJ A;  1K9M Q;  4OVN F;  1NHL A;  1EIA A;  2OYO A;  2Q1K A;  1MUU A;  5AVZ B;  4N3Y B;  2KOP A;  3TK1 A;  1S5L H;  1L0L J;  3QH9 A;  3S1K A;  4EYY Q;  3G26 A;  5KAI H;  2XU6 A;  3TF5 A;  4WY4 A;  1PP9 J;  4RO0 A;  4PH1 A;  2FYU K;  1SQP K;  1GU4 A;  4M0I A;  2P10 A;  4H13 B;  1GW4 A;  1L0L G;  3CX5 D;  4EDF A;  2K0Y A;  2QNW A;  2H88 C;  4R4L A;  3OAK A;  2N1T A;  1OW8 A;  2K9Y A;  1K73 Q;  2E74 B;  1IUQ A;  2M8N A;  3RL0 C;  1RF0 A;  4ZKU A;  1JMB A;  2XT1 A;  1JY3 O;  4CA3 A;  2FYN C;  5CCH A;  4NPF X;  4BRY A;  2FVF A;  5E79 E;  1JY2 N;  3RK2 C;  2MVU A;  3HYB A;  1SQB E;  1DEB A;  3GHG B;  3CCJ P;  1GW3 A;  3VMX A;  1ZR4 A;  3RG2 A;  2KLV A;  2O01 N;  2AXT H;  4L76 A;  1M1J B;  2GA1 A;  3B5I A;  2OAR A;  3IF4 A;  1KYO E;  2IBZ G;  2J59 M;  1GXG A;  1FOS F;  2O01 J;  1H89 A;  2K0X A;  5AVT B;  1BE3 G;  1FS0 E;  3HUS A;  2UWJ E;  3P8C E;  1GTW A;  1ZN5 A;  1J1D B;  3BAT A;  1T3J A;  3B5N B;  1G2C A;  3AEG C;  2M0B A;  4H13 D;  2Q9I A;  3V4W A;  3AED C;  5KAF H;  3E1I A;  3LW5 H;  2KUB A;  1YHQ P;  5KLV K;  3E1R A;  1RO2 A;  2Q3E A;  2E74 C;  1AQ5 A;  3L72 D;  3GZM A;  2C9N Y;  5EFW B;  2Q6Q A;  2W8Z A;  4DT0 A;  3GHG C;  3GF3 A;  1HBW A;  4A7P A;  1ZV8 A;  1KZU B;  1M1J C;  2HG5 D;  4NPD A;  2ZVO B;  2IPP A;  3CC7 P;  1AA0 A;  3C1L A;  3L75 J;  1EQ7 A;  1YQ4 C;  2PEN A;  5BU8 B;  2QJK B;  1M74 A;  3DS3 A;  3T97 A;  2GUV A;  3Q1M A;  1J1D C;  3VN0 A;  2YO3 A;  3B5N D;  5APQ A;  3D70 A;  3B5N C;  1BCC E;  1L0L D;  2JYL A;  1ZRT E;  5H2F E;  2PGD A;  4U3F E;  5HVC A;  5CZD B;  1LT9 A;  1SLQ A;  3A0B E;  4Y28 J;  1PP9 D;  4W7Z A;  1S5L X;  1NU1 K;  2JEE A;  3CXH D;  3TNU B;  1HJB A;  1URQ D;  2M5A A;  1EZV I;  1IK9 A;  1KMI Z;  4M3L A;  3VTP C;  2O01 H;  3L73 E;  3L35 A;  3PJS K;  1QGK B;  3EJB A;  3DPH A;  2I1J A;  5TJH A;  2KI7 B;  2R32 A;  4RES B;  2CPS A;  3CL3 D;  3II6 A;  1N7S B;  2FAC A;  1HQB A;  1AVO A;  1E79 H;  2VLQ A;  2L91 A;  1AJY A;  2QJK C;  1OW6 A;  3CCS P;  1KTM A;  2AFD A;  2QE7 H;  2JP3 A;  1YTZ T;  3NFQ A;  3A0H H;  2V7Q J;  1KYO D;  2PEJ A;  1FE6 A;  2FXP A;  1OFC X;  2CG5 B;  2DNW A;  1NTK K;  1BGY E;  2IYO A;  2LL8 A;  4JBZ A;  1M56 D;  3FWN A;  2LXC B;  3TGU G;  1PFI A;  2P2U A;  2L5G B;  5KLI B;  5CHX A;  1GL2 D;  1OR5 A;  3M0D C;  1N73 B;  2K2Q A;  3GF7 A;  5AW1 B;  2BHV A;  4U0F A;  2RN0 A;  4IZ6 A;  4KHX A;  2YMK A;  5HV8 A;  4K35 A;  2DW3 A;  1N7S D;  1R5S A;  2CNR A;  2FVA A;  5KJ7 C;  5AVX B;  1N7S C;  2GM4 A;  2KSJ A;  2MR7 A;  1U7J A;  4JYC A;  1KIL D;  2Y0D A;  2PY8 A;  2KGA A;  1J1E B;  1JB0 J;  2YKQ A;  5F2N A;  5B66 H;  2ONT A;  1RE4 C;  4DJG A;  3NXS A;  3L75 D;  3A7O A;  1LTG C;  1YTZ I;  3A3Y B;  1SQX J;  3PRJ A;  1SFC D;  3V2R A;  1JY2 P;  5AW9 B;  3RGU A;  1VPC A;  1EDK A;  3GHG A;  4C7N B;  1ZNV A;  1ZR2 A;  2QIW A;  3L70 G;  1M1J A;  1L0N J;  1NVO A;  1NTZ K;  1F80 D;  3FXD A;  1SQX G;  3GLM A;  5KLI C;  3WU2 H;  4OGQ B;  1S2E A;  1N73 C;  4EI2 A;  5F2K A;  4W80 A;  3H25 A;  2MKV A;  2ZAE B;  4D6T E;  3G6E P;  1ACP A;  2Z45 A;  3OJA B;  3B5N A;  1FC2 C;  2KOG A;  3P8M C;  3USS A;  5BS2 A;  1RH5 B;  4PD4 H;  4WY4 B;  1VQP P;  1CEI A;  1M6E X;  1SQV E;  3VMY A;  1J1E C;  1EOQ A;  2XV6 A;  3TYY A;  1XTG B;  3Q2Y A;  1RQV A;  1EXJ A;  1IFM A;  3Q5R A;  3FGA D;  3R2P A;  5L8R J;  3B71 A;  3P32 A;  2GZE A;  2KGE A;  3OW2 O;  2JWA A;  1DIP A;  3PP5 A;  5CBN A;  2KOO A;  1VKU A;  1G1J A;  4BRY B;  1FDM A;  4DZO A;  1SQQ K;  3L74 E;  3LID A;  1A02 F;  4GOF A;  4N78 E;  3DS0 A;  4OGQ C;  2O3J A;  3KZI H;  1Y8A A;  1LTT C;  5DJT B;  1PGQ A;  2FYU J;  1SQP J;  1EMV A;  1FZC B;  1BSN A;  3HUS B;  4ZKP A;  4GOE A;  5TIS E;  2JB0 A;  4JQ0 D;  2QJP B;  2W6B A;  4WY4 C;  3U43 A;  1G2C B;  3I5C A;  2QVA A;  1N86 A;  3OA7 A;  2BCC G;  1W5C E;  2W90 A;  4BWN A;  3S9O A;  2FYU G;  1SQP G;  2RKL A;  2XV5 A;  3JCU H;  3TNU A;  1CI6 A;  2YMY A;  1JY3 P;  1OMI A;  1S3J A;  2YIU B;  3C8V A;  1FAV A;  1OVU A;  4L75 A;  1P84 H;  4U0A A;  2Y9Z A;  5GTI E;  1FZG A;  3K5B A;  3H1H J;  1PGP A;  1SQX D;  2HR3 A;  1IFN A;  2PNG A;  2MY5 A;  3CX5 E;  2IBZ I;  3CLQ A;  1HGV A;  1IC2 A;  1N7S A;  1Z6M A;  1PGO A;  5AW3 B;  1NTM G;  1L0N D;  3H1H G;  4HYT B;  2KOD A;  2GZI A;  1NQ4 A;  3HUS C;  1N7L A;  5KAI E;  3T97 B;  2JKV A;  2QJP C;  2KYV A;  1T2K D;  4BXL A;  2IYP A;  1NKN A;  3AEC C;  4UB8 H;  4D6T D;  3AE4 C;  1HH0 A;  1LT9 B;  1Y47 A;  2FQ1 A;  4O9B A;  3G71 P;  1J2J B;  3CWB J;  2EIA A;  2ZT9 B;  1EZV D;  2YIU C;  2M5A B;  1SQV D;  5KLV G;  4H44 B;  1N73 A;  2W6J H;  1HUC A;  4R0M A;  2WVR A;  3MTU E;  3B4Q A;  5M1B A;  2PAJ A;  2KG9 A;  2Z5I A;  2KXP B;  4H2W C;  3AE3 C;  3CWB G;  4HJG H;  5CCG D;  4KJM A;  2AXT E;  2HOD B;  3KXD A;  3G4S P;  4IFD K;  3MUD A;  1JOC A;  3L72 E;  3HE4 B;  3AEF C;  4QMA A;  3CXC O;  1YJW P;  4WWI A;  4XFJ A;  2YKP A;  2JBG A;  4WYM A;  1PPJ D;  1NU1 J;  2KWL A;  2JYG A;  2FYU D;  1SQP D;  1AYI A;  2JO1 A;  2K37 A;  2OTL P;  2H7H A;  4YTP C;  4KT0 J;  1LT9 C;  1YYC A;  3QWO C;  3RBX A;  1JTH B;  2LOL A;  3BCC G;  2ZT9 C;  3LW5 J;  1NU1 G;  4XFX A;  2N9Y B;  4H44 D;  1LTJ B;  1FDI A;  1KB9 D;  1LT1 A;  4H44 C;  4U0D A;  1JEK A;  4H0L D;  2LTE A;  1L0L E;  1U57 A;  1Q2N A;  4I7Z B;  3CI9 A;  3B8E B;  1M1K Q;  2AFE A;  3G1G A;  1JM0 A;  1PP9 E;  4BPF A;  3CXH E;  3AE6 C;  1LGH B;  2NZ2 A;  2MF4 A;  1YIJ P;  5HGO A;  3H1L J;  2KOS A;  1K04 A;  2XDJ A;  4ASW A;  2D2C D;  3U1A A;  2IX7 C;  1NTK J;  4UB6 E;  1VQK P;  3KHU A;  5B5E E;  2KOR A;  3Q20 A;  3N4X A;  2KG6 A;  4XE5 B;  3O6Q B;  1BE3 E;  4HB1 A;  3H1L G;  4PV1 B;  1USD A;  2GZF A;  2AF8 A;  2KSE A;  1VQO P;  1BE3 J;  1NTK G;  3H1I J;  2JQ4 A;  3NY7 B;  3LIE A;  2XZ0 D;  1E6J P;  1LTJ C;  4PD4 I;  1NTM K;  3E7K A;  2BQ1 E;  2ZXE B;  4W7Y A;  2M5R A;  3CWB D;  2P67 A;  3SFD C;  1X9V A;  4I7Z C;  2FAD A;  2L9F A;  1VQ5 P;  1FZC A;  1L2P A;  3CCR P;  3D6Z A;  3H1I G;  3D6Y A;  3G3Z A;  5AW7 B;  2N5H A;  1PGJ A; 
#chains in the Genus database with same CATH homology
 3M1M A;  2PEJ A;  1YI2 P;  3G26 A;  3G21 A;  5BS1 A;  1VQM P;  5BS2 A;  3G1I A;  3CMA P;  3E2D A;  1PEU A;  1VQP P;  3CCV P;  1A8O A;  1M6E X;  1PEM A;  2XXM A;  4PH0 A;  2CWO A;  3DTJ A;  1EOQ A;  4PH1 A;  2XV6 A;  3CCM P;  4XFX A;  3H4E A;  2PEM A;  3MGE A;  2PEI A;  4U0C A;  4U0D A;  4M0I A;  3CC7 P;  1RNI A;  2JO0 A;  1KD1 Q;  4COP A;  2KOD A;  3G0V A;  2PEN A;  3G28 A;  5HGL A;  3CCE P;  1M1K Q;  1S72 P;  1K8A Q;  1VQ7 P;  1M74 A;  4U0B A;  3G1G A;  3DS3 A;  1K73 Q;  3CC2 P;  1IUQ A;  2M8N A;  3WBH A;  2BHV A;  4IPY A;  4U0F A;  4XFY A;  3OW2 O;  1KQS O;  2XT1 A;  1AUM A;  1VQ4 P;  1QVG O;  1Q86 Q;  3LRY A;  1A43 A;  2JYL A;  1Q81 Q;  1VQN P;  2EFJ A;  4XRO A;  1Q7Y Q;  3HYB A;  5JPA A;  1YIJ P;  3CCQ P;  5HGO A;  2QA4 P;  3CME P;  3CCJ P;  4GR6 A;  1KC8 Q;  3G71 P;  1N8R Q;  2EIA A;  3I56 P;  3DS0 A;  2PY8 A;  1W2B O;  1VQL P;  2E1M A;  5F2N A;  1VQK P;  2PEK A;  3B5I A;  4QNB A;  1M6N A;  2Z44 A;  5I4T G;  2OAR A;  2PEQ A;  2ONT A;  3H0D A;  3H47 A;  3G29 A;  3DS5 A;  3Q20 A;  1VQ6 P;  2M8P A;  3NTE A;  4U0E A;  2Z46 A;  3DS1 A;  5DCK A;  1BAJ A;  2M8L A;  2EG5 A;  1PEQ A;  2OTJ P;  2L6E A;  1YJN P;  3DPH A;  1VQO P;  1M90 Q;  4XRQ A;  3VRL C;  3I55 P;  3G4S P;  1YIT P;  1QRJ A;  3DS2 A;  1RO0 A;  5HGM A;  1E6J P;  3CD6 P;  2BUO A;  1PEO A;  4COC A;  2BQ1 E;  1QVF O;  3CCL P;  1Q82 Q;  4GR2 A;  4XFZ A;  2QEX P;  3CXC O;  1YJW P;  5HGN A;  3CC4 P;  1K30 A;  1VQ5 P;  4WYM A;  2DGY A;  3HZQ A;  5F2O A;  1YHQ P;  2P9X A;  5F2K A;  1K9M Q;  1D1D A;  3CCS P;  3CCR P;  1YJ9 P;  1RO2 A;  1ZMB A;  3CCU P;  2JYG A;  1EIA A;  1JJ2 O;  4U0A A;  3RG6 C;  1VQ9 P;  3G6E P;  2LF4 A;  1NJI Q;  2OTL P;  3P05 A;  3CPW O;  1VQ8 P;  2PEO A;  2Z45 A;  3DS4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...