3CCSP

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2482a
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
143
structure length
143
Chain Sequence
b'TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 45
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3ccsP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 3ccsP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 3ccsP02
3CMAP 1YI2P 3CCVP 1K73Q 2OTLP 3I55P 1N8RQ 1M90Q 3CXCO 1W2BO 3CCRP 1VQ9P 3CC2P 3G71P 1VQOP 1S72P 3CPWO 1KQSO 3CC4P 1VQNP 1VQ6P 1VQ5P 3CC7P 1KD1Q 1VQ4P 3CCJP 1YHQP 1Q86Q 1M1KQ 3G6EP 1NJIQ 1VQPP 2QEXP 1YITP 1Q82Q 1VQKP 2QA4P 1YJNP 1YIJP 1K9MQ 3G4SP 1YJ9P 3CCSP 1Q7YQ 1JJ2O 3CCEP 1YJWP 1VQLP 2OTJP 1VQMP 3CMEP 1VQ7P 1K8AQ 3CD6P 3CCQP 1QVFO 1KC8Q 3CCMP 1Q81Q 1QVGO 3I56P 1VQ8P 3CCLP 3OW2O 3CCUP
chains in the Genus database with same CATH superfamily
3LRYA 2FYNC 5KAIH 5GTIH 4COPA 1YQ4C 4N78E 1E6JP 1T8KA 1NTKE 1VHNA 4IZ6A 2K88A 3IN6A 4PD4H 1ZR2A 2FKWB 3L36A 1EXJA 3L74J 1KYOH 2AFDA 1L0LK 1PEMA 2QVAA 1SQXG 4Y99C 1NTMK 1SQBE 5KJ7A 1Y47A 4JBZA 2Y0DA 3GHGA 2FHSC 2QJKC 2E76D 2E42A 3AEEC 4XA4A 3BCCE 3OAKA 4PV1C 1LTTC 1M74A 2M8LA 1FZBA 1PP9D 3L73G 5JPAA 3P05A 3RL0B 5KAFH 5AW4B 5KLVK 5M1BA 2Q7CA 2RMZA 1YBKA 2AEJA 3Q2YA 1PPJD 3Q3DA 2A45G 1NOHA 4QKOA 2BUOA 3GHGB 2WSEH 1PEUA 2KWLA 1DH3A 3LW5H 3L74E 3TYYA 1UIXA 3G3ZA 4DJGA 1RE3A 3L71E 1BE3G 2G8YA 3PHLA 4F37A 3Q20A 1AF8A 3H6PA 2JKVA 2SPZA 5C39A 1VQ6P 1VQNP 2W6BA 2DW3A 3TGUJ 1VQLP 1L0LD 2R5DA 1VDFA 4EYYQ 4DG9A 1BCCE 1L4AA 3MZWB 3B5NA 3H1LE 1Z6MA 2L0QA 2WSFJ 2P58A 1FS0E 2IBZE 1ZRTD 2KYVA 2KOGA 3H1HE 4D6TG 1GXHA 3G0VA 4HH2A 3VRLC 4L73A 1SFCC 1OW8A 1GL2B 5KLVD 1L4AB 3B5NB 2RKLA 3AE3C 3CC7P 1VQ9P 3TNUA 4XE5B 1EDIA 2A06E 3RK3C 3RK3D 5BU8B 1FZFA 2W6AA 2E5YA 3MGEA 1A43A 1BDDA 2DNWA 2E43A 4U0AA 4PXHB 1HF9A 3S4RA 3EWKA 2IZ0A 2BCCD 2LIWA 3TNUB 3M06A 4IL6H 1VQMP 2CK3H 3CWBD 3CMEP 3L70E 5CJ4A 1USDA 1JY3P 5AVSB 1QVGO 1MFZA 3MUDC 2J58A 1PV3A 3IF4A 4OWFA 1PL5A 3CXCO 4PH0A 1UNKA 4C7RA 3P7KA 2M8NA 3G4SP 3FWLA 1YTZT 1NTZJ 1K8AQ 3F89A 4ZKPA 1S5LX 5F2OA 3M0AA 3MTUE 1KQLA 3H1IG 3IR9A 5E79H 2E75D 1PZQA 2QM8A 2KXPB 1AJYA 2LKIA 1ZW0A 1KILA 1LWUC 1Q90D 1WMKA 1NYHA 1NAYA 3CL3D 2XKMA 4EDFA 1AQ5A 2LXBA 3G71P 3LIEA 3CX5I 1SQPK 1ZP0C 2JU1A 2JYLA 3G6EP 1OX3A 5CJ0A 1LTGC 4IFDK 1EC5A 4ZNCA 1NGMB 1KTMA 3U43A 5KAIE 5GTIE 1EZVI 4JYCA 4WY4A 3CCVP 1KILB 1X9VA 4PD4E 2WSEJ 2KG8A 3KXDA 1KYOE 4I7ZC 4IFFA 1RF0A 2GM4A 4MN4C 3GMAA 1OVRA 1KQGB 2L9FA 3Q5RA 3KHUA 4Z1MH 2LPKA 4WY4B 2ONTA 1GK6A 1NH4A 3BCCG 3D6ZA 2W90A 5HGMA 1RF1C 3H1KE 1M8OB 4N3YB 3VMYA 1OXZA 5DCKA 1SQXJ 1JY2P 5CCGC 5KAFE 4U0DA 1SQPD 1X8YA 3RK2B 3VN0A 3MHVA 2MR7A 3ABVC 4H44C 3RBXA 4QMAA 1OVVA 2WPVB 2OTKE 1AFOA 3L71G 3D70A 2KOOA 1IFMA 3RL0C 4I1LA 4PWVB 2FQ2A 1CW5A 5KJ7C 4AUWA 3B71A 2OYIC 1QRJA 2B87A 2GDYA 4YTPC 1L0ND 2E76B 1VL2A 1BCCG 4LGDE 4TT3H 5BU5A 1EDKA 3H1LG 1ZNVA 1JCDA 2JDIH 2E1MA 3WMM0 3M9BA 1FZCC 1PGJA 2VLQA 1T3JA 3GKLC 3N7NA 4I2LC 1SQXK 1G2CA 4H13D 5CZDB 5AW8B 1KZUB 2K94A 3H1HG 3VP8A 3RL0g 4L74A 4OGQB 1NO4A 4XFYA 1YYCA 1N73C 1D1DA 3D6YA 1DIPA 3A7OA 4L76A 3T97A 1RE3C 3LIDA 4NEOA 2YMYA 3U1CA 2FYUJ 3PLNA 3L75J 3A2AA 2KGDA 2IYOA 3B4QA 5H2FH 2WQYC 1BXIA 2M3BA 1LTIC 1JCCA 2FFDA 1J1EC 1GL2C 1IC2A 1YJNP 4M0IA 3WUUA 2FADA 1LT9A 3T97B 4DT0A 2KODA 1Y9BA 1UJZA 1EQ7A 3L72D 2VLNA 5AVVB 5APWA 1LTJB 2JWAA 2WMMA 4IL6E 2KOPA 3IFMA 3GF7A 4HKGA 3HUSA 2Y9YA 2FFDB 3L75E 2KNCA 1JJ2O 2E74B 1LNQA 1LT9B 2W27A 1KILE 5CHXA 2FACA 2FVEA 3CCLP 4ASVA 4GIFA 1S5LH 1K04A 2XNDH 4HJGH 3EJBA 3L73D 3HUSB 1UIIA 2QJYB 5E79E 3E2DA 3JSVC 1LTBC 5AW1B 1IZNB 4IFMA 1E5WA 4UB6H 1VQ5P 2KUBA 1N2DC 1MZ9A 2D2CC 3MIWA 2N9YB 2D2CD 2ZYDA 2XZ1C 1AVOA 1PP9J 2B9BA 1P84D 1BSHA 1Y8AA 3NTEA 1MKMA 5BVZA 1FZEA 4H0LD 3A3YB 1L0NG 2MJZA 1PIXA 5APTA 5CCHA 1Z56A 4COCA 1ZV8A 3O6QA 3CCEP 2OARA 3V5BA 5TISH 1NAFA 3CXHD 2DGYA 3NY7B 4HYTB 2E75B 2OTJP 3HD7D 1CI6A 1AUMA 1KB9I 3DS0A 2KZIA 2YIUB 2A45I 4WB4A 3EJDA 2OTLP 1L0LJ 1TU3F 3H1JE 2JO0A 4XFZA 2M3EA 1NTMJ 1GPJA 4U3FJ 1QEXA 1KILC 3VYIA 1FOSF 1PP9E 1GTWA 3O6QB 1GU4A 1VF5C 1NU1D 1VF5D 3DTJA 1PPJE 3H1KG 3CCMP 1KFNA 3PJSK 2NPSC 3F5HA 1NVOA 2C0XA 2NPSD 1CI6B 3A0HH 2KOQA 1IMQA 4BPFA 1SQVD 2I8DA 4NPEA 5KLVJ 1YITP 4YXDC 2PNGA 2K9YA 3G1GA 3L72G 2KP8A 3Q5PA 4GOFA 1HWTC 2FQ1A 2R32A 2H89C 3GW6A 3HE4A 1M90Q 2ZVNB 3SWFA 3KQGA 1NTME 1GDTA 4U3FE 1HJ0A 1KN7A 1QX8A 1HBWA 1NKNA 3M0DA 1T2KC 1BGYD 2LIUA 2AXTH 2PGDA 1VQKP 1QVFO 1EXIA 2BCCJ 2YO3A 1JM0A 1SQQD 4K3AA 1CEIA 3W67A 3CWBJ 1N7SA 4PV1D 3HE4B 1FDIA 2KR5A 3H1ID 2WSSH 2QJPB 5AVZB 1AVYA 2N50A 1OZHA 2WPTA 2Q3EA 4C46A 2MKVA 5B66H 3NTNA 3M9QA 1QL1A 3GF3A 2Y0CA 4CPGA 3H25A 1IFJA 2KGAA 3AE9C 5APSA 1J1DC 3CE7A 2WITA 1QL2A 1N7SB 5H2FE 2N1TA 3NMDA 1SP4A 5AW7B 2FBWC 3IAOA 1XTGB 4JQ0D 5F2NA 2K1AA 1JUNA 1VQ8P 1JNMA 3CMAP 1RE4A 2Z5HA 1RH5B 2WZ7A 4N78D 1NTKD 4XROA 3MGNA 1L0IA 2NO8A 1FJKA 3CX5E 3GZLA 2K0YA 3B8EB 2N1TB 1DD4A 3CD6P 2PEIA 4LC1A 3R4YA 3I56P 3AE6C 1SFCD 1RY3A 5AVUB 3A5TA 1WT6A 2JYGA 1DEBA 1SQBD 1EZVE 1IFPA 1OWAA 1VQ4P 3RG6C 1G1IA 3CCJP 1LTJC 2KI7B 1S3JA 3BCCD 5KTBA 1KB9H 3TGUE 1NU1G 1S5LE 2A45H 2Y9ZA 2RN0A 5DJTB 2KZJA 2K9JA 3FGAD 3AE5C 2KOSA 1SQVG 3CLQA 3P8MC 4Y28J 1H8AA 3CC4P 1EDLA 1Q86Q 1M1KQ 1XTCC 1FC2C 2HLOA 1Q7YQ 3L71D 2KGEA 1PGPA 4UB6E 1KC8Q 2JGPA 2Z4EA 2ZVOB 2N5IA 2K9JB 4MRTC 2R5BA 5GTHH 1SQPJ 2UWJE 2BASA 3GJNA 4EIJA 1BGYG 2KB7P 2K37A 1BCCD 3H1LD 1HY8A 1URQA 1SQQG 2C9NY 2PEQA 2I1KA 5TISE 5AW6B 2ZT9B 2IBZD 3CCRP 3H1HD 5EW5E 3CC2P 3SWYA 2Z44A 2LTEA 2FVFA 1OMIA 5EJDA 1YIJP 3H1JG 2ERHA 1L0NJ 5L8RJ 2KSEA 2QE7H 2Q9IA 1URQB 3GZMA 1K73Q 1S1CX 2OYHA 2A06D 4H2XC 2YIUC 1K05A 2L22A 3P8CE 3U1AA 4H0LB 2H88C 3A0HE 1JB0J 4ASWA 2PENA 1M1JA 1NTZE 1EIAA 1HH0A 1Q2NA 3DS5A 2WPQA 2C0WA 2MVVA 1HQBA 2W83C 1PFIA 1NTKG 1S9KE 3TK1A 3CPWO 3V6IA 2OYHB 3L70D 1IMPA 4JPZB 2N6YA 1W2EA 1L0NK 3TSIA 1R8EA 1IUQA 1SQBG 2HPCA 1M1JB 1AV1A 2NZ2A 3W68A 3OW2O 1N8RQ 3L72J 1X22A 1DNYA 2ZAEB 2AXTE 2I1JA 2HODA 1X0TA 3SFDC 1JY3O 2GUSA 1AQTA 1DD3A 5CBNA 3H0DA 1M57D 1USEA 2QG4A 4NPFX 2FYNB 2MD9A 1KQFB 3AE4C 3M9HA 5CCGD 3CCUP 3HTKA 2EHTA 1OVUA 5KP7B 2HPCB 5B66E 4I6MC 1RQVA 2R3CA 3WUTA 5AVYB 2IPPA 3L74G 2OQQA 2PFXA 3AEDC 1M6NA 4H44D 2K93A 4AQRD 3N4XA 2JU2A 2QJPC 2HODB 1PGQA 4Y99B 4O9BA 3RL0D 1FDOA 3L73J 3M91A 5KJ7D 2PAJA 2WWWA 2KORA 3GHGC 3M0DC 3HTKB 2QJKB 2YKOA 1FE6A 2ZXEB 2ZYAA 1KD1Q 1H89A 5APYA 4BRYA 1LGHB 3FX0A 1LJ2A 1ZOYC 2GUVA 1SQXE 1EDJA 1BE3J 2V7QH 1E79H 3RG2A 4WYMA 3WU2H 1FU1A 4PD4D 2IBZG 1OW7A 3KDPB 1N86A 3G21A 4XFJA 3KYQA 4YXWH 2GZEA 1KYOD 3GG2A 3TF5A 1EZVG 2B87B 2MR8A 1GU5A 2K5XA 4GODA 1IO4A 2N9BA 2L91A 4BRYB 2N98A 3PH0A 2AF8A 3L73E 4W80A 3AEAC 4TLFA 4B86A 3TGUG 1G2CB 3Q1MA 4L75A 1KB9E 2A06G 3H1KD 1RQUA 4D6TJ 2JEEA 3UIAA 1U7JA 1SFCA 2WSCJ 3USSA 1GL2D 1SLQA 3OA7A 1L4AC 4BPGA 2AEMA 3B5NC 1L4AD 2MF4A 1BE3E 1YQ3C 1IJDB 4U0BA 3H4EA 2KSJA 2Y0EA 4UB8H 2PEOA 5EFWB 2L5GB 3VMZA 3L70G 3O8ZA 1EMVA 2EG5A 5AVRB 1JY2O 2FYUE 4R0MA 4GDOA 2P1JA 1SQVJ 5KP6B 4U0EA 1X79B 2YXQB 5GTHE 1FAVA 2XT1A 5CMZA 3PP5A 3BVHA 4D6TE 1A8OA 5HGLA 4JYBA 4XFXA 1BDCA 2GZGA 1OFCX 3RK3B 3MUDA 4QNBA 5AW0B 1HGVA 3S1KA 5AVTB 3JCUH 2PEMA 2B89A 2KNCB 4HB1A 4GR6A 3BATA 1HJBA 1LTAC 2CQ8A 1NU1K 2AFEA 2IDBA 4GKGA 1HVVA 1ZMEC 2ZT9C 1NJIQ 1S4XA 1K9MQ 4WWIA 3H1IJ 2FXMA 2JAZA 1SQVK 3C1LA 1GZLA 2FAEA 2GDWA 2O1JA 2ZJSE 2QSIA 1NTZG 3AEGC 3EJEA 1BSNA 1OIPA 4GT1A 1GD2E 2K0DX 1GK4A 1URQC 5B5EH 1LWUA 1SS1A 2FQ0A 2MVUA 2BQ1E 3SFEC 3PTZA 2O3JA 2VSQA 2K92A 1JEKA 1QLED 5AW5B 1IFIA 3AEBC 2WVRA 1PGOA 1S2EA 3L75D 2H8PD 1KV4A 3VTPC 1SQQK 1EOQA 1M56D 1MUUA 2ITAA 1JMMA 2IYPA 1KILD 1LWUB 5HGNA 2XV6A 5HV8A 1NTKJ 4DOJA 1PEOA 2KLUA 2K3RA 1DEEG 1P84I 4CA3A 1HGZA 3P32A 2C9LY 3G1IA 2IZ1A 3VOPA 2H43A 2V7QJ 3V2QA 1F80D 1CSBA 5F2KA 4RKUJ 2JO1A 4WY4C 4WY4D 3CXHI 4BPHA 1RF1A 4WBAA 1LT1A 3BCCJ 2QM7A 2PEJA 1L0LE 4LLHA 4N6JA 2P9XA 2KLVA 2Q6QA 3FXDA 4I7ZB 1RF0C 2YMKA 5CCGA 4PJ0H 3SWKA 3G26A 1ZMBA 3RK2C 1R5LA 3RK2D 3A0BH 2LKMA 4EOTA 1NTKK 1RO2A 1T2KD 1ZRTE 2LF4A 1RF1B 3V2RA 3L71J 3V2PA 3GLMA 2O01N 3WU2E 5KLVE 1SQBK 1YHQP 1T6AA 2W8ZA 2OYIA 3WUVA 2JWDA 1NWQA 2E76C 1RO0A 3H1JD 3V2NA 4H44B 2Z45A 5APXA 1FZCA 1BCCJ 2HG5D 4U7JA 3H1LJ 3DS3A 5K5GB 2B88A 3RK3E 1A02F 4OVNF 1L0HA 2LXCB 1KLPA 2CPSA 1ZLLA 3EFFK 3TDKA 2J59M 1FBMA 4XRQA 3BASA 3CI9A 4OGQC 3H1HJ 1FJPA 4OGQD 3RGUA 1N73A 2FXPA 2OYIB 3M1MA 5HVCA 4JF7A 4KJMA 1GMJA 2BCCE 3E7KA 1HTLC 1MV8A 1IK9A 3S9OA 2O01J 3CWBE 1FZCB 2GDXA 2Q5UA 1ZR4A 4OH8B 4H13B 2KW2A 4UB8E 2M8PA 2QRXA 1WRGA 2P10A 2JR8A 1GL2A 3U59A 1GXGA 4IPYA 2QNWA 1N73B 1NTMD 3E1RA 2FYUG 4U3FD 4IOIH 3L75G 3VMXA 1ZXGA 3HYBA 5BS1A 3Q5SA 3AE1C 1VQPP 2M0BA 2WPSA 2CG5B 2JBGA 5AVXB 1AYIA 2H7HA 3L70J 2XDJA 2FFDC 1J1EB 1KMIZ 2E74C 1YI2P 2AXCA 2E74D 2PEKA 2CWOA 1LT9C 3MP7B 2LR2A 3JCUE 1KQSO 1SVFA 4H2WC 2OYOA 3L4FA 1P84H 3L74D 4BXLA 4DZOA 3DPHA 4BWNA 2K0XA 4RJTA 2GZFA 3HUSC 2EHSA 2O1KA 2QJYC 3KZIH 2M5AA 3I55P 1T8ZA 2YXRB 5TJHA 3CXHH 3VMAA 2VLOA 1AA0A 4WVZA 1JY3N 5HGOA 4U0CA 1VKUA 2YO2A 4ZKUA 5AW9B 5B5EE 2WSCH 2POHA 1N7LA 1IFNA 2E5TA 3G29A 3CX5D 2Z46A 1FDMA 3H32A 3HRNA 2M5AB 3K5BA 5DJUB 2P67A 1FOSE 3CCSP 2BEZF 2LL8A 1EZVD 3FWNA 3V4QA 1VPCA 1PP9G 3G9RA 2EFJA 2D2CB 2E75C 3HD7A 2YNYA 1OW6A 3TGUD 1PPJG 1SQPE 3H32B 2WTYA 2JQ4A 1MZ8A 1H88A 1IFDA 3RBZA 2EIAA 1ZN5A 3DS2A 5CCHC 5CCHD 2XZ0D 2AEFA 5AVQB 3AE7C 1W5CE 2LOLA 1ACPA 4YPCA 4K35A 3AE8C 1BAJA 1JMBA 1A02J 5KLIB 2RH0A 3HD7B 2HR3A 2IBZI 3KPEA 2NPSA 3H1KJ 1L0LG 1FZGA 2Q3IA 2KGCA 1L0NE 3B4SA 1NTMG 1NTZK 4U3FG 2PP6A 4PJ0E 2VLPA 2GA1A 2ZFCA 2HFED 2GZIA 2P7JA 5AW3B 3A0BE 3DS4A 2G3AA 2L6EA 2FYZA 3LW5J 1VF5B 2L4BA 1LP1A 4GR2A 1PEQA 2WPRA 2J5UA 3E1IA 1U7MA 2NPSB 5KKZB 1U57A 1OR5A 1K30A 3OJAB 5KLVG 2K2QA 2N6ZA 2GYKA 2JP3A 1HUCA 1RHZB 1DX7A 1NHLA 3FXEA 3EQ2A 5APUA 1VQOP 4DCKA 2YKQA 1L2PA 4KHXA 2ZYGA 1JY2N 1M6EX 1YJ9P 2LMLA 1FZAA 1LP1B 1D7MA 4U0FA 2KS1A 2IFNA 1KORA 1T3UA 2JB0A 2N5HA 2XNXA 3P8CD 3DS1A 3L72E 4W7YA 5I4TG 2BCCG 1NTZD 1JO5A 3CWBG 1JOCA 3B5IA 5AW2B 1N7SC 2MY5A 4PV1B 1NQ4A 5BS2A 1M7LA 1N7SD 1S9KD 2Q1KA 2R44A 2KS1B 4W7ZA 5APQA 1J2JB 5KP8B 4EI2A 2ROQA 2BHVA 1GW4A 2P2UA 3AE2C 4M3LA 2QA4P 1NKZB 1J1DB 1MFTA 3BRVB 1VQ7P 4H13C 5APVA 2IX7C 2FY8A 4UHPB 2N1TC 2N1TD 1H0TA 1W2BO 2M8RA 3HE5A 1X3OA 2KK7A 1DV5A 2AVAA 3WBHA 1RE4C 3H47A 3B5ND 2CPBA 1LTJA 4GOEA 4R4MA 1IK7A 1P84E 3C8VA 4PD4I 1NU1J 5CBOA 1H0TB 1KYOI 2YKPA 3HE5B 1SFCB 5AVWB 3KZIE 3BRTB 1QGKB 3NFQA 3CX5H 3CCQP 3CXHE 2R3SA 3NXSA 4RO0A 3EFGA 3AECC 2QIWA 2V4HA 1SQXD 2XU6A 2FVAA 2O01H 2FYUK 1YJWP 3I5CA 2GZJA 4AYCA 1R5SA 7CEIA 1G1JA 1CZQA 3D71A 1BGYJ 4R4LA 1NU1E 4NPDA 2M5RA 3MD0A 3PRJA 4H2YC 2NRGA 3G28A 1SQQJ 3QH9A 2Z5IA 2JJLA 2ZT9D 3L37A 1SQVE 2WSFH 1SQPG 1KB9D 2XV5A 2PY8A 1Q81Q 4C7NA 2KG9A 2CNRA 3H1JJ 2KG6A 2XXMA 2BEQD 2PRRA 3II6A 1BE3D 2CGQA 2ZXXA 1URQD 2W6JH 4IL6X 4PH1A 3QWOC 3JC22 4H0LC 2KIKA 2IFMA 1BGYE 4KT0J 4RESB 1FR2A 4C7NB 1JTHA 2FYUD 1S72P 1LTSC 3ITKA 1SQQE 1Q82Q 2QEXP 2WT7A 3H1IE 1YTZI 5KLIC 2OGUA 3HD7C 3AEFC 2OYHC 4D6TD 4ZMDA 1KFMA 3C9IA 3SSUA 3V4WA 3VP9A 4HKZH 2X2BA 1GW3A 2VRSA 1M1JC 2XZRA 2HYNA 3ZDMA 1JTHB 1SQBJ 2FXOA 1RNIA 4A7PA 3R2PA 2WT7B 3HZQA 3L35A 1E0HA 3LMOA 5KKZC
chains in the Genus database with same CATH topology
1YI2P 2OTLP 2PEKA 1N8RQ 2JO0A 3LRYA 2CWOA 1BAJA 4XFZA 2BHVA 1KQSO 4COPA 3G28A 1YHQP 2BQ1E 2QA4P 1E6JP 3G0VA 1JJ2O 3DPHA 1RO0A 3H0DA 5F2NA 1VQ7P 4U0BA 3H4EA 3DTJA 3VRLC 2PY8A 3CCMP 1Q81Q 2Z45A 1VQ8P 2PEQA 3CCLP 2PEOA 3CCUP 3DS3A 3CMAP 3I55P 1PEMA 1W2BO 3DS4A 3CCRP 1QRJA 2L6EA 2XXMA 3CC2P 3G71P 4XROA 4XRQA 2Z44A 3CC7P 1M6NA 2JYLA 1VQ9P 1EOQA 2E1MA 2EG5A 3G6EP 1YITP 4GR2A 1PEQA 1YIJP 3G1GA 3WBHA 4PH1A 5HGNA 5HGOA 2XV6A 4U0CA 1PEOA 3H47A 4U0EA 3M1MA 1K30A 3CD6P 2PEIA 2XT1A 3E2DA 3I56P 3MGEA 3G29A 2JYGA 2Z46A 1K73Q 1A43A 3CCVP 1A8OA 1M90Q 5HGLA 4XFXA 1M74A 3G1IA 2M8LA 4XFYA 1VQOP 1S72P 5JPAA 1D1DA 3P05A 1VQ5P 4QNBA 1KD1Q 1VQ4P 3RG6C 3CCJP 4U0AA 1Q82Q 2QEXP 5F2KA 2M8PA 1M6EX 1YJ9P 3CCSP 2BUOA 4U0FA 2PENA 1VQMP 1EIAA 3CMEP 1PEUA 3NTEA 2PEMA 4WYMA 3DS5A 4IPYA 3CCQP 1QVGO 2PEJA 4GR6A 1VQKP 1QVFO 2EFJA 3G21A 2P9XA 3CXCO 3DS1A 3Q20A 4COCA 4PH0A 2ONTA 5I4TG 3HYBA 5BS1A 3CPWO 3CC4P 3G26A 1VQ6P 5HGMA 3CCEP 1ZMBA 2OARA 1Q86Q 1M1KQ 1NJIQ 1VQPP 1VQNP 1RNIA 4M0IA 1YJNP 2M8NA 1K9MQ 3G4SP 2DGYA 3B5IA 2EIAA 1Q7YQ 5DCKA 2KODA 1YJWP 1RO2A 3DS2A 3HZQA 1VQLP 2OTJP 5BS2A 1K8AQ 1IUQA 1KC8Q 1AUMA 4U0DA 5F2OA 2LF4A 3OW2O 3DS0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CMA P;  1YI2 P;  3CCV P;  1K73 Q;  2OTL P;  3I55 P;  1N8R Q;  1M90 Q;  3CXC O;  1W2B O;  3CCR P;  1VQ9 P;  3CC2 P;  3G71 P;  1VQO P;  1S72 P;  3CPW O;  1KQS O;  3CC4 P;  1VQN P;  1VQ6 P;  1VQ5 P;  3CC7 P;  1KD1 Q;  1VQ4 P;  3CCJ P;  1YHQ P;  1Q86 Q;  1M1K Q;  3G6E P;  1NJI Q;  1VQP P;  2QEX P;  1YIT P;  1Q82 Q;  1VQK P;  2QA4 P;  1YJN P;  1YIJ P;  1K9M Q;  3G4S P;  1YJ9 P;  3CCS P;  1Q7Y Q;  1JJ2 O;  3CCE P;  1YJW P;  1VQL P;  2OTJ P;  1VQM P;  3CME P;  1VQ7 P;  1K8A Q;  3CD6 P;  3CCQ P;  1QVF O;  1KC8 Q;  3CCM P;  1Q81 Q;  1QVG O;  3I56 P;  1VQ8 P;  3CCL P;  3OW2 O;  3CCU P; 
#chains in the Genus database with same CATH topology
 3LRY A;  2FYN C;  5KAI H;  5GTI H;  4COP A;  1YQ4 C;  4N78 E;  1E6J P;  1T8K A;  1NTK E;  1VHN A;  4IZ6 A;  2K88 A;  3IN6 A;  4PD4 H;  1ZR2 A;  2FKW B;  3L36 A;  1EXJ A;  3L74 J;  1KYO H;  2AFD A;  1L0L K;  1PEM A;  2QVA A;  1SQX G;  4Y99 C;  1NTM K;  1SQB E;  5KJ7 A;  1Y47 A;  4JBZ A;  2Y0D A;  3GHG A;  2FHS C;  2QJK C;  2E76 D;  2E42 A;  3AEE C;  4XA4 A;  3BCC E;  3OAK A;  4PV1 C;  1LTT C;  1M74 A;  2M8L A;  1FZB A;  1PP9 D;  3L73 G;  5JPA A;  3P05 A;  3RL0 B;  5KAF H;  5AW4 B;  5KLV K;  5M1B A;  2Q7C A;  2RMZ A;  1YBK A;  2AEJ A;  3Q2Y A;  1PPJ D;  3Q3D A;  2A45 G;  1NOH A;  4QKO A;  2BUO A;  3GHG B;  2WSE H;  1PEU A;  2KWL A;  1DH3 A;  3LW5 H;  3L74 E;  3TYY A;  1UIX A;  3G3Z A;  4DJG A;  1RE3 A;  3L71 E;  1BE3 G;  2G8Y A;  3PHL A;  4F37 A;  3Q20 A;  1AF8 A;  3H6P A;  2JKV A;  2SPZ A;  5C39 A;  1VQ6 P;  1VQN P;  2W6B A;  2DW3 A;  3TGU J;  1VQL P;  1L0L D;  2R5D A;  1VDF A;  4EYY Q;  4DG9 A;  1BCC E;  1L4A A;  3MZW B;  3B5N A;  3H1L E;  1Z6M A;  2L0Q A;  2WSF J;  2P58 A;  1FS0 E;  2IBZ E;  1ZRT D;  2KYV A;  2KOG A;  3H1H E;  4D6T G;  1GXH A;  3G0V A;  4HH2 A;  3VRL C;  4L73 A;  1SFC C;  1OW8 A;  1GL2 B;  5KLV D;  1L4A B;  3B5N B;  2RKL A;  3AE3 C;  3CC7 P;  1VQ9 P;  3TNU A;  4XE5 B;  1EDI A;  2A06 E;  3RK3 C;  3RK3 D;  5BU8 B;  1FZF A;  2W6A A;  2E5Y A;  3MGE A;  1A43 A;  1BDD A;  2DNW A;  2E43 A;  4U0A A;  4PXH B;  1HF9 A;  3S4R A;  3EWK A;  2IZ0 A;  2BCC D;  2LIW A;  3TNU B;  3M06 A;  4IL6 H;  1VQM P;  2CK3 H;  3CWB D;  3CME P;  3L70 E;  5CJ4 A;  1USD A;  1JY3 P;  5AVS B;  1QVG O;  1MFZ A;  3MUD C;  2J58 A;  1PV3 A;  3IF4 A;  4OWF A;  1PL5 A;  3CXC O;  4PH0 A;  1UNK A;  4C7R A;  3P7K A;  2M8N A;  3G4S P;  3FWL A;  1YTZ T;  1NTZ J;  1K8A Q;  3F89 A;  4ZKP A;  1S5L X;  5F2O A;  3M0A A;  3MTU E;  1KQL A;  3H1I G;  3IR9 A;  5E79 H;  2E75 D;  1PZQ A;  2QM8 A;  2KXP B;  1AJY A;  2LKI A;  1ZW0 A;  1KIL A;  1LWU C;  1Q90 D;  1WMK A;  1NYH A;  1NAY A;  3CL3 D;  2XKM A;  4EDF A;  1AQ5 A;  2LXB A;  3G71 P;  3LIE A;  3CX5 I;  1SQP K;  1ZP0 C;  2JU1 A;  2JYL A;  3G6E P;  1OX3 A;  5CJ0 A;  1LTG C;  4IFD K;  1EC5 A;  4ZNC A;  1NGM B;  1KTM A;  3U43 A;  5KAI E;  5GTI E;  1EZV I;  4JYC A;  4WY4 A;  3CCV P;  1KIL B;  1X9V A;  4PD4 E;  2WSE J;  2KG8 A;  3KXD A;  1KYO E;  4I7Z C;  4IFF A;  1RF0 A;  2GM4 A;  4MN4 C;  3GMA A;  1OVR A;  1KQG B;  2L9F A;  3Q5R A;  3KHU A;  4Z1M H;  2LPK A;  4WY4 B;  2ONT A;  1GK6 A;  1NH4 A;  3BCC G;  3D6Z A;  2W90 A;  5HGM A;  1RF1 C;  3H1K E;  1M8O B;  4N3Y B;  3VMY A;  1OXZ A;  5DCK A;  1SQX J;  1JY2 P;  5CCG C;  5KAF E;  4U0D A;  1SQP D;  1X8Y A;  3RK2 B;  3VN0 A;  3MHV A;  2MR7 A;  3ABV C;  4H44 C;  3RBX A;  4QMA A;  1OVV A;  2WPV B;  2OTK E;  1AFO A;  3L71 G;  3D70 A;  2KOO A;  1IFM A;  3RL0 C;  4I1L A;  4PWV B;  2FQ2 A;  1CW5 A;  5KJ7 C;  4AUW A;  3B71 A;  2OYI C;  1QRJ A;  2B87 A;  2GDY A;  4YTP C;  1L0N D;  2E76 B;  1VL2 A;  1BCC G;  4LGD E;  4TT3 H;  5BU5 A;  1EDK A;  3H1L G;  1ZNV A;  1JCD A;  2JDI H;  2E1M A;  3WMM 0;  3M9B A;  1FZC C;  1PGJ A;  2VLQ A;  1T3J A;  3GKL C;  3N7N A;  4I2L C;  1SQX K;  1G2C A;  4H13 D;  5CZD B;  5AW8 B;  1KZU B;  2K94 A;  3H1H G;  3VP8 A;  3RL0 g;  4L74 A;  4OGQ B;  1NO4 A;  4XFY A;  1YYC A;  1N73 C;  1D1D A;  3D6Y A;  1DIP A;  3A7O A;  4L76 A;  3T97 A;  1RE3 C;  3LID A;  4NEO A;  2YMY A;  3U1C A;  2FYU J;  3PLN A;  3L75 J;  3A2A A;  2KGD A;  2IYO A;  3B4Q A;  5H2F H;  2WQY C;  1BXI A;  2M3B A;  1LTI C;  1JCC A;  2FFD A;  1J1E C;  1GL2 C;  1IC2 A;  1YJN P;  4M0I A;  3WUU A;  2FAD A;  1LT9 A;  3T97 B;  4DT0 A;  2KOD A;  1Y9B A;  1UJZ A;  1EQ7 A;  3L72 D;  2VLN A;  5AVV B;  5APW A;  1LTJ B;  2JWA A;  2WMM A;  4IL6 E;  2KOP A;  3IFM A;  3GF7 A;  4HKG A;  3HUS A;  2Y9Y A;  2FFD B;  3L75 E;  2KNC A;  1JJ2 O;  2E74 B;  1LNQ A;  1LT9 B;  2W27 A;  1KIL E;  5CHX A;  2FAC A;  2FVE A;  3CCL P;  4ASV A;  4GIF A;  1S5L H;  1K04 A;  2XND H;  4HJG H;  3EJB A;  3L73 D;  3HUS B;  1UII A;  2QJY B;  5E79 E;  3E2D A;  3JSV C;  1LTB C;  5AW1 B;  1IZN B;  4IFM A;  1E5W A;  4UB6 H;  1VQ5 P;  2KUB A;  1N2D C;  1MZ9 A;  2D2C C;  3MIW A;  2N9Y B;  2D2C D;  2ZYD A;  2XZ1 C;  1AVO A;  1PP9 J;  2B9B A;  1P84 D;  1BSH A;  1Y8A A;  3NTE A;  1MKM A;  5BVZ A;  1FZE A;  4H0L D;  3A3Y B;  1L0N G;  2MJZ A;  1PIX A;  5APT A;  5CCH A;  1Z56 A;  4COC A;  1ZV8 A;  3O6Q A;  3CCE P;  2OAR A;  3V5B A;  5TIS H;  1NAF A;  3CXH D;  2DGY A;  3NY7 B;  4HYT B;  2E75 B;  2OTJ P;  3HD7 D;  1CI6 A;  1AUM A;  1KB9 I;  3DS0 A;  2KZI A;  2YIU B;  2A45 I;  4WB4 A;  3EJD A;  2OTL P;  1L0L J;  1TU3 F;  3H1J E;  2JO0 A;  4XFZ A;  2M3E A;  1NTM J;  1GPJ A;  4U3F J;  1QEX A;  1KIL C;  3VYI A;  1FOS F;  1PP9 E;  1GTW A;  3O6Q B;  1GU4 A;  1VF5 C;  1NU1 D;  1VF5 D;  3DTJ A;  1PPJ E;  3H1K G;  3CCM P;  1KFN A;  3PJS K;  2NPS C;  3F5H A;  1NVO A;  2C0X A;  2NPS D;  1CI6 B;  3A0H H;  2KOQ A;  1IMQ A;  4BPF A;  1SQV D;  2I8D A;  4NPE A;  5KLV J;  1YIT P;  4YXD C;  2PNG A;  2K9Y A;  3G1G A;  3L72 G;  2KP8 A;  3Q5P A;  4GOF A;  1HWT C;  2FQ1 A;  2R32 A;  2H89 C;  3GW6 A;  3HE4 A;  1M90 Q;  2ZVN B;  3SWF A;  3KQG A;  1NTM E;  1GDT A;  4U3F E;  1HJ0 A;  1KN7 A;  1QX8 A;  1HBW A;  1NKN A;  3M0D A;  1T2K C;  1BGY D;  2LIU A;  2AXT H;  2PGD A;  1VQK P;  1QVF O;  1EXI A;  2BCC J;  2YO3 A;  1JM0 A;  1SQQ D;  4K3A A;  1CEI A;  3W67 A;  3CWB J;  1N7S A;  4PV1 D;  3HE4 B;  1FDI A;  2KR5 A;  3H1I D;  2WSS H;  2QJP B;  5AVZ B;  1AVY A;  2N50 A;  1OZH A;  2WPT A;  2Q3E A;  4C46 A;  2MKV A;  5B66 H;  3NTN A;  3M9Q A;  1QL1 A;  3GF3 A;  2Y0C A;  4CPG A;  3H25 A;  1IFJ A;  2KGA A;  3AE9 C;  5APS A;  1J1D C;  3CE7 A;  2WIT A;  1QL2 A;  1N7S B;  5H2F E;  2N1T A;  3NMD A;  1SP4 A;  5AW7 B;  2FBW C;  3IAO A;  1XTG B;  4JQ0 D;  5F2N A;  2K1A A;  1JUN A;  1VQ8 P;  1JNM A;  3CMA P;  1RE4 A;  2Z5H A;  1RH5 B;  2WZ7 A;  4N78 D;  1NTK D;  4XRO A;  3MGN A;  1L0I A;  2NO8 A;  1FJK A;  3CX5 E;  3GZL A;  2K0Y A;  3B8E B;  2N1T B;  1DD4 A;  3CD6 P;  2PEI A;  4LC1 A;  3R4Y A;  3I56 P;  3AE6 C;  1SFC D;  1RY3 A;  5AVU B;  3A5T A;  1WT6 A;  2JYG A;  1DEB A;  1SQB D;  1EZV E;  1IFP A;  1OWA A;  1VQ4 P;  3RG6 C;  1G1I A;  3CCJ P;  1LTJ C;  2KI7 B;  1S3J A;  3BCC D;  5KTB A;  1KB9 H;  3TGU E;  1NU1 G;  1S5L E;  2A45 H;  2Y9Z A;  2RN0 A;  5DJT B;  2KZJ A;  2K9J A;  3FGA D;  3AE5 C;  2KOS A;  1SQV G;  3CLQ A;  3P8M C;  4Y28 J;  1H8A A;  3CC4 P;  1EDL A;  1Q86 Q;  1M1K Q;  1XTC C;  1FC2 C;  2HLO A;  1Q7Y Q;  3L71 D;  2KGE A;  1PGP A;  4UB6 E;  1KC8 Q;  2JGP A;  2Z4E A;  2ZVO B;  2N5I A;  2K9J B;  4MRT C;  2R5B A;  5GTH H;  1SQP J;  2UWJ E;  2BAS A;  3GJN A;  4EIJ A;  1BGY G;  2KB7 P;  2K37 A;  1BCC D;  3H1L D;  1HY8 A;  1URQ A;  1SQQ G;  2C9N Y;  2PEQ A;  2I1K A;  5TIS E;  5AW6 B;  2ZT9 B;  2IBZ D;  3CCR P;  3H1H D;  5EW5 E;  3CC2 P;  3SWY A;  2Z44 A;  2LTE A;  2FVF A;  1OMI A;  5EJD A;  1YIJ P;  3H1J G;  2ERH A;  1L0N J;  5L8R J;  2KSE A;  2QE7 H;  2Q9I A;  1URQ B;  3GZM A;  1K73 Q;  1S1C X;  2OYH A;  2A06 D;  4H2X C;  2YIU C;  1K05 A;  2L22 A;  3P8C E;  3U1A A;  4H0L B;  2H88 C;  3A0H E;  1JB0 J;  4ASW A;  2PEN A;  1M1J A;  1NTZ E;  1EIA A;  1HH0 A;  1Q2N A;  3DS5 A;  2WPQ A;  2C0W A;  2MVV A;  1HQB A;  2W83 C;  1PFI A;  1NTK G;  1S9K E;  3TK1 A;  3CPW O;  3V6I A;  2OYH B;  3L70 D;  1IMP A;  4JPZ B;  2N6Y A;  1W2E A;  1L0N K;  3TSI A;  1R8E A;  1IUQ A;  1SQB G;  2HPC A;  1M1J B;  1AV1 A;  2NZ2 A;  3W68 A;  3OW2 O;  1N8R Q;  3L72 J;  1X22 A;  1DNY A;  2ZAE B;  2AXT E;  2I1J A;  2HOD A;  1X0T A;  3SFD C;  1JY3 O;  2GUS A;  1AQT A;  1DD3 A;  5CBN A;  3H0D A;  1M57 D;  1USE A;  2QG4 A;  4NPF X;  2FYN B;  2MD9 A;  1KQF B;  3AE4 C;  3M9H A;  5CCG D;  3CCU P;  3HTK A;  2EHT A;  1OVU A;  5KP7 B;  2HPC B;  5B66 E;  4I6M C;  1RQV A;  2R3C A;  3WUT A;  5AVY B;  2IPP A;  3L74 G;  2OQQ A;  2PFX A;  3AED C;  1M6N A;  4H44 D;  2K93 A;  4AQR D;  3N4X A;  2JU2 A;  2QJP C;  2HOD B;  1PGQ A;  4Y99 B;  4O9B A;  3RL0 D;  1FDO A;  3L73 J;  3M91 A;  5KJ7 D;  2PAJ A;  2WWW A;  2KOR A;  3GHG C;  3M0D C;  3HTK B;  2QJK B;  2YKO A;  1FE6 A;  2ZXE B;  2ZYA A;  1KD1 Q;  1H89 A;  5APY A;  4BRY A;  1LGH B;  3FX0 A;  1LJ2 A;  1ZOY C;  2GUV A;  1SQX E;  1EDJ A;  1BE3 J;  2V7Q H;  1E79 H;  3RG2 A;  4WYM A;  3WU2 H;  1FU1 A;  4PD4 D;  2IBZ G;  1OW7 A;  3KDP B;  1N86 A;  3G21 A;  4XFJ A;  3KYQ A;  4YXW H;  2GZE A;  1KYO D;  3GG2 A;  3TF5 A;  1EZV G;  2B87 B;  2MR8 A;  1GU5 A;  2K5X A;  4GOD A;  1IO4 A;  2N9B A;  2L91 A;  4BRY B;  2N98 A;  3PH0 A;  2AF8 A;  3L73 E;  4W80 A;  3AEA C;  4TLF A;  4B86 A;  3TGU G;  1G2C B;  3Q1M A;  4L75 A;  1KB9 E;  2A06 G;  3H1K D;  1RQU A;  4D6T J;  2JEE A;  3UIA A;  1U7J A;  1SFC A;  2WSC J;  3USS A;  1GL2 D;  1SLQ A;  3OA7 A;  1L4A C;  4BPG A;  2AEM A;  3B5N C;  1L4A D;  2MF4 A;  1BE3 E;  1YQ3 C;  1IJD B;  4U0B A;  3H4E A;  2KSJ A;  2Y0E A;  4UB8 H;  2PEO A;  5EFW B;  2L5G B;  3VMZ A;  3L70 G;  3O8Z A;  1EMV A;  2EG5 A;  5AVR B;  1JY2 O;  2FYU E;  4R0M A;  4GDO A;  2P1J A;  1SQV J;  5KP6 B;  4U0E A;  1X79 B;  2YXQ B;  5GTH E;  1FAV A;  2XT1 A;  5CMZ A;  3PP5 A;  3BVH A;  4D6T E;  1A8O A;  5HGL A;  4JYB A;  4XFX A;  1BDC A;  2GZG A;  1OFC X;  3RK3 B;  3MUD A;  4QNB A;  5AW0 B;  1HGV A;  3S1K A;  5AVT B;  3JCU H;  2PEM A;  2B89 A;  2KNC B;  4HB1 A;  4GR6 A;  3BAT A;  1HJB A;  1LTA C;  2CQ8 A;  1NU1 K;  2AFE A;  2IDB A;  4GKG A;  1HVV A;  1ZME C;  2ZT9 C;  1NJI Q;  1S4X A;  1K9M Q;  4WWI A;  3H1I J;  2FXM A;  2JAZ A;  1SQV K;  3C1L A;  1GZL A;  2FAE A;  2GDW A;  2O1J A;  2ZJS E;  2QSI A;  1NTZ G;  3AEG C;  3EJE A;  1BSN A;  1OIP A;  4GT1 A;  1GD2 E;  2K0D X;  1GK4 A;  1URQ C;  5B5E H;  1LWU A;  1SS1 A;  2FQ0 A;  2MVU A;  2BQ1 E;  3SFE C;  3PTZ A;  2O3J A;  2VSQ A;  2K92 A;  1JEK A;  1QLE D;  5AW5 B;  1IFI A;  3AEB C;  2WVR A;  1PGO A;  1S2E A;  3L75 D;  2H8P D;  1KV4 A;  3VTP C;  1SQQ K;  1EOQ A;  1M56 D;  1MUU A;  2ITA A;  1JMM A;  2IYP A;  1KIL D;  1LWU B;  5HGN A;  2XV6 A;  5HV8 A;  1NTK J;  4DOJ A;  1PEO A;  2KLU A;  2K3R A;  1DEE G;  1P84 I;  4CA3 A;  1HGZ A;  3P32 A;  2C9L Y;  3G1I A;  2IZ1 A;  3VOP A;  2H43 A;  2V7Q J;  3V2Q A;  1F80 D;  1CSB A;  5F2K A;  4RKU J;  2JO1 A;  4WY4 C;  4WY4 D;  3CXH I;  4BPH A;  1RF1 A;  4WBA A;  1LT1 A;  3BCC J;  2QM7 A;  2PEJ A;  1L0L E;  4LLH A;  4N6J A;  2P9X A;  2KLV A;  2Q6Q A;  3FXD A;  4I7Z B;  1RF0 C;  2YMK A;  5CCG A;  4PJ0 H;  3SWK A;  3G26 A;  1ZMB A;  3RK2 C;  1R5L A;  3RK2 D;  3A0B H;  2LKM A;  4EOT A;  1NTK K;  1RO2 A;  1T2K D;  1ZRT E;  2LF4 A;  1RF1 B;  3V2R A;  3L71 J;  3V2P A;  3GLM A;  2O01 N;  3WU2 E;  5KLV E;  1SQB K;  1YHQ P;  1T6A A;  2W8Z A;  2OYI A;  3WUV A;  2JWD A;  1NWQ A;  2E76 C;  1RO0 A;  3H1J D;  3V2N A;  4H44 B;  2Z45 A;  5APX A;  1FZC A;  1BCC J;  2HG5 D;  4U7J A;  3H1L J;  3DS3 A;  5K5G B;  2B88 A;  3RK3 E;  1A02 F;  4OVN F;  1L0H A;  2LXC B;  1KLP A;  2CPS A;  1ZLL A;  3EFF K;  3TDK A;  2J59 M;  1FBM A;  4XRQ A;  3BAS A;  3CI9 A;  4OGQ C;  3H1H J;  1FJP A;  4OGQ D;  3RGU A;  1N73 A;  2FXP A;  2OYI B;  3M1M A;  5HVC A;  4JF7 A;  4KJM A;  1GMJ A;  2BCC E;  3E7K A;  1HTL C;  1MV8 A;  1IK9 A;  3S9O A;  2O01 J;  3CWB E;  1FZC B;  2GDX A;  2Q5U A;  1ZR4 A;  4OH8 B;  4H13 B;  2KW2 A;  4UB8 E;  2M8P A;  2QRX A;  1WRG A;  2P10 A;  2JR8 A;  1GL2 A;  3U59 A;  1GXG A;  4IPY A;  2QNW A;  1N73 B;  1NTM D;  3E1R A;  2FYU G;  4U3F D;  4IOI H;  3L75 G;  3VMX A;  1ZXG A;  3HYB A;  5BS1 A;  3Q5S A;  3AE1 C;  1VQP P;  2M0B A;  2WPS A;  2CG5 B;  2JBG A;  5AVX B;  1AYI A;  2H7H A;  3L70 J;  2XDJ A;  2FFD C;  1J1E B;  1KMI Z;  2E74 C;  1YI2 P;  2AXC A;  2E74 D;  2PEK A;  2CWO A;  1LT9 C;  3MP7 B;  2LR2 A;  3JCU E;  1KQS O;  1SVF A;  4H2W C;  2OYO A;  3L4F A;  1P84 H;  3L74 D;  4BXL A;  4DZO A;  3DPH A;  4BWN A;  2K0X A;  4RJT A;  2GZF A;  3HUS C;  2EHS A;  2O1K A;  2QJY C;  3KZI H;  2M5A A;  3I55 P;  1T8Z A;  2YXR B;  5TJH A;  3CXH H;  3VMA A;  2VLO A;  1AA0 A;  4WVZ A;  1JY3 N;  5HGO A;  4U0C A;  1VKU A;  2YO2 A;  4ZKU A;  5AW9 B;  5B5E E;  2WSC H;  2POH A;  1N7L A;  1IFN A;  2E5T A;  3G29 A;  3CX5 D;  2Z46 A;  1FDM A;  3H32 A;  3HRN A;  2M5A B;  3K5B A;  5DJU B;  2P67 A;  1FOS E;  3CCS P;  2BEZ F;  2LL8 A;  1EZV D;  3FWN A;  3V4Q A;  1VPC A;  1PP9 G;  3G9R A;  2EFJ A;  2D2C B;  2E75 C;  3HD7 A;  2YNY A;  1OW6 A;  3TGU D;  1PPJ G;  1SQP E;  3H32 B;  2WTY A;  2JQ4 A;  1MZ8 A;  1H88 A;  1IFD A;  3RBZ A;  2EIA A;  1ZN5 A;  3DS2 A;  5CCH C;  5CCH D;  2XZ0 D;  2AEF A;  5AVQ B;  3AE7 C;  1W5C E;  2LOL A;  1ACP A;  4YPC A;  4K35 A;  3AE8 C;  1BAJ A;  1JMB A;  1A02 J;  5KLI B;  2RH0 A;  3HD7 B;  2HR3 A;  2IBZ I;  3KPE A;  2NPS A;  3H1K J;  1L0L G;  1FZG A;  2Q3I A;  2KGC A;  1L0N E;  3B4S A;  1NTM G;  1NTZ K;  4U3F G;  2PP6 A;  4PJ0 E;  2VLP A;  2GA1 A;  2ZFC A;  2HFE D;  2GZI A;  2P7J A;  5AW3 B;  3A0B E;  3DS4 A;  2G3A A;  2L6E A;  2FYZ A;  3LW5 J;  1VF5 B;  2L4B A;  1LP1 A;  4GR2 A;  1PEQ A;  2WPR A;  2J5U A;  3E1I A;  1U7M A;  2NPS B;  5KKZ B;  1U57 A;  1OR5 A;  1K30 A;  3OJA B;  5KLV G;  2K2Q A;  2N6Z A;  2GYK A;  2JP3 A;  1HUC A;  1RHZ B;  1DX7 A;  1NHL A;  3FXE A;  3EQ2 A;  5APU A;  1VQO P;  4DCK A;  2YKQ A;  1L2P A;  4KHX A;  2ZYG A;  1JY2 N;  1M6E X;  1YJ9 P;  2LML A;  1FZA A;  1LP1 B;  1D7M A;  4U0F A;  2KS1 A;  2IFN A;  1KOR A;  1T3U A;  2JB0 A;  2N5H A;  2XNX A;  3P8C D;  3DS1 A;  3L72 E;  4W7Y A;  5I4T G;  2BCC G;  1NTZ D;  1JO5 A;  3CWB G;  1JOC A;  3B5I A;  5AW2 B;  1N7S C;  2MY5 A;  4PV1 B;  1NQ4 A;  5BS2 A;  1M7L A;  1N7S D;  1S9K D;  2Q1K A;  2R44 A;  2KS1 B;  4W7Z A;  5APQ A;  1J2J B;  5KP8 B;  4EI2 A;  2ROQ A;  2BHV A;  1GW4 A;  2P2U A;  3AE2 C;  4M3L A;  2QA4 P;  1NKZ B;  1J1D B;  1MFT A;  3BRV B;  1VQ7 P;  4H13 C;  5APV A;  2IX7 C;  2FY8 A;  4UHP B;  2N1T C;  2N1T D;  1H0T A;  1W2B O;  2M8R A;  3HE5 A;  1X3O A;  2KK7 A;  1DV5 A;  2AVA A;  3WBH A;  1RE4 C;  3H47 A;  3B5N D;  2CPB A;  1LTJ A;  4GOE A;  4R4M A;  1IK7 A;  1P84 E;  3C8V A;  4PD4 I;  1NU1 J;  5CBO A;  1H0T B;  1KYO I;  2YKP A;  3HE5 B;  1SFC B;  5AVW B;  3KZI E;  3BRT B;  1QGK B;  3NFQ A;  3CX5 H;  3CCQ P;  3CXH E;  2R3S A;  3NXS A;  4RO0 A;  3EFG A;  3AEC C;  2QIW A;  2V4H A;  1SQX D;  2XU6 A;  2FVA A;  2O01 H;  2FYU K;  1YJW P;  3I5C A;  2GZJ A;  4AYC A;  1R5S A;  7CEI A;  1G1J A;  1CZQ A;  3D71 A;  1BGY J;  4R4L A;  1NU1 E;  4NPD A;  2M5R A;  3MD0 A;  3PRJ A;  4H2Y C;  2NRG A;  3G28 A;  1SQQ J;  3QH9 A;  2Z5I A;  2JJL A;  2ZT9 D;  3L37 A;  1SQV E;  2WSF H;  1SQP G;  1KB9 D;  2XV5 A;  2PY8 A;  1Q81 Q;  4C7N A;  2KG9 A;  2CNR A;  3H1J J;  2KG6 A;  2XXM A;  2BEQ D;  2PRR A;  3II6 A;  1BE3 D;  2CGQ A;  2ZXX A;  1URQ D;  2W6J H;  4IL6 X;  4PH1 A;  3QWO C;  3JC2 2;  4H0L C;  2KIK A;  2IFM A;  1BGY E;  4KT0 J;  4RES B;  1FR2 A;  4C7N B;  1JTH A;  2FYU D;  1S72 P;  1LTS C;  3ITK A;  1SQQ E;  1Q82 Q;  2QEX P;  2WT7 A;  3H1I E;  1YTZ I;  5KLI C;  2OGU A;  3HD7 C;  3AEF C;  2OYH C;  4D6T D;  4ZMD A;  1KFM A;  3C9I A;  3SSU A;  3V4W A;  3VP9 A;  4HKZ H;  2X2B A;  1GW3 A;  2VRS A;  1M1J C;  2XZR A;  2HYN A;  3ZDM A;  1JTH B;  1SQB J;  2FXO A;  1RNI A;  4A7P A;  3R2P A;  2WT7 B;  3HZQ A;  3L35 A;  1E0H A;  3LMO A;  5KKZ C; 
#chains in the Genus database with same CATH homology
 1YI2 P;  2OTL P;  2PEK A;  1N8R Q;  2JO0 A;  3LRY A;  2CWO A;  1BAJ A;  4XFZ A;  2BHV A;  1KQS O;  4COP A;  3G28 A;  1YHQ P;  2BQ1 E;  2QA4 P;  1E6J P;  3G0V A;  1JJ2 O;  3DPH A;  1RO0 A;  3H0D A;  5F2N A;  1VQ7 P;  4U0B A;  3H4E A;  3DTJ A;  3VRL C;  2PY8 A;  3CCM P;  1Q81 Q;  2Z45 A;  1VQ8 P;  2PEQ A;  3CCL P;  2PEO A;  3CCU P;  3DS3 A;  3CMA P;  3I55 P;  1PEM A;  1W2B O;  3DS4 A;  3CCR P;  1QRJ A;  2L6E A;  2XXM A;  3CC2 P;  3G71 P;  4XRO A;  4XRQ A;  2Z44 A;  3CC7 P;  1M6N A;  2JYL A;  1VQ9 P;  1EOQ A;  2E1M A;  2EG5 A;  3G6E P;  1YIT P;  4GR2 A;  1PEQ A;  1YIJ P;  3G1G A;  3WBH A;  4PH1 A;  5HGN A;  5HGO A;  2XV6 A;  4U0C A;  1PEO A;  3H47 A;  4U0E A;  3M1M A;  1K30 A;  3CD6 P;  2PEI A;  2XT1 A;  3E2D A;  3I56 P;  3MGE A;  3G29 A;  2JYG A;  2Z46 A;  1K73 Q;  1A43 A;  3CCV P;  1A8O A;  1M90 Q;  5HGL A;  4XFX A;  1M74 A;  3G1I A;  2M8L A;  4XFY A;  1VQO P;  1S72 P;  5JPA A;  1D1D A;  3P05 A;  1VQ5 P;  4QNB A;  1KD1 Q;  1VQ4 P;  3RG6 C;  3CCJ P;  4U0A A;  1Q82 Q;  2QEX P;  5F2K A;  2M8P A;  1M6E X;  1YJ9 P;  3CCS P;  2BUO A;  4U0F A;  2PEN A;  1VQM P;  1EIA A;  3CME P;  1PEU A;  3NTE A;  2PEM A;  4WYM A;  3DS5 A;  4IPY A;  3CCQ P;  1QVG O;  2PEJ A;  4GR6 A;  1VQK P;  1QVF O;  2EFJ A;  3G21 A;  2P9X A;  3CXC O;  3DS1 A;  3Q20 A;  4COC A;  4PH0 A;  2ONT A;  5I4T G;  3HYB A;  5BS1 A;  3CPW O;  3CC4 P;  3G26 A;  1VQ6 P;  5HGM A;  3CCE P;  1ZMB A;  2OAR A;  1Q86 Q;  1M1K Q;  1NJI Q;  1VQP P;  1VQN P;  1RNI A;  4M0I A;  1YJN P;  2M8N A;  1K9M Q;  3G4S P;  2DGY A;  3B5I A;  2EIA A;  1Q7Y Q;  5DCK A;  2KOD A;  1YJW P;  1RO2 A;  3DS2 A;  3HZQ A;  1VQL P;  2OTJ P;  5BS2 A;  1K8A Q;  1IUQ A;  1KC8 Q;  1AUM A;  4U0D A;  5F2O A;  2LF4 A;  3OW2 O;  3DS0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...