3CCSP

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2482a
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
total genus 45
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3ccsP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 3ccsP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 3ccsP02
1QVGO 1VQ4P 1VQKP 1S72P 3CD6P 2OTJP 1KC8Q 2QA4P 2OTLP 3CMAP 1K73Q 1VQMP 3CC7P 1W2BO 1YJWP 1M1KQ 1JJ2O 3CCRP 1YHQP 1YJ9P 1VQ8P 3I55P 1K8AQ 3CCLP 3CC4P 3CXCO 3CCQP 1YI2P 3G6EP 1YITP 3OW2O 1YIJP 1VQLP 1Q82Q 1KD1Q 3G71P 3CCMP 1Q81Q 1Q7YQ 3G4SP 1NJIQ 1K9MQ 1M90Q 1KQSO 1VQOP 1VQ9P 1YJNP 1VQ7P 3I56P 1VQ5P 1VQNP 1VQPP 3CCEP 2QEXP 3CCVP 3CC2P 3CCJP 1QVFO 3CCUP 1Q86Q 1VQ6P 1N8RQ 3CCSP 3CPWO 3CMEP
chains in the Genus database with same CATH superfamily
2LF4A 3AEGC 1KYOE 1OVRA 5GTHE 2KLUA 4WY4A 2VLOA 1LP1A 5APUA 3NMDA 2PGDA 2NO8A 5AW6B 2K9YA 1ZNVA 2B89A 2R5BA 1LWUB 1QVFO 3RK3C 1Q86Q 2XV6A 3O8ZA 1KILB 3MP7B 1IUQA 3AEBC 3V4WA 1RE4C 2QJPB 1KFNA 4HB1A 3BCCE 1IFNA 3H1KD 3E1RA 3TGUG 5HGMA 2E75B 1SQQD 5KAFH 1GU5A 1RH5B 4H44D 5KJ7C 1KZUB 3LIEA 1PPJE 2YKOA 1T8ZA 3CCUP 5AVSB 1IC2A 1X9VA 4GR6A 1PIXA 1OR5A 4GODA 1NGMB 3CC7P 2A45H 1NTKK 1R8EA 2C9NY 1EZVE 2JR8A 3HUSA 1RHZB 1JY2P 2FQ2A 1LTTC 1VQ6P 4D6TE 2NPSB 4XFJA 2XDJA 3FX0A 1GDTA 5KJ7D 5BS1A 2H43A 2P9XA 1VQ8P 1MZ8A 1YYCA 3L75G 1KYOI 4PV1B 4WB4A 1BDDA 4Y99B 5CCHA 1LTGC 4U3FD 3VRLC 2L4BA 5EW5E 1N8RQ 2YNYA 1JY3O 2MD9A 2YXQB 4IFDK 3CD6P 3W67A 4YTPC 3M0DA 2KYVA 2KIKA 1G1JA 1FZFA 3B5IA 2PEMA 1L0HA 2HPCB 1SQQG 4U0EA 3HUSC 2I1KA 1IMPA 1VKUA 3H1KG 2ITAA 3CLQA 1NTMJ 2KG8A 2ZT9C 5AVRB 4YPCA 3SWKA 1PPJD 2RMZA 3C8VA 2FAEA 3T97B 1M6EX 2BHVA 3TGUE 1GZLA 4H13B 1DEEG 3RK3B 3MIWA 2EG5A 4R4LA 2H88C 3WMM0 2NPSC 1PV3A 2B87A 1OFCX 2JKVA 2JYLA 1SQPJ 2WSFH 4IL6X 2POHA 1JOCA 4PH1A 2HPCA 1KILE 3M91A 3EJEA 1IO4A 2ONTA 4O9BA 3EFFK 1WRGA 2KXPB 1KLPA 3GHGA 1HWTC 3JCUE 1SQPK 3CL3D 3CXHI 1ZMBA 3U1CA 1JCCA 2Z4EA 2O1KA 2QSIA 4A7PA 1NU1J 1AQ5A 1ZOYC 3AE7C 1NYHA 2E42A 1MZ9A 1JEKA 2ZJSE 3RK3D 1IJDB 2HODA 4L75A 5AVYB 3V6IA 1FBMA 1S72P 1DD3A 2GZEA 1KILD 1LTJC 2FFDA 5F2OA 1H88A 1W5CE 4GR2A 2K5XA 1PL5A 3L72D 2GZGA 2WMMA 3GMAA 3P32A 4U3FG 3L74G 1R5LA 3S4RA 3V2NA 1K30A 2Z5HA 2PEJA 1R5SA 2GA1A 4Y99C 4WY4B 2VLNA 3AEFC 3CCLP 3P8MC 2Y9YA 1FZCB 3CXCO 5AW4B 3FXEA 3B5NC 2OYIB 2Y0CA 2I8DA 5BU8B 2KW2A 1AUMA 2LL8A 3JSVC 2PAJA 5F2KA 2EHSA 3G21A 1DH3A 3GZMA 3II6A 4OGQD 3Q5SA 4H2YC 2WT7A 2QJYC 4I7ZC 3WBHA 1TU3F 4AYCA 2N1TD 2WWWA 2JWDA 1T6AA 3A0BE 1SQVJ 2NPSD 1FZGA 1QEXA 1LT9B 2M5RA 1JMMA 1L0NK 3FWLA 3GHGB 3VP8A 2IYPA 2FYUJ 5GTIH 2JO0A 4JF7A 3WUVA 1MKMA 2J5UA 1SQXK 4IL6E 4D6TD 1PEQA 3BRVB 1KFMA 1PEUA 3HZQA 2N5HA 1EZVD 3MTUE 3PJSK 5KAIE 2Q7CA 3P05A 1ZW0A 3T97A 4YXWH 1Q81Q 2PNGA 1BE3E 3G9RA 3L73E 2P1JA 2BCCJ 4K35A 4XE5B 1LT9A 1Y8AA 2PENA 3HYBA 3G1GA 1SQQE 1BCCJ 3G0VA 4N78E 1FDMA 5CCGC 1YQ4C 2A06E 2JDIH 3H1KE 5BVZA 3BCCD 4WBAA 1GTWA 2A06D 2WVRA 2FVFA 5KLVJ 5CHXA 3G26A 2AVAA 2WTYA 3CC2P 2QM8A 2PEQA 1NO4A 3KZIE 1HQBA 1M1JB 4R0MA 1MV8A 3AE2C 5EJDA 1KYOD 1KYOH 1YI2P 3ABVC 2PEIA 2XV5A 4PJ0E 2LKMA 1M90Q 3G3ZA 1G1IA 3KHUA 1AVYA 2D2CB 4PD4I 3M9QA 2FYNB 1BSHA 1S9KE 1NAYA 1VL2A 1KQGB 3HRNA 2UWJE 5CCGA 2P58A 3NY7B 3VMAA 2K92A 2EFJA 2JQ4A 3H6PA 1L0LJ 4U0AA 4XFXA 3USSA 1PGJA 1HGVA 1BXIA 1IFJA 2Y0DA 3TNUA 3G4SP 2GM4A 1NTZG 4JPZB 1M6NA 3CX5I 3A0HE 1KMIZ 3BASA 2XT1A 5CMZA 2WPVB 5CZDB 1M8OB 2KOQA 5APTA 3MHVA 1URQA 2JGPA 1HUCA 4DG9A 3WU2H 1PGOA 1M7LA 1NTZE 4LC1A 1L0NJ 3WUTA 1NTKE 2A45G 4MN4C 2VRSA 2KP8A 2IYOA 3DS1A 1NTZK 2JP3A 1L0LG 1A43A 1P84I 2E76B 3H1LE 3CE7A 4PD4E 3N7NA 5B66H 3L75E 1N73C 1LTJA 1VQKP 2Z5IA 3P8CE 1EOQA 2M5AA 3B8EB 1HF9A 1AFOA 3LW5H 2WITA 3DS4A 5HV8A 3VTPC 1UIXA 2IFNA 3RK3E 2P2UA 1IZNB 1EZVG 4IOIH 2I1JA 1OVVA 2FXMA 1RE3A 3QH9A 4WVZA 3OA7A 2E74C 1LGHB 1JM0A 3B71A 3L36A 3G71P 2PEOA 1L0LE 1N7SD 3HD7B 2R3SA 2Q3EA 5AVXB 2A45I 1SFCA 1DD4A 1GXGA 1LJ2A 2QJKB 3G29A 4CA3A 3IR9A 2N1TC 1ZLLA 2CWOA 2KODA 5KAIH 5APSA 2FFDB 2XXMA 2EHTA 1KB9E 2FXOA 2LXBA 1CSBA 1G2CB 2WPTA 1ZR4A 1VQPP 2K37A 2IBZD 5DJTB 2ZYGA 2K0YA 2Z44A 2NRGA 4B86A 1RE3C 1P84H 2YO2A 2IZ1A 2ZVOB 1ZMEC 3MUDC 2W8ZA 2M8RA 5EFWB 3H47A 1ZN5A 2ZYAA 2V7QJ 4DJGA 2O01H 4F37A 4K3AA 1SQXJ 2HODB 3H1KJ 1EZVI 2K93A 5H2FE 3CWBD 2YIUC 5AW3B 3L74D 3BRTB 1AVOA 1GK6A 2IZ0A 4PXHB 1RNIA 2OYHA 1SQVG 5F2NA 2JAZA 1NTMK 1T2KC 2E43A 3PHLA 2W6BA 3M0AA 1FC2C 1WT6A 2O3JA 1ZR2A 1GL2D 3CCEP 1J1EB 2AEFA 5KLVK 1LT9C 4IFFA 5GTHH 5KLIC 1SQBE 3AECC 3B4SA 2O1JA 3H1JG 4XA4A 1S5LH 3H1LJ 3U43A 4EI2A 3A5TA 2K9JA 3AEAC 1IMQA 5AVUB 3L71E 3CCSP 2LPKA 4GKGA 5L8RJ 3RK2D 3Q1MA 3CI9A 3D6ZA 3A0HH 4XROA 4GIFA 1SQBK 5KAFE 2VLPA 1ZRTD 2C0WA 1DV5A 2YXRB 3VMZA 2W6AA 1GK4A 2H8PD 1X79B 1VPCA 4RO0A 1OW8A 1YQ3C 3Q5RA 1VQ7P 3L71G 2QEXP 3PRJA 2ZAEB 3E1IA 1H0TA 1N7SA 5KTBA 4W80A 2PEKA 1KC8Q 1SQVD 3AEDC 1CEIA 2K94A 1PGQA 1VDFA 3GG2A 1BSNA 3IF4A 3VP9A 1M1JC 1PPJG 2MR8A 3DTJA 5KKZC 3D6YA 3M0DC 3PLNA 2AEJA 2K9JB 2NZ2A 1JJ2O 2ZYDA 3RL0B 4W7ZA 2Q3IA 1RQVA 3DPHA 3RBXA 2CPBA 2E74B 3H4EA 1FZBA 4KHXA 4C7NA 3VMXA 3HD7A 1SFCD 1N7SC 1SQQK 1CI6A 2KB7P 5TJHA 1DX7A 2OTLP 1L0NE 1BGYD 3RBZA 2GZJA 2CQ8A 3AEEC 1OVUA 3RG6C 1U7JA 2PFXA 2WPRA 4C46A 1BCCD 2W83C 1KD1Q 2P7JA 4Y28J 2N9BA 2MVVA 1GL2A 3EWKA 4NPEA 1K04A 1SQQJ 1Q90D 2MVUA 5AW1B 2OGUA 1URQD 3V2PA 1NKNA 2E76C 1YJ9P 1URQB 2IDBA 3MGNA 2V4HA 1JCDA 1PEOA 4ZMDA 4QNBA 1MUUA 1SQXE 5KLIB 1RQUA 2WZ7A 2ZT9B 2LR2A 2Y0EA 1A8OA 3K5BA 3CMEP 3CX5E 1NAFA 1QL2A 3H1IJ 1L4AC 4H44C 2K0XA 4JYCA 3AE4C 3H1JJ 2QJYB 3OAKA 1QL1A 3BVHA 1UNKA 1SS1A 4OH8B 3HD7D 2YIUB 2FYUE 4BRYA 1NOHA 2R32A 3U59A 2CPSA 1JMBA 3F5HA 2OYIC 4U3FJ 1NTME 1SVFA 5AW8B 2N1TA 2GUVA 2FXPA 3R2PA 2M3EA 4WY4C 2AXCA 2KLVA 3O6QA 2JB0A 2MR7A 2WPSA 1H0TB 3A7OA 4JQ0D 3MD0A 3WU2E 1J1DC 1PP9D 1ACPA 3A2AA 1YTZT 1RO2A 1RE4A 2AXTE 3L70J 1N7LA 4I6MC 1FZCA 3AE3C 1GD2E 2GZFA 2FYZA 2XNDH 3Q5PA 1L0ND 5KLVG 1PP9G 3MZWB 1GU4A 2E5TA 2M3BA 1A02F 1S2EA 2OYIA 2QG4A 4D6TJ 1GW4A 3A3YB 2LTEA 2G8YA 1SQPD 1Q2NA 4D6TG 2MJZA 2RN0A 3L70E 2HFED 3O6QB 2QA4P 2J58A 2FBWC 2HYNA 3NTNA 2YKPA 1KORA 3AE1C 3A0BH 2ROQA 5CCHC 2QNWA 2WPQA 2KS1B 2WT7B 3HTKB 4GOFA 1Q7YQ 1E6JP 3VN0A 2L22A 4GOEA 1VF5C 3SFEC 1T3UA 1N73B 3CCJP 2BCCG 3C1LA 3GF3A 3H1LG 1NU1D 2N6ZA 2KZJA 4H13C 4UB6E 5KLVD 3H1HG 1ZV8A 1P84D 4ASWA 2FYUG 4H2WC 1S4XA 1HJBA 1NVOA 1FZEA 1E79H 4QKOA 3RG2A 2LXCB 2QM7A 1ZRTE 2QE7H 3VYIA 3EQ2A 3LMOA 4H13D 4M0IA 2GZIA 2P67A 4NPFX 3DS5A 4H0LD 5M1BA 2FYUK 3HUSB 5AW9B 1N2DC 5APVA 4IFMA 3L4FA 4ASVA 3GF7A 1Y9BA 5CCGD 4I7ZB 1KQSO 2XZ0D 1EC5A 1VQOP 1M1JA 3SWFA 1BGYJ 1HBWA 3DS0A 2G3AA 3GJNA 3HE5A 2JEEA 3H32A 1DIPA 3SSUA 3Q20A 5AVWB 3M9BA 2FHSC 2BUOA 2OQQA 3MGEA 5TISH 4UHPB 3I55P 2HR3A 1RF1C 4I2LC 2N6YA 3M1MA 1VQLP 3FWNA 1SP4A 1RF1B 4OGQC 2L6EA 3L74J 1KILA 3KZIH 3RGUA 1YJNP 4MRTC 1QRJA 5APQA 1SFCB 2BEQD 3TK1A 2D2CC 2JO1A 5AVZB 1UIIA 3SFDC 3E2DA 1X22A 3AE9C 3H1ID 3L73J 2WQYC 1BE3J 2X2BA 3EJBA 1AQTA 1KV4A 2FVAA 4U0DA 1U7MA 3LW5J 3Q2YA 2A06G 2KSJA 1KB9D 1SQPE 3CC4P 2R3CA 1SQVK 1GW3A 5E79H 1AV1A 1KILC 2WSEJ 1EDLA 4PH0A 1HJ0A 1U57A 3TGUJ 3Q3DA 3H0DA 5HGOA 2WSSH 2BCCD 3H25A 1OX3A 1D1DA 2E1MA 3DS2A 4BPHA 1YITP 2XZRA 5AVQB 2E5YA 2Y9ZA 3IFMA 1PGPA 2AEMA 5BU5A 1M57D 1VQNP 3M06A 1IK9A 1GL2B 3BCCJ 2KGCA 5KP8B 1HH0A 2KUBA 2N5IA 4DOJA 2NPSA 1X8YA 4OGQB 2JU2A 4XFZA 3VMYA 3ITKA 3L35A 3L71J 1BE3G 1DEBA 5JPAA 1T2KD 3G6EP 1GPJA 1FAVA 7CEIA 3P7KA 1RF0C 1A02J 2QVAA 3H1JE 2CNRA 2LMLA 3GHGC 1X3OA 3H1IE 1QLED 3L75D 1CW5A 2O01N 3PP5A 2GYKA 1VQMP 4H44B 1X0TA 4NEOA 2KG9A 3LRYA 1L4AB 2MY5A 2ERHA 2LOLA 2ZFCA 1M56D 2PRRA 1VQ9P 1M74A 5APXA 1L4AD 3N4XA 1SFCC 3CX5D 4BWNA 4EOTA 3CPWO 1XTCC 4R4MA 3R4YA 2V7QH 3AE5C 5HGLA 4DT0A 1M1KQ 4ZNCA 1SQXD 3H1HD 5B5EH 2FADA 2N98A 3B5NB 1SQBG 3CWBJ 2KGAA 2KR5A 3CXHD 4BPFA 5BS2A 1NQ4A 2M0BA 2W6JH 1SLQA 1LWUA 2L0QA 4M3LA 2JYGA 2ZVNB 4RESB 3KPEA 4WYMA 4JBZA 4U0FA 1NH4A 4H2XC 1CZQA 1HGZA 3CCQP 4HYTB 5KJ7A 3TDKA 2FVEA 1QX8A 2ZT9D 2FKWB 1LTJB 1NTKG 4EIJA 1USDA 4LGDE 1S9KD 2Q5UA 2OTJP 3CMAP 2CK3H 5AVVB 5DJUB 2E76D 3KQGA 4U0BA 1YIJP 1K05A 5KKZB 3RL0g 2CGQA 2QJPC 2L9FA 5AW7B 2DW3A 2SPZA 3DS3A 1F80D 1JO5A 1VF5D 1JUNA 2K88A 2ZXEB 1LWUC 1GXHA 1VQ4P 1FDIA 2BQ1E 1VF5B 1LTAC 3B5ND 2AF8A 4C7RA 2M5AB 3EFGA 2L91A 1PP9J 1OXZA 2OYHB 1PFIA 1BCCG 2Z45A 3L70D 2YMKA 5APWA 2K0DX 4N78D 2N50A 1L2PA 2J59M 3S9OA 3L73D 3E7KA 1Z6MA 2KS1A 1BE3D 2GDWA 4GDOA 2KORA 1OWAA 1IK7A 3NXSA 1NTKJ 1SQPG 5C39A 4IZ6A 1E0HA 1SQBJ 2H89C 2KOPA 3GW6A 2W27A 4OWFA 1OW7A 5CCHD 2QRXA 2YKQA 3PH0A 1LTIC 1HY8A 1LP1B 1LTBC 2Q6QA 3VOPA 2B9BA 2K3RA 5KP7B 3B4QA 2B87B 4WWIA 2B88A 3CXHE 1NKZB 1AJYA 5CJ4A 2C9LY 2FY8A 1J1DB 3GKLC 1HTLC 5DCKA 5HGNA 1EDJA 1UJZA 4BPGA 3H1HE 4PWVB 3NFQA 4PV1C 1LNQA 2IX7C 2Q1KA 1OMIA 1YTZI 1L0IA 2AFDA 1T3JA 3SWYA 4YXDC 3L74E 4UB8H 3H1IG 1W2EA 2IPPA 3G28A 1BGYG 3I5CA 2PY8A 1KB9H 2VLQA 2ZXXA 3GLMA 4GT1A 1JTHB 4LLHA 1AA0A 2IFMA 3M9HA 1JY3N 3IN6A 1BDCA 3CCVP 3H1JD 1YBKA 4ZKUA 2FFDC 2IBZE 3RL0C 1KTMA 1FU1A 2DNWA 2M8LA 2E75C 2JWAA 5TISE 5CBOA 3L72E 1IFDA 2E75D 2QJKC 1URQC 2XNXA 2MKVA 1LTSC 2WSFJ 1NJIQ 2LIUA 5KP6B 1DNYA 3H1HJ 3V5BA 1MFZA 2M8PA 1BCCE 2K2QA 4HH2A 1E5WA 3HE4A 2BCCE 3D71A 4XFYA 3MUDA 1JY2O 3FGAD 2C0XA 1QGKB 2OARA 2OTKE 1Y47A 3L73G 1FJPA 4H0LC 2KNCB 3CX5H 4BRYB 3L37A 4NPDA 3G1IA 4RKUJ 1N7SB 2RKLA 4AUWA 4H0LB 2H7HA 1QVGO 2OYHC 1JY3P 3L70G 3HTKA 1YHQP 1AYIA 3F89A 5GTIE 1Q82Q 2HG5D 2N1TB 2FQ1A 1BAJA 3NTEA 1VHNA 1KQFB 2KG6A 1MFTA 1NU1G 2LKIA 3V4QA 4IL6H 4U7JA 4PD4H 4L76A 4C7NB 1JB0J 3V2QA 2R5DA 1FS0E 4AQRD 3TGUD 1KB9I 5I4TG 3TNUB 1SQVE 1EIAA 1IFMA 2E74D 1FOSE 1KQLA 2KGDA 4L74A 1T8KA 2W90A 1USEA 1LT1A 2WSEH 1K73Q 1JNMA 1NTZD 1S1CX 1K8AQ 3CWBG 2LIWA 3OJAB 2FACA 3HE4B 2KZIA 1K9MQ 3RK2C 3L71D 2GUSA 2KOOA 2YMYA 4HJGH 1L0NG 2OYOA 1EQ7A 4EYYQ 4U0CA 4TLFA 1EXJA 2L5GB 1J2JB 4JYBA 1NTMG 4U3FE 3TYYA 2Z46A 4KJMA 1SQBD 1AF8A 3KYQA 2KK7A 2IBZG 3TF5A 4EDFA 1OIPA 4PJ0H 2FYNC 4I1LA 3V2RA 1FE6A 3S1KA 2CG5B 3D70A 2GDXA 1XTGB 2EIAA 4OVNF 1J1EC 4L73A 3CXHH 4WY4D 1H8AA 4HKGA 1G2CA 5CBNA 1FOSF 1IFPA 2N9YB 1P84E 4DZOA 5B5EE 5KLVE 4BXLA 3CWBE 1PZQA 2QIWA 1NU1E 1OZHA 3JCUH 3ZDMA 2KOGA 3TSIA 1H89A 3HD7C 5AW2B 4W7YA 1JTHA 2KSEA 3AE8C 1ZXGA 5H2FH 1Z56A 3L72G 3OW2O 4CPGA 1L0LK 1EDIA 2JBGA 1NWQA 1GL2C 3L72J 2XU6A 3HE5B 3IAOA 2GDYA 1IFIA 1YJWP 3CCRP 1RF1A 2XZ1C 5CJ0A 5AW5B 2RH0A 2BASA 5AW0B 2JJLA 1S5LE 1CI6B 1S3JA 3QWOC 1FR2A 2KNCA 1L0LD 2BEZF 1S5LX 1NHLA 1KN7A 5B66E 2JU1A 4XRQA 1W2BO 2XKMA 2PP6A 2P10A 1WMKA 3KDPB 4ZKPA 1PP9E 2K1AA 1FDOA 1HVVA 3LIDA 2AXTH 2WSCH 1NU1K 4COCA 2FQ0A 1N73A 1D7MA 3U1AA 2VSQA 2Q9IA 1NTMD 3P8CD 4PV1D 3RL0D 3CCMP 3GZLA 1EDKA 2FYUD 3I56P 2KWLA 3PTZA 2KOSA 1N86A 3JC22 2WSCJ 4PD4D 4COPA 3H1LD 3WUUA 3RK2B 1OW6A 5E79E 1FZCC 4Z1MH 4IPYA 1NTKD 2YO3A 2M8NA 3L75J 3W68A 3FXDA 5AVTB 1VQ5P 5APYA 2R44A 5K5GB 3BATA 1EMVA 3C9IA 1EXIA 3KXDA 3EJDA 4DCKA 4QMAA 1RO0A 1PEMA 4RJTA 2MF4A 2KGEA 4HKZH 4KT0J 1RF0A 4TT3H 4UB6H 1NTZJ 3H32B 2AFEA 1SQXG 2IBZI 2KI7B 1RY3A 1ZP0C 2HLOA 5HVCA 4UB8E 3BCCG 2DGYA 1L4AA 4N6JA 1BGYE 3B5NA 1FZAA 4N3YB 1JY2N 1FJKA 2D2CD 3AE6C 1GMJA 3UIAA 2O01J
chains in the Genus database with same CATH topology
1QVGO 2BUOA 2EIAA 3CD6P 2LF4A 3G29A 4XFZA 5DCKA 5HGNA 2OTJP 3MGEA 4XROA 3CMAP 5F2OA 1YHQP 1YJ9P 3B5IA 4GR2A 3I55P 5JPAA 2CWOA 2PEMA 3P05A 3G6EP 4U0BA 1YIJP 2KODA 3M1MA 1VQLP 2XXMA 1PEOA 1Q82Q 2L6EA 1Q81Q 3CCMP 4U0EA 4QNBA 1BAJA 3NTEA 1YJNP 1VQ7P 3I56P 1VQPP 1QRJA 3DS3A 2QEXP 1QVFO 2PENA 1Q86Q 1A8OA 2XV6A 4COPA 1K30A 3CMEP 2Z44A 2PEKA 3G1GA 3HYBA 1VQ4P 2PEJA 1IUQA 3G0VA 1KC8Q 2BQ1E 2QA4P 3G28A 1VQMP 4IPYA 2PY8A 5I4TG 3CCLP 3LRYA 1M6EX 3CXCO 5HGMA 2BHVA 1EIAA 2M8NA 3DS1A 3OW2O 3E2DA 1A43A 3H47A 2Z45A 1VQ9P 1Q7YQ 1M74A 3G26A 1E6JP 1AUMA 1VQ5P 3CCVP 3CC2P 3CCJP 3CCUP 2PEQA 2EG5A 5F2KA 3G21A 3CPWO 4GR6A 3DTJA 1VQKP 2JYLA 4U0DA 5HGLA 1RO0A 1RNIA 1K73Q 3CC7P 1M1KQ 5F2NA 1EOQA 1YJWP 1JJ2O 1PEMA 3CCRP 2M8LA 1K8AQ 3CC4P 3WBHA 4PH1A 1YI2P 2PEIA 3DPHA 3DS4A 1M90Q 1NJIQ 2ONTA 1K9MQ 4PH0A 3H4EA 5BS2A 3CCEP 4M0IA 3H0DA 1VQ6P 5HGOA 2M8PA 3DS5A 4U0CA 1RO2A 2JYGA 2DGYA 2OTLP 4XRQA 4WYMA 5BS1A 4U0FA 1W2BO 2JO0A 1ZMBA 2P9XA 1VQ8P 4XFYA 1D1DA 2EFJA 2Z46A 2E1MA 3DS2A 3RG6C 3CCQP 1YITP 4U0AA 4XFXA 1KD1Q 2OARA 3G71P 1KQSO 2PEOA 3G4SP 3VRLC 1VQOP 1PEQA 1VQNP 3DS0A 1PEUA 3HZQA 3G1IA 1M6NA 3Q20A 4COCA 3CCSP 1N8RQ 1S72P 2XT1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QVG O;  1VQ4 P;  1VQK P;  1S72 P;  3CD6 P;  2OTJ P;  1KC8 Q;  2QA4 P;  2OTL P;  3CMA P;  1K73 Q;  1VQM P;  3CC7 P;  1W2B O;  1YJW P;  1M1K Q;  1JJ2 O;  3CCR P;  1YHQ P;  1YJ9 P;  1VQ8 P;  3I55 P;  1K8A Q;  3CCL P;  3CC4 P;  3CXC O;  3CCQ P;  1YI2 P;  3G6E P;  1YIT P;  3OW2 O;  1YIJ P;  1VQL P;  1Q82 Q;  1KD1 Q;  3G71 P;  3CCM P;  1Q81 Q;  1Q7Y Q;  3G4S P;  1NJI Q;  1K9M Q;  1M90 Q;  1KQS O;  1VQO P;  1VQ9 P;  1YJN P;  1VQ7 P;  3I56 P;  1VQ5 P;  1VQN P;  1VQP P;  3CCE P;  2QEX P;  3CCV P;  3CC2 P;  3CCJ P;  1QVF O;  3CCU P;  1Q86 Q;  1VQ6 P;  1N8R Q;  3CCS P;  3CPW O;  3CME P; 
#chains in the Genus database with same CATH topology
 2LF4 A;  3AEG C;  1KYO E;  1OVR A;  5GTH E;  2KLU A;  4WY4 A;  2VLO A;  1LP1 A;  5APU A;  3NMD A;  2PGD A;  2NO8 A;  5AW6 B;  2K9Y A;  1ZNV A;  2B89 A;  2R5B A;  1LWU B;  1QVF O;  3RK3 C;  1Q86 Q;  2XV6 A;  3O8Z A;  1KIL B;  3MP7 B;  1IUQ A;  3AEB C;  3V4W A;  1RE4 C;  2QJP B;  1KFN A;  4HB1 A;  3BCC E;  1IFN A;  3H1K D;  3E1R A;  3TGU G;  5HGM A;  2E75 B;  1SQQ D;  5KAF H;  1GU5 A;  1RH5 B;  4H44 D;  5KJ7 C;  1KZU B;  3LIE A;  1PPJ E;  2YKO A;  1T8Z A;  3CCU P;  5AVS B;  1IC2 A;  1X9V A;  4GR6 A;  1PIX A;  1OR5 A;  4GOD A;  1NGM B;  3CC7 P;  2A45 H;  1NTK K;  1R8E A;  2C9N Y;  1EZV E;  2JR8 A;  3HUS A;  1RHZ B;  1JY2 P;  2FQ2 A;  1LTT C;  1VQ6 P;  4D6T E;  2NPS B;  4XFJ A;  2XDJ A;  3FX0 A;  1GDT A;  5KJ7 D;  5BS1 A;  2H43 A;  2P9X A;  1VQ8 P;  1MZ8 A;  1YYC A;  3L75 G;  1KYO I;  4PV1 B;  4WB4 A;  1BDD A;  4Y99 B;  5CCH A;  1LTG C;  4U3F D;  3VRL C;  2L4B A;  5EW5 E;  1N8R Q;  2YNY A;  1JY3 O;  2MD9 A;  2YXQ B;  4IFD K;  3CD6 P;  3W67 A;  4YTP C;  3M0D A;  2KYV A;  2KIK A;  1G1J A;  1FZF A;  3B5I A;  2PEM A;  1L0H A;  2HPC B;  1SQQ G;  4U0E A;  3HUS C;  2I1K A;  1IMP A;  1VKU A;  3H1K G;  2ITA A;  3CLQ A;  1NTM J;  2KG8 A;  2ZT9 C;  5AVR B;  4YPC A;  3SWK A;  1PPJ D;  2RMZ A;  3C8V A;  2FAE A;  3T97 B;  1M6E X;  2BHV A;  3TGU E;  1GZL A;  4H13 B;  1DEE G;  3RK3 B;  3MIW A;  2EG5 A;  4R4L A;  2H88 C;  3WMM 0;  2NPS C;  1PV3 A;  2B87 A;  1OFC X;  2JKV A;  2JYL A;  1SQP J;  2WSF H;  4IL6 X;  2POH A;  1JOC A;  4PH1 A;  2HPC A;  1KIL E;  3M91 A;  3EJE A;  1IO4 A;  2ONT A;  4O9B A;  3EFF K;  1WRG A;  2KXP B;  1KLP A;  3GHG A;  1HWT C;  3JCU E;  1SQP K;  3CL3 D;  3CXH I;  1ZMB A;  3U1C A;  1JCC A;  2Z4E A;  2O1K A;  2QSI A;  4A7P A;  1NU1 J;  1AQ5 A;  1ZOY C;  3AE7 C;  1NYH A;  2E42 A;  1MZ9 A;  1JEK A;  2ZJS E;  3RK3 D;  1IJD B;  2HOD A;  4L75 A;  5AVY B;  3V6I A;  1FBM A;  1S72 P;  1DD3 A;  2GZE A;  1KIL D;  1LTJ C;  2FFD A;  5F2O A;  1H88 A;  1W5C E;  4GR2 A;  2K5X A;  1PL5 A;  3L72 D;  2GZG A;  2WMM A;  3GMA A;  3P32 A;  4U3F G;  3L74 G;  1R5L A;  3S4R A;  3V2N A;  1K30 A;  2Z5H A;  2PEJ A;  1R5S A;  2GA1 A;  4Y99 C;  4WY4 B;  2VLN A;  3AEF C;  3CCL P;  3P8M C;  2Y9Y A;  1FZC B;  3CXC O;  5AW4 B;  3FXE A;  3B5N C;  2OYI B;  2Y0C A;  2I8D A;  5BU8 B;  2KW2 A;  1AUM A;  2LL8 A;  3JSV C;  2PAJ A;  5F2K A;  2EHS A;  3G21 A;  1DH3 A;  3GZM A;  3II6 A;  4OGQ D;  3Q5S A;  4H2Y C;  2WT7 A;  2QJY C;  4I7Z C;  3WBH A;  1TU3 F;  4AYC A;  2N1T D;  2WWW A;  2JWD A;  1T6A A;  3A0B E;  1SQV J;  2NPS D;  1FZG A;  1QEX A;  1LT9 B;  2M5R A;  1JMM A;  1L0N K;  3FWL A;  3GHG B;  3VP8 A;  2IYP A;  2FYU J;  5GTI H;  2JO0 A;  4JF7 A;  3WUV A;  1MKM A;  2J5U A;  1SQX K;  4IL6 E;  4D6T D;  1PEQ A;  3BRV B;  1KFM A;  1PEU A;  3HZQ A;  2N5H A;  1EZV D;  3MTU E;  3PJS K;  5KAI E;  2Q7C A;  3P05 A;  1ZW0 A;  3T97 A;  4YXW H;  1Q81 Q;  2PNG A;  1BE3 E;  3G9R A;  3L73 E;  2P1J A;  2BCC J;  4K35 A;  4XE5 B;  1LT9 A;  1Y8A A;  2PEN A;  3HYB A;  3G1G A;  1SQQ E;  1BCC J;  3G0V A;  4N78 E;  1FDM A;  5CCG C;  1YQ4 C;  2A06 E;  2JDI H;  3H1K E;  5BVZ A;  3BCC D;  4WBA A;  1GTW A;  2A06 D;  2WVR A;  2FVF A;  5KLV J;  5CHX A;  3G26 A;  2AVA A;  2WTY A;  3CC2 P;  2QM8 A;  2PEQ A;  1NO4 A;  3KZI E;  1HQB A;  1M1J B;  4R0M A;  1MV8 A;  3AE2 C;  5EJD A;  1KYO D;  1KYO H;  1YI2 P;  3ABV C;  2PEI A;  2XV5 A;  4PJ0 E;  2LKM A;  1M90 Q;  3G3Z A;  1G1I A;  3KHU A;  1AVY A;  2D2C B;  4PD4 I;  3M9Q A;  2FYN B;  1BSH A;  1S9K E;  1NAY A;  1VL2 A;  1KQG B;  3HRN A;  2UWJ E;  5CCG A;  2P58 A;  3NY7 B;  3VMA A;  2K92 A;  2EFJ A;  2JQ4 A;  3H6P A;  1L0L J;  4U0A A;  4XFX A;  3USS A;  1PGJ A;  1HGV A;  1BXI A;  1IFJ A;  2Y0D A;  3TNU A;  3G4S P;  2GM4 A;  1NTZ G;  4JPZ B;  1M6N A;  3CX5 I;  3A0H E;  1KMI Z;  3BAS A;  2XT1 A;  5CMZ A;  2WPV B;  5CZD B;  1M8O B;  2KOQ A;  5APT A;  3MHV A;  1URQ A;  2JGP A;  1HUC A;  4DG9 A;  3WU2 H;  1PGO A;  1M7L A;  1NTZ E;  4LC1 A;  1L0N J;  3WUT A;  1NTK E;  2A45 G;  4MN4 C;  2VRS A;  2KP8 A;  2IYO A;  3DS1 A;  1NTZ K;  2JP3 A;  1L0L G;  1A43 A;  1P84 I;  2E76 B;  3H1L E;  3CE7 A;  4PD4 E;  3N7N A;  5B66 H;  3L75 E;  1N73 C;  1LTJ A;  1VQK P;  2Z5I A;  3P8C E;  1EOQ A;  2M5A A;  3B8E B;  1HF9 A;  1AFO A;  3LW5 H;  2WIT A;  3DS4 A;  5HV8 A;  3VTP C;  1UIX A;  2IFN A;  3RK3 E;  2P2U A;  1IZN B;  1EZV G;  4IOI H;  2I1J A;  1OVV A;  2FXM A;  1RE3 A;  3QH9 A;  4WVZ A;  3OA7 A;  2E74 C;  1LGH B;  1JM0 A;  3B71 A;  3L36 A;  3G71 P;  2PEO A;  1L0L E;  1N7S D;  3HD7 B;  2R3S A;  2Q3E A;  5AVX B;  2A45 I;  1SFC A;  1DD4 A;  1GXG A;  1LJ2 A;  2QJK B;  3G29 A;  4CA3 A;  3IR9 A;  2N1T C;  1ZLL A;  2CWO A;  2KOD A;  5KAI H;  5APS A;  2FFD B;  2XXM A;  2EHT A;  1KB9 E;  2FXO A;  2LXB A;  1CSB A;  1G2C B;  2WPT A;  1ZR4 A;  1VQP P;  2K37 A;  2IBZ D;  5DJT B;  2ZYG A;  2K0Y A;  2Z44 A;  2NRG A;  4B86 A;  1RE3 C;  1P84 H;  2YO2 A;  2IZ1 A;  2ZVO B;  1ZME C;  3MUD C;  2W8Z A;  2M8R A;  5EFW B;  3H47 A;  1ZN5 A;  2ZYA A;  2V7Q J;  4DJG A;  2O01 H;  4F37 A;  4K3A A;  1SQX J;  2HOD B;  3H1K J;  1EZV I;  2K93 A;  5H2F E;  3CWB D;  2YIU C;  5AW3 B;  3L74 D;  3BRT B;  1AVO A;  1GK6 A;  2IZ0 A;  4PXH B;  1RNI A;  2OYH A;  1SQV G;  5F2N A;  2JAZ A;  1NTM K;  1T2K C;  2E43 A;  3PHL A;  2W6B A;  3M0A A;  1FC2 C;  1WT6 A;  2O3J A;  1ZR2 A;  1GL2 D;  3CCE P;  1J1E B;  2AEF A;  5KLV K;  1LT9 C;  4IFF A;  5GTH H;  5KLI C;  1SQB E;  3AEC C;  3B4S A;  2O1J A;  3H1J G;  4XA4 A;  1S5L H;  3H1L J;  3U43 A;  4EI2 A;  3A5T A;  2K9J A;  3AEA C;  1IMQ A;  5AVU B;  3L71 E;  3CCS P;  2LPK A;  4GKG A;  5L8R J;  3RK2 D;  3Q1M A;  3CI9 A;  3D6Z A;  3A0H H;  4XRO A;  4GIF A;  1SQB K;  5KAF E;  2VLP A;  1ZRT D;  2C0W A;  1DV5 A;  2YXR B;  3VMZ A;  2W6A A;  1GK4 A;  2H8P D;  1X79 B;  1VPC A;  4RO0 A;  1OW8 A;  1YQ3 C;  3Q5R A;  1VQ7 P;  3L71 G;  2QEX P;  3PRJ A;  2ZAE B;  3E1I A;  1H0T A;  1N7S A;  5KTB A;  4W80 A;  2PEK A;  1KC8 Q;  1SQV D;  3AED C;  1CEI A;  2K94 A;  1PGQ A;  1VDF A;  3GG2 A;  1BSN A;  3IF4 A;  3VP9 A;  1M1J C;  1PPJ G;  2MR8 A;  3DTJ A;  5KKZ C;  3D6Y A;  3M0D C;  3PLN A;  2AEJ A;  2K9J B;  2NZ2 A;  1JJ2 O;  2ZYD A;  3RL0 B;  4W7Z A;  2Q3I A;  1RQV A;  3DPH A;  3RBX A;  2CPB A;  2E74 B;  3H4E A;  1FZB A;  4KHX A;  4C7N A;  3VMX A;  3HD7 A;  1SFC D;  1N7S C;  1SQQ K;  1CI6 A;  2KB7 P;  5TJH A;  1DX7 A;  2OTL P;  1L0N E;  1BGY D;  3RBZ A;  2GZJ A;  2CQ8 A;  3AEE C;  1OVU A;  3RG6 C;  1U7J A;  2PFX A;  2WPR A;  4C46 A;  1BCC D;  2W83 C;  1KD1 Q;  2P7J A;  4Y28 J;  2N9B A;  2MVV A;  1GL2 A;  3EWK A;  4NPE A;  1K04 A;  1SQQ J;  1Q90 D;  2MVU A;  5AW1 B;  2OGU A;  1URQ D;  3V2P A;  1NKN A;  2E76 C;  1YJ9 P;  1URQ B;  2IDB A;  3MGN A;  2V4H A;  1JCD A;  1PEO A;  4ZMD A;  4QNB A;  1MUU A;  1SQX E;  5KLI B;  1RQU A;  2WZ7 A;  2ZT9 B;  2LR2 A;  2Y0E A;  1A8O A;  3K5B A;  3CME P;  3CX5 E;  1NAF A;  1QL2 A;  3H1I J;  1L4A C;  4H44 C;  2K0X A;  4JYC A;  3AE4 C;  3H1J J;  2QJY B;  3OAK A;  1QL1 A;  3BVH A;  1UNK A;  1SS1 A;  4OH8 B;  3HD7 D;  2YIU B;  2FYU E;  4BRY A;  1NOH A;  2R32 A;  3U59 A;  2CPS A;  1JMB A;  3F5H A;  2OYI C;  4U3F J;  1NTM E;  1SVF A;  5AW8 B;  2N1T A;  2GUV A;  2FXP A;  3R2P A;  2M3E A;  4WY4 C;  2AXC A;  2KLV A;  3O6Q A;  2JB0 A;  2MR7 A;  2WPS A;  1H0T B;  3A7O A;  4JQ0 D;  3MD0 A;  3WU2 E;  1J1D C;  1PP9 D;  1ACP A;  3A2A A;  1YTZ T;  1RO2 A;  1RE4 A;  2AXT E;  3L70 J;  1N7L A;  4I6M C;  1FZC A;  3AE3 C;  1GD2 E;  2GZF A;  2FYZ A;  2XND H;  3Q5P A;  1L0N D;  5KLV G;  1PP9 G;  3MZW B;  1GU4 A;  2E5T A;  2M3B A;  1A02 F;  1S2E A;  2OYI A;  2QG4 A;  4D6T J;  1GW4 A;  3A3Y B;  2LTE A;  2G8Y A;  1SQP D;  1Q2N A;  4D6T G;  2MJZ A;  2RN0 A;  3L70 E;  2HFE D;  3O6Q B;  2QA4 P;  2J58 A;  2FBW C;  2HYN A;  3NTN A;  2YKP A;  1KOR A;  3AE1 C;  3A0B H;  2ROQ A;  5CCH C;  2QNW A;  2WPQ A;  2KS1 B;  2WT7 B;  3HTK B;  4GOF A;  1Q7Y Q;  1E6J P;  3VN0 A;  2L22 A;  4GOE A;  1VF5 C;  3SFE C;  1T3U A;  1N73 B;  3CCJ P;  2BCC G;  3C1L A;  3GF3 A;  3H1L G;  1NU1 D;  2N6Z A;  2KZJ A;  4H13 C;  4UB6 E;  5KLV D;  3H1H G;  1ZV8 A;  1P84 D;  4ASW A;  2FYU G;  4H2W C;  1S4X A;  1HJB A;  1NVO A;  1FZE A;  1E79 H;  4QKO A;  3RG2 A;  2LXC B;  2QM7 A;  1ZRT E;  2QE7 H;  3VYI A;  3EQ2 A;  3LMO A;  4H13 D;  4M0I A;  2GZI A;  2P67 A;  4NPF X;  3DS5 A;  4H0L D;  5M1B A;  2FYU K;  3HUS B;  5AW9 B;  1N2D C;  5APV A;  4IFM A;  3L4F A;  4ASV A;  3GF7 A;  1Y9B A;  5CCG D;  4I7Z B;  1KQS O;  2XZ0 D;  1EC5 A;  1VQO P;  1M1J A;  3SWF A;  1BGY J;  1HBW A;  3DS0 A;  2G3A A;  3GJN A;  3HE5 A;  2JEE A;  3H32 A;  1DIP A;  3SSU A;  3Q20 A;  5AVW B;  3M9B A;  2FHS C;  2BUO A;  2OQQ A;  3MGE A;  5TIS H;  4UHP B;  3I55 P;  2HR3 A;  1RF1 C;  4I2L C;  2N6Y A;  3M1M A;  1VQL P;  3FWN A;  1SP4 A;  1RF1 B;  4OGQ C;  2L6E A;  3L74 J;  1KIL A;  3KZI H;  3RGU A;  1YJN P;  4MRT C;  1QRJ A;  5APQ A;  1SFC B;  2BEQ D;  3TK1 A;  2D2C C;  2JO1 A;  5AVZ B;  1UII A;  3SFD C;  3E2D A;  1X22 A;  3AE9 C;  3H1I D;  3L73 J;  2WQY C;  1BE3 J;  2X2B A;  3EJB A;  1AQT A;  1KV4 A;  2FVA A;  4U0D A;  1U7M A;  3LW5 J;  3Q2Y A;  2A06 G;  2KSJ A;  1KB9 D;  1SQP E;  3CC4 P;  2R3C A;  1SQV K;  1GW3 A;  5E79 H;  1AV1 A;  1KIL C;  2WSE J;  1EDL A;  4PH0 A;  1HJ0 A;  1U57 A;  3TGU J;  3Q3D A;  3H0D A;  5HGO A;  2WSS H;  2BCC D;  3H25 A;  1OX3 A;  1D1D A;  2E1M A;  3DS2 A;  4BPH A;  1YIT P;  2XZR A;  5AVQ B;  2E5Y A;  2Y9Z A;  3IFM A;  1PGP A;  2AEM A;  5BU5 A;  1M57 D;  1VQN P;  3M06 A;  1IK9 A;  1GL2 B;  3BCC J;  2KGC A;  5KP8 B;  1HH0 A;  2KUB A;  2N5I A;  4DOJ A;  2NPS A;  1X8Y A;  4OGQ B;  2JU2 A;  4XFZ A;  3VMY A;  3ITK A;  3L35 A;  3L71 J;  1BE3 G;  1DEB A;  5JPA A;  1T2K D;  3G6E P;  1GPJ A;  1FAV A;  7CEI A;  3P7K A;  1RF0 C;  1A02 J;  2QVA A;  3H1J E;  2CNR A;  2LML A;  3GHG C;  1X3O A;  3H1I E;  1QLE D;  3L75 D;  1CW5 A;  2O01 N;  3PP5 A;  2GYK A;  1VQM P;  4H44 B;  1X0T A;  4NEO A;  2KG9 A;  3LRY A;  1L4A B;  2MY5 A;  2ERH A;  2LOL A;  2ZFC A;  1M56 D;  2PRR A;  1VQ9 P;  1M74 A;  5APX A;  1L4A D;  3N4X A;  1SFC C;  3CX5 D;  4BWN A;  4EOT A;  3CPW O;  1XTC C;  4R4M A;  3R4Y A;  2V7Q H;  3AE5 C;  5HGL A;  4DT0 A;  1M1K Q;  4ZNC A;  1SQX D;  3H1H D;  5B5E H;  2FAD A;  2N98 A;  3B5N B;  1SQB G;  3CWB J;  2KGA A;  2KR5 A;  3CXH D;  4BPF A;  5BS2 A;  1NQ4 A;  2M0B A;  2W6J H;  1SLQ A;  1LWU A;  2L0Q A;  4M3L A;  2JYG A;  2ZVN B;  4RES B;  3KPE A;  4WYM A;  4JBZ A;  4U0F A;  1NH4 A;  4H2X C;  1CZQ A;  1HGZ A;  3CCQ P;  4HYT B;  5KJ7 A;  3TDK A;  2FVE A;  1QX8 A;  2ZT9 D;  2FKW B;  1LTJ B;  1NTK G;  4EIJ A;  1USD A;  4LGD E;  1S9K D;  2Q5U A;  2OTJ P;  3CMA P;  2CK3 H;  5AVV B;  5DJU B;  2E76 D;  3KQG A;  4U0B A;  1YIJ P;  1K05 A;  5KKZ B;  3RL0 g;  2CGQ A;  2QJP C;  2L9F A;  5AW7 B;  2DW3 A;  2SPZ A;  3DS3 A;  1F80 D;  1JO5 A;  1VF5 D;  1JUN A;  2K88 A;  2ZXE B;  1LWU C;  1GXH A;  1VQ4 P;  1FDI A;  2BQ1 E;  1VF5 B;  1LTA C;  3B5N D;  2AF8 A;  4C7R A;  2M5A B;  3EFG A;  2L91 A;  1PP9 J;  1OXZ A;  2OYH B;  1PFI A;  1BCC G;  2Z45 A;  3L70 D;  2YMK A;  5APW A;  2K0D X;  4N78 D;  2N50 A;  1L2P A;  2J59 M;  3S9O A;  3L73 D;  3E7K A;  1Z6M A;  2KS1 A;  1BE3 D;  2GDW A;  4GDO A;  2KOR A;  1OWA A;  1IK7 A;  3NXS A;  1NTK J;  1SQP G;  5C39 A;  4IZ6 A;  1E0H A;  1SQB J;  2H89 C;  2KOP A;  3GW6 A;  2W27 A;  4OWF A;  1OW7 A;  5CCH D;  2QRX A;  2YKQ A;  3PH0 A;  1LTI C;  1HY8 A;  1LP1 B;  1LTB C;  2Q6Q A;  3VOP A;  2B9B A;  2K3R A;  5KP7 B;  3B4Q A;  2B87 B;  4WWI A;  2B88 A;  3CXH E;  1NKZ B;  1AJY A;  5CJ4 A;  2C9L Y;  2FY8 A;  1J1D B;  3GKL C;  1HTL C;  5DCK A;  5HGN A;  1EDJ A;  1UJZ A;  4BPG A;  3H1H E;  4PWV B;  3NFQ A;  4PV1 C;  1LNQ A;  2IX7 C;  2Q1K A;  1OMI A;  1YTZ I;  1L0I A;  2AFD A;  1T3J A;  3SWY A;  4YXD C;  3L74 E;  4UB8 H;  3H1I G;  1W2E A;  2IPP A;  3G28 A;  1BGY G;  3I5C A;  2PY8 A;  1KB9 H;  2VLQ A;  2ZXX A;  3GLM A;  4GT1 A;  1JTH B;  4LLH A;  1AA0 A;  2IFM A;  3M9H A;  1JY3 N;  3IN6 A;  1BDC A;  3CCV P;  3H1J D;  1YBK A;  4ZKU A;  2FFD C;  2IBZ E;  3RL0 C;  1KTM A;  1FU1 A;  2DNW A;  2M8L A;  2E75 C;  2JWA A;  5TIS E;  5CBO A;  3L72 E;  1IFD A;  2E75 D;  2QJK C;  1URQ C;  2XNX A;  2MKV A;  1LTS C;  2WSF J;  1NJI Q;  2LIU A;  5KP6 B;  1DNY A;  3H1H J;  3V5B A;  1MFZ A;  2M8P A;  1BCC E;  2K2Q A;  4HH2 A;  1E5W A;  3HE4 A;  2BCC E;  3D71 A;  4XFY A;  3MUD A;  1JY2 O;  3FGA D;  2C0X A;  1QGK B;  2OAR A;  2OTK E;  1Y47 A;  3L73 G;  1FJP A;  4H0L C;  2KNC B;  3CX5 H;  4BRY B;  3L37 A;  4NPD A;  3G1I A;  4RKU J;  1N7S B;  2RKL A;  4AUW A;  4H0L B;  2H7H A;  1QVG O;  2OYH C;  1JY3 P;  3L70 G;  3HTK A;  1YHQ P;  1AYI A;  3F89 A;  5GTI E;  1Q82 Q;  2HG5 D;  2N1T B;  2FQ1 A;  1BAJ A;  3NTE A;  1VHN A;  1KQF B;  2KG6 A;  1MFT A;  1NU1 G;  2LKI A;  3V4Q A;  4IL6 H;  4U7J A;  4PD4 H;  4L76 A;  4C7N B;  1JB0 J;  3V2Q A;  2R5D A;  1FS0 E;  4AQR D;  3TGU D;  1KB9 I;  5I4T G;  3TNU B;  1SQV E;  1EIA A;  1IFM A;  2E74 D;  1FOS E;  1KQL A;  2KGD A;  4L74 A;  1T8K A;  2W90 A;  1USE A;  1LT1 A;  2WSE H;  1K73 Q;  1JNM A;  1NTZ D;  1S1C X;  1K8A Q;  3CWB G;  2LIW A;  3OJA B;  2FAC A;  3HE4 B;  2KZI A;  1K9M Q;  3RK2 C;  3L71 D;  2GUS A;  2KOO A;  2YMY A;  4HJG H;  1L0N G;  2OYO A;  1EQ7 A;  4EYY Q;  4U0C A;  4TLF A;  1EXJ A;  2L5G B;  1J2J B;  4JYB A;  1NTM G;  4U3F E;  3TYY A;  2Z46 A;  4KJM A;  1SQB D;  1AF8 A;  3KYQ A;  2KK7 A;  2IBZ G;  3TF5 A;  4EDF A;  1OIP A;  4PJ0 H;  2FYN C;  4I1L A;  3V2R A;  1FE6 A;  3S1K A;  2CG5 B;  3D70 A;  2GDX A;  1XTG B;  2EIA A;  4OVN F;  1J1E C;  4L73 A;  3CXH H;  4WY4 D;  1H8A A;  4HKG A;  1G2C A;  5CBN A;  1FOS F;  1IFP A;  2N9Y B;  1P84 E;  4DZO A;  5B5E E;  5KLV E;  4BXL A;  3CWB E;  1PZQ A;  2QIW A;  1NU1 E;  1OZH A;  3JCU H;  3ZDM A;  2KOG A;  3TSI A;  1H89 A;  3HD7 C;  5AW2 B;  4W7Y A;  1JTH A;  2KSE A;  3AE8 C;  1ZXG A;  5H2F H;  1Z56 A;  3L72 G;  3OW2 O;  4CPG A;  1L0L K;  1EDI A;  2JBG A;  1NWQ A;  1GL2 C;  3L72 J;  2XU6 A;  3HE5 B;  3IAO A;  2GDY A;  1IFI A;  1YJW P;  3CCR P;  1RF1 A;  2XZ1 C;  5CJ0 A;  5AW5 B;  2RH0 A;  2BAS A;  5AW0 B;  2JJL A;  1S5L E;  1CI6 B;  1S3J A;  3QWO C;  1FR2 A;  2KNC A;  1L0L D;  2BEZ F;  1S5L X;  1NHL A;  1KN7 A;  5B66 E;  2JU1 A;  4XRQ A;  1W2B O;  2XKM A;  2PP6 A;  2P10 A;  1WMK A;  3KDP B;  4ZKP A;  1PP9 E;  2K1A A;  1FDO A;  1HVV A;  3LID A;  2AXT H;  2WSC H;  1NU1 K;  4COC A;  2FQ0 A;  1N73 A;  1D7M A;  3U1A A;  2VSQ A;  2Q9I A;  1NTM D;  3P8C D;  4PV1 D;  3RL0 D;  3CCM P;  3GZL A;  1EDK A;  2FYU D;  3I56 P;  2KWL A;  3PTZ A;  2KOS A;  1N86 A;  3JC2 2;  2WSC J;  4PD4 D;  4COP A;  3H1L D;  3WUU A;  3RK2 B;  1OW6 A;  5E79 E;  1FZC C;  4Z1M H;  4IPY A;  1NTK D;  2YO3 A;  2M8N A;  3L75 J;  3W68 A;  3FXD A;  5AVT B;  1VQ5 P;  5APY A;  2R44 A;  5K5G B;  3BAT A;  1EMV A;  3C9I A;  1EXI A;  3KXD A;  3EJD A;  4DCK A;  4QMA A;  1RO0 A;  1PEM A;  4RJT A;  2MF4 A;  2KGE A;  4HKZ H;  4KT0 J;  1RF0 A;  4TT3 H;  4UB6 H;  1NTZ J;  3H32 B;  2AFE A;  1SQX G;  2IBZ I;  2KI7 B;  1RY3 A;  1ZP0 C;  2HLO A;  5HVC A;  4UB8 E;  3BCC G;  2DGY A;  1L4A A;  4N6J A;  1BGY E;  3B5N A;  1FZA A;  4N3Y B;  1JY2 N;  1FJK A;  2D2C D;  3AE6 C;  1GMJ A;  3UIA A;  2O01 J; 
#chains in the Genus database with same CATH homology
 1QVG O;  2BUO A;  2EIA A;  3CD6 P;  2LF4 A;  3G29 A;  4XFZ A;  5DCK A;  5HGN A;  2OTJ P;  3MGE A;  4XRO A;  3CMA P;  5F2O A;  1YHQ P;  1YJ9 P;  3B5I A;  4GR2 A;  3I55 P;  5JPA A;  2CWO A;  2PEM A;  3P05 A;  3G6E P;  4U0B A;  1YIJ P;  2KOD A;  3M1M A;  1VQL P;  2XXM A;  1PEO A;  1Q82 Q;  2L6E A;  1Q81 Q;  3CCM P;  4U0E A;  4QNB A;  1BAJ A;  3NTE A;  1YJN P;  1VQ7 P;  3I56 P;  1VQP P;  1QRJ A;  3DS3 A;  2QEX P;  1QVF O;  2PEN A;  1Q86 Q;  1A8O A;  2XV6 A;  4COP A;  1K30 A;  3CME P;  2Z44 A;  2PEK A;  3G1G A;  3HYB A;  1VQ4 P;  2PEJ A;  1IUQ A;  3G0V A;  1KC8 Q;  2BQ1 E;  2QA4 P;  3G28 A;  1VQM P;  4IPY A;  2PY8 A;  5I4T G;  3CCL P;  3LRY A;  1M6E X;  3CXC O;  5HGM A;  2BHV A;  1EIA A;  2M8N A;  3DS1 A;  3OW2 O;  3E2D A;  1A43 A;  3H47 A;  2Z45 A;  1VQ9 P;  1Q7Y Q;  1M74 A;  3G26 A;  1E6J P;  1AUM A;  1VQ5 P;  3CCV P;  3CC2 P;  3CCJ P;  3CCU P;  2PEQ A;  2EG5 A;  5F2K A;  3G21 A;  3CPW O;  4GR6 A;  3DTJ A;  1VQK P;  2JYL A;  4U0D A;  5HGL A;  1RO0 A;  1RNI A;  1K73 Q;  3CC7 P;  1M1K Q;  5F2N A;  1EOQ A;  1YJW P;  1JJ2 O;  1PEM A;  3CCR P;  2M8L A;  1K8A Q;  3CC4 P;  3WBH A;  4PH1 A;  1YI2 P;  2PEI A;  3DPH A;  3DS4 A;  1M90 Q;  1NJI Q;  2ONT A;  1K9M Q;  4PH0 A;  3H4E A;  5BS2 A;  3CCE P;  4M0I A;  3H0D A;  1VQ6 P;  5HGO A;  2M8P A;  3DS5 A;  4U0C A;  1RO2 A;  2JYG A;  2DGY A;  2OTL P;  4XRQ A;  4WYM A;  5BS1 A;  4U0F A;  1W2B O;  2JO0 A;  1ZMB A;  2P9X A;  1VQ8 P;  4XFY A;  1D1D A;  2EFJ A;  2Z46 A;  2E1M A;  3DS2 A;  3RG6 C;  3CCQ P;  1YIT P;  4U0A A;  4XFX A;  1KD1 Q;  2OAR A;  3G71 P;  1KQS O;  2PEO A;  3G4S P;  3VRL C;  1VQO P;  1PEQ A;  1VQN P;  3DS0 A;  1PEU A;  3HZQ A;  3G1I A;  1M6N A;  3Q20 A;  4COC A;  3CCS P;  1N8R Q;  1S72 P;  2XT1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...