3CCSP

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2482a
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
total genus 45
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3ccsP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 3ccsP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 3ccsP02
1KQSO 3CPWO 3CCUP 2OTJP 1NJIQ 3CCEP 1YIJP 3I55P 3G6EP 1Q86Q 1M1KQ 1VQ7P 1QVGO 1VQLP 3CMEP 3CCVP 1VQOP 1YJ9P 1Q7YQ 1VQ9P 3CC2P 1VQKP 1YJNP 1VQ8P 1VQNP 3CMAP 3OW2O 1VQMP 1KC8Q 1K9MQ 1M90Q 1S72P 3CCQP 1VQ5P 1YHQP 3CC7P 1KD1Q 2OTLP 3CCSP 1YITP 1Q81Q 1YI2P 1K73Q 1W2BO 1K8AQ 3CCLP 1Q82Q 3CCJP 3I56P 3CXCO 3G4SP 1VQ6P 1VQ4P 1QVFO 2QEXP 1YJWP 1JJ2O 3G71P 3CC4P 3CCRP 1VQPP 3CD6P 1N8RQ 2QA4P 3CCMP
chains in the Genus database with same CATH superfamily
3WBHA 2E76D 4GDOA 1JMMA 4WY4B 1LTJB 1GL2B 2KOOA 1MZ9A 3KXDA 3GHGB 2MKVA 3OJAB 1JY2P 2Q9IA 2OYIC 2VLQA 1D1DA 1HWTC 1R5LA 5GTHH 1OVUA 1FAVA 3E1RA 1M56D 1SQBJ 2JP3A 2L22A 2M5AA 3RL0C 2Q5UA 3H6PA 1KTMA 1MFTA 1CEIA 1EMVA 2D2CC 2K94A 2KOPA 1BAJA 2CGQA 4IFMA 2GDYA 5AW1B 3CD6P 3M0DC 1NKZB 3L74D 4HKGA 4GR6A 3G6EP 2VRSA 2H7HA 1VL2A 4DOJA 4H44C 1HQBA 1LT9A 2X2BA 1YI2P 1N86A 3PJSK 3CXCO 2MJZA 1LTIC 3EJDA 1PPJE 2G8YA 2P1JA 3DS5A 1DV5A 2KI7B 1HJ0A 4XRQA 3I55P 3O6QB 1RF1A 4O9BA 3CX5H 1PEUA 2WSFH 5C39A 4ZKPA 4NEOA 1S4XA 1ZMBA 3JC22 3HUSC 3H0DA 3GJNA 4IFFA 4GR2A 2VLNA 1N7SB 1E5WA 2QEXP 1NTMD 5TJHA 2GDXA 5CBOA 4H13C 2GZGA 3H4EA 4ZKUA 2KOQA 3AE7C 4BPHA 1RE3A 1EXIA 5HVCA 3OAKA 2NZ2A 1L0LK 2O01N 1HGZA 4IL6E 1L0ND 5HGLA 4U3FD 4K35A 3V4QA 1SQVG 3SWFA 5BS1A 2W6JH 2HYNA 1ZP0C 1JY2N 2ZAEB 3PH0A 5H2FH 2ZT9B 3L72D 2ZVOB 2OTKE 2MR8A 2QJKC 1J1EC 3GLMA 3CC7P 1G2CA 1RF1C 1NTKK 2Y0EA 3TGUE 3BASA 2Y0DA 2JEEA 4C46A 4NPFX 3RG6C 1IMPA 1WT6A 2JDIH 1PIXA 3EFGA 3BATA 3M0AA 2FACA 4M3LA 1MUUA 2PRRA 3MIWA 3H1JD 4RO0A 5AW0B 1HY8A 3CL3D 4H0LC 1FZFA 4YXDC 2B87A 1EZVE 2QJPC 1IC2A 5K5GB 2LXCB 3L73E 5JPAA 2LIUA 2H43A 1OZHA 2ZYGA 4U0DA 4DT0A 3HE5B 1NQ4A 2KZJA 5KAIE 1N2DC 1OW8A 1PGQA 2CPBA 4PJ0H 1NHLA 1FDMA 2ZYDA 2JYGA 2PEKA 5HGMA 5CZDB 3G4SP 3H1KD 2MF4A 4H44B 4I6MC 2ROQA 1XTGB 5EFWB 4XFZA 3VYIA 4GKGA 3AE4C 4N78E 2Q3IA 4PD4H 2OYHB 5E79H 1FZCC 2O1JA 1GL2D 3M06A 2A45H 2QM8A 1H89A 1NTMG 4DZOA 4BPGA 1A02J 1ZRTE 3CX5I 1SQQK 2ZVNB 3BCCE 2H89C 2Y9ZA 4NPEA 2XZ1C 1PEQA 2B9BA 3AE1C 2FFDA 2ZXEB 2KWLA 2FY8A 2LXBA 1J2JB 2QG4A 3KZIH 2KGCA 1GU5A 1NTZK 1PPJG 4JPZB 1P84E 4GOEA 1VQ4P 2NO8A 3PP5A 1CW5A 3LRYA 5AVUB 1LTGC 2C0XA 2K92A 5AW7B 2MR7A 1NJIQ 1OVRA 3DS0A 1FJKA 5CJ4A 3DTJA 5CCGA 2LF4A 5APVA 4U7JA 5CCHC 4U0AA 1GW4A 3AEBC 1BCCE 2O01J 3JCUH 4WVZA 3HD7B 1KILE 2QIWA 2Z44A 2QJKB 1J1EB 2FYNC 2UWJE 3GKLC 5H2FE 3HRNA 2KUBA 2YKPA 2IZ0A 5L8RJ 3H1JG 5APTA 2PEQA 3T97B 2KG8A 1USDA 2IPPA 2FFDC 2BEZF 1BGYD 2LKMA 1AYIA 3TGUJ 3M1MA 1T8ZA 4IOIH 4K3AA 1FJPA 4LLHA 1N7SD 2MVVA 1PEOA 1HGVA 2FQ1A 3GMAA 3SWYA 2K3RA 3I5CA 1NGMB 1FZGA 2L6EA 1LTAC 2E75C 1SQXE 3TGUG 2QJPB 5DCKA 3H1KG 1IK7A 2KK7A 2DGYA 2AFEA 2ONTA 3L37A 4HJGH 3CI9A 3MGEA 4JF7A 2BASA 2Z4EA 3L73J 2H88C 3B4QA 3CPWO 2ZT9D 1ZW0A 4Y99B 2V7QJ 3O8ZA 4PJ0E 4WB4A 3MP7B 1AVYA 1GD2E 2WSSH 1LTJA 3V2PA 1GL2A 1HUCA 1R5SA 4MN4C 2KODA 2CK3H 3L73G 3GHGA 4PD4I 1FZCB 4GODA 1IFDA 2A45I 1RF0A 4WWIA 1QVGO 1M1JC 2FYUD 2R32A 2K0YA 2GZJA 4QMAA 3F89A 1LP1B 3A3YB 2XU6A 4TLFA 3BCCJ 3P8CD 2EFJA 1SQPD 3AE3C 4HYTB 4EOTA 5KP7B 2KP8A 2Z45A 1MV8A 1PP9E 1G1IA 2WSFJ 1X9VA 4R0MA 3CLQA 4RESB 3AEAC 1K30A 3WMM0 5KLVK 1GK4A 3DS4A 1JEKA 4WY4C 2Q7CA 4H44D 1NWQA 1LTJC 4XFXA 3VN0A 3D6ZA 1RQVA 1BGYG 1BCCJ 2FYNB 3L4FA 2YNYA 2AEMA 1KC8Q 3O6QA 1LT1A 5APQA 3PHLA 5GTIH 2R5DA 2IX7C 2YKQA 1PV3A 2YO2A 3H1HE 1S9KE 1N7SA 1NU1D 3RK3E 1KYOE 2XZ0D 1S5LE 2J5UA 2B88A 4UB6H 1FS0E 1AUMA 4H13D 3V4WA 3DS3A 2N6YA 2AEJA 3WUUA 2E75B 2FVAA 2OARA 3V2NA 2Z5HA 3N7NA 4PH0A 2KW2A 1HVVA 2IBZD 2W83C 5AVWB 1SQXJ 1YYCA 2FXMA 3VP9A 1SQBD 2HFED 2XNDH 2K1AA 2VLOA 2JQ4A 1JY3O 3HD7D 1D7MA 4IZ6A 5APUA 2G3AA 4R4LA 3CXHD 3H1LE 2C9LY 1YBKA 2CG5B 2ZFCA 1JO5A 1URQB 1KN7A 3Q5PA 2WQYC 2GDWA 3A7OA 4GIFA 1LTTC 1JCCA 1VQ9P 1M90Q 3USSA 1FU1A 3VOPA 3EJBA 2M8RA 1YITP 2OYIA 2BEQD 2NRGA 3Q5SA 1SQPG 2WTYA 1ZNVA 1L0HA 1ZR4A 5HV8A 1H88A 3PTZA 4RJTA 1RQUA 3CCVP 1Q7YQ 3LIDA 3CMAP 2FAEA 1VQ5P 3HE5A 3W68A 2JJLA 2AVAA 3S4RA 2ZT9C 3H1IJ 3M0DA 3DS2A 1PP9J 5KAFE 3DPHA 4H2XC 3AE8C 3DS1A 5I4TG 4EYYQ 2Q6QA 2GM4A 2GZFA 4U0EA 2YKOA 2XV5A 4N3YB 2LMLA 1L0LE 1QX8A 3G9RA 1YJNP 2AEFA 3II6A 3KQGA 1IFIA 2XKMA 1GK6A 4EIJA 3CCSP 2YMYA 3B5IA 1PP9G 2KNCB 1IFMA 1NU1G 5AVYB 3FXDA 2J58A 1KB9H 3TNUB 1VQPP 2M8NA 2K2QA 2PEJA 2AXTH 1Q90D 5AW3B 2OTJP 2FQ0A 3HUSA 3E2DA 4AYCA 2WPTA 4Z1MH 1NTKE 1S72P 4I2LC 3AEEC 4L74A 3H1HJ 2IBZG 3GF3A 2BHVA 4W80A 2AFDA 2AF8A 2KOGA 2PP6A 3GG2A 1IJDB 2M3EA 1AQTA 1SQBG 3QH9A 5BU5A 3WU2H 5B5EE 1CZQA 4H2YC 4LGDE 1DD4A 3H1HG 3ABVC 4U0BA 1IUQA 2JKVA 4R4MA 3CWBE 2IFNA 1LTBC 5CCHD 1KV4A 2OYHC 2QNWA 1SQVK 3H32B 5EW5E 2PY8A 1FC2C 1SVFA 1BXIA 4C7NB 3T97A 1JB0J 3OA7A 3AE5C 1Z6MA 2JYLA 2GUSA 3H1LJ 1A02F 5KJ7C 2N50A 4I7ZB 3IN6A 1LNQA 4ZNCA 4IL6X 4C7RA 2O3JA 4JYCA 3KYQA 2PFXA 3PLNA 2R44A 1T8KA 3VMXA 3H1LG 1KILB 1SQQE 3CCJP 3VMAA 4PV1B 2E75D 4XE5B 1PPJD 1GW3A 1EQ7A 3NY7B 2GYKA 2HG5D 3AE9C 1U7JA 1EDIA 3RGUA 2K0XA 1BDCA 3HD7C 2Y0CA 2VSQA 1NTZE 1FDIA 1JOCA 1KQGB 2IYPA 1T3UA 1OIPA 4L75A 7CEIA 1KQLA 4U0CA 1URQD 2KLVA 2LPKA 1L0LJ 1FZCA 1VQNP 2KS1B 1KB9I 1MZ8A 3NMDA 5CMZA 1K73Q 1IK9A 2IDBA 5AVRB 3U1CA 1KB9E 2P10A 1LP1A 2KGAA 5GTHE 1NAFA 1NTMK 3RBXA 3WUVA 3CCMP 2HPCA 4N6JA 2JAZA 2E5TA 2WSEH 1NTKJ 5HGNA 1DEBA 3OW2O 2ITAA 5DJUB 2KGDA 3AEDC 3E7KA 3TGUD 3HE4B 1KFMA 1L0NK 3L36A 2WPRA 2P9XA 4Y99C 1FZBA 3H47A 1EDJA 3G26A 5CCHA 2ZXXA 3CCEP 1KQFB 2PEOA 2P58A 2EHSA 4WY4D 3CE7A 2R3SA 5AW9B 3CWBJ 1M57D 3Q2YA 3HTKB 2KIKA 1EZVD 2N5HA 1YQ3C 2QSIA 3L71E 2GA1A 3L73D 4HB1A 3CX5E 2KYVA 4XA4A 3NXSA 3CWBG 1SS1A 4BXLA 1Q82Q 1Y8AA 2M5AB 2YXRB 2CQ8A 4N78D 4COCA 2Q1KA 1NO4A 3E1IA 1SQQJ 1RE4C 2I1KA 3CCQP 1VPCA 2L4BA 5KTBA 2L0QA 3A2AA 2W27A 1W2BO 1ZRTD 1OFCX 3BCCD 2CWOA 5KLIB 4XFJA 1N8RQ 3RK3B 2QM7A 1URQA 1NTZJ 3P7KA 2IYOA 1UIIA 2JO0A 1OXZA 2LKIA 5KLVE 3G21A 3IF4A 3P05A 4TT3H 1VQ6P 1P84D 4UHPB 3SFDC 1JTHA 1L4AC 3CXHH 3L75E 1M1JA 2CNRA 3BRVB 5CJ0A 3G3ZA 1S1CX 3V2RA 2M3BA 1NTZG 5EJDA 3Q1MA 2E42A 1M6EX 1BCCD 1Q81Q 1KILD 3TDKA 3U43A 5APSA 4AUWA 3M9BA 4PV1D 1JMBA 2GZIA 2CPSA 1IFPA 3S1KA 1M7LA 3AE2C 3CC4P 1K04A 3MGNA 1WMKA 1HH0A 5F2OA 2I1JA 2OYOA 2FVFA 3CMEP 4OWFA 3M9HA 2OQQA 3FGAD 2EIAA 3EQ2A 5BS2A 2C9NY 2QE7H 2JWDA 4ZMDA 1URQC 4WY4A 5AVXB 1EZVG 2ZYAA 3A5TA 2FKWB 1NKNA 3RBZA 1CI6B 2HODB 1W5CE 4W7ZA 1QL2A 2E76B 3LW5H 3L70E 3TNUA 2RH0A 1SQXD 2L5GB 4PD4E 2FYZA 5E79E 1VF5C 2WVRA 3MHVA 1X0TA 2BCCE 2A06E 1YJWP 3L71J 2J59M 3H1IE 1A8OA 3GZMA 4BWNA 1UJZA 2R3CA 1CSBA 3KZIE 2MY5A 1YQ4C 2O1KA 4DG9A 2E74C 3BCCG 1BDDA 1AFOA 1KLPA 3VMZA 1FR2A 1FBMA 1MKMA 2LL8A 1FE6A 3NTNA 3G29A 2RMZA 1FZEA 1M6NA 3JCUE 3H32A 3P8MC 2IBZI 1SFCC 3FWNA 2LIWA 4C7NA 3CCLP 1GPJA 3TK1A 4BRYB 2VLPA 2KSEA 2K9YA 4YXWH 1PP9D 4D6TE 1JY3P 1SP4A 2WPVB 1GXHA 1AVOA 1PL5A 1BCCG 5KJ7D 1GXGA 2LR2A 1JM0A 1TU3F 2OGUA 1L4AB 3CXHI 3EWKA 5KLVJ 2FYUK 1K9MQ 2N1TB 3S9OA 3A0HH 1ZXGA 3L75J 2R5BA 1KILA 2K5XA 1YTZI 3SSUA 3AECC 1SQPK 1QRJA 1T3JA 1FOSE 2M5RA 1VQLP 2WT7B 2QRXA 1KFNA 3VTPC 1EDKA 1Y9BA 5AW5B 2PENA 1KD1Q 4GOFA 1LWUB 3I56P 1OX3A 4I1LA 1JJ2O 3R2PA 2KG6A 1RO2A 3H25A 2QJYB 3H1HD 1FOSF 1S9KD 1X22A 3JSVC 1SQXG 2NPSC 1KYOD 5AVZB 3RK2C 2FQ2A 5KKZC 3UIAA 3ITKA 2P2UA 4I7ZC 2C0WA 2KS1A 1DIPA 1BE3E 3D6YA 2ZJSE 1EC5A 1VF5B 3L70J 1SQVE 1NU1K 1KILC 4KT0J 4PV1C 2EHTA 1NYHA 2BCCJ 2WPQA 4IL6H 4ASWA 2BQ1E 2E5YA 2O01H 1T6AA 3GF7A 1UIXA 3H1LD 4HKZH 1RY3A 2E74B 2PAJA 5APWA 1OR5A 3KDPB 2A45G 3KHUA 1OW6A 4B86A 2BCCG 2N5IA 1SQBK 1JY3N 4OGQC 3L35A 3H1IG 1Y47A 2OYHA 3GW6A 1IZNB 3HTKA 1SFCB 1GZLA 1OW7A 1PZQA 1DX7A 1JCDA 3L74E 2E1MA 1SLQA 4DCKA 2K0DX 4BPFA 2WSCH 5KJ7A 3D71A 1N73B 5F2KA 1S2EA 4JYBA 5GTIE 1EDLA 4Y28J 1ZMEC 2XDJA 1PGOA 1ZR2A 3SFEC 1KORA 1GDTA 4D6TJ 2RKLA 3B5NC 2LOLA 1MFZA 2AXCA 2KZIA 4UB6E 2KLUA 1L0LD 2WITA 5KAIH 1VKUA 2V7QH 3A0HE 3C8VA 2Z5IA 1K8AQ 2FADA 1Q2NA 1H0TB 5AW6B 4D6TG 1NTME 3HD7A 3BVHA 4JQ0D 1X8YA 2Q3EA 2JB0A 2N9YB 1JY2O 1VQ8P 2W6BA 1NTKD 2NPSB 2OTLP 2KR5A 1L0NE 4U3FE 1GMJA 5APYA 2K88A 3RK2B 5KKZB 1HBWA 3CCRP 1G1JA 2M0BA 3D70A 1U57A 3AEGC 4XFYA 2L91A 1IFNA 3VRLC 3L72E 4QNBA 3RL0g 2H8PD 2K9JB 2KORA 2FHSC 3V6IA 1L4AD 2M8PA 1BE3J 1AV1A 1M74A 2N1TD 4CA3A 2K93A 2XT1A 1ACPA 2N9BA 3CWBD 3LW5J 3TSIA 5AVSB 3IR9A 1P84H 1SQVJ 4EDFA 1KZUB 2EG5A 1T2KC 2FXOA 4IFDK 1HJBA 4H2WC 4COPA 4HH2A 1ZLLA 4PWVB 3H1JE 1VQKP 2YIUC 1BE3G 1RNIA 2WMMA 2KGEA 1AF8A 1IMQA 5KLIC 1AJYA 3NFQA 3RK3C 3B71A 1WRGA 2JU1A 1LT9C 3K5BA 4OGQB 1NVOA 5CCGD 3NTEA 1RO0A 2IZ1A 1CI6A 3KPEA 2HODA 5AVQB 4A7PA 4W7YA 3IAOA 1SQQD 1ZOYC 3BRTB 3A0BH 3H1KE 2QVAA 1VF5D 3L74J 2AXTE 3VMYA 1L0LG 1HF9A 3U1AA 5BU8B 1YIJP 1USEA 2OYIB 3B5NB 1EZVI 1NTZD 1ZV8A 1RE3C 2YXQB 3RL0B 5AVTB 1EIAA 3C1LA 1AQ5A 1KMIZ 3L74G 1M8OB 1Z56A 2DNWA 2D2CB 3FWLA 1BSNA 2JBGA 3PRJA 3ZDMA 2E74D 3TF5A 1RE4A 3WU2E 2Z46A 2W8ZA 1X79B 1NTKG 1EOQA 2N98A 4QKOA 2P7JA 3R4YA 1LGHB 4WBAA 2E76C 2Y9YA 1NTMJ 2JO1A 2KB7P 1KB9D 4GT1A 1GTWA 3F5HA 1S3JA 1SFCD 4BRYA 2JWAA 2E43A 5F2NA 1DD3A 4KJMA 2HR3A 1VQMP 1VHNA 1L0NJ 4U3FJ 1PEMA 1NAYA 1L4AA 1JNMA 3MZWB 2N1TA 4PH1A 1QVFO 3HUSB 3L72J 3TYYA 1PFIA 1A43A 1FDOA 1DNYA 1P84I 4RKUJ 1L0NG 4U3FG 4H13B 1BGYE 2WT7A 4YPCA 4ASVA 3LMOA 2PEMA 2W6AA 1DH3A 4F37A 2YIUB 3L72G 3M91A 1LWUA 2KOSA 3L71D 1PGPA 3H1JJ 3W67A 2L9FA 3CX5D 1LT9B 3HYBA 3AE6C 1XTCC 1SQQG 4AQRD 3FX0A 2NPSD 3V2QA 1J1DC 3RK2D 1L0IA 1RF1B 2WWWA 4MRTC 1LJ2A 2N1TC 3Q20A 1KYOH 4OH8B 1S5LH 3HZQA 1NOHA 2POHA 1BSHA 5TISH 2WPSA 3H1KJ 1YTZT 3A0BE 3G1GA 3AEFC 2K37A 1AA0A 3G1IA 1QLED 1E6JP 1RHZB 2WSCJ 4H0LB 2KSJA 3EFFK 2FYUE 1LWUC 1GU4A 1OMIA 2QJYC 4EI2A 5CCGC 5KLVD 4IPYA 5B66H 3V5BA 3P8CE 5AW2B 1SQPE 3L75D 4OGQD 1X3OA 2KNCA 2JU2A 1QGKB 4UB8H 1R8EA 1Q86Q 1SFCA 2YMKA 1G2CB 2ERHA 5AVVB 4WYMA 4PXHB 2V4HA 1LTSC 2W90A 3SWKA 3MUDA 1N73A 2XNXA 1EXJA 5KP8B 1KQSO 4NPDA 4JBZA 1IO4A 2YO3A 1E79H 3B5ND 2KXPB 2B87B 3P32A 1H8AA 1RH5B 2B89A 2DW3A 1HTLC 3RL0D 2HPCB 3L71G 3WUTA 4YTPC 1E0HA 5KAFH 1PGJA 1NU1E 1H0TA 3L70D 2D2CD 2XZRA 2BUOA 1BGYJ 3FXEA 1DEEG 5CBNA 2PGDA 4PD4D 3M9QA 4XROA 2GZEA 1QL1A 5AW8B 1U7MA 2BCCD 2A06D 1W2EA 3C9IA 2NPSA 3MD0A 1N7LA 3MUDC 3H1ID 1S5LX 1GL2C 2IBZE 5AW4B 5KP6B 2PEIA 3GHGC 1ZN5A 1N73C 2JGPA 4M0IA 1J1DB 1K05A 1SQBE 2M8LA 2K9JA 4U0FA 1SQXK 1RF0C 1IFJA 1YHQP 1KYOI 1NH4A 1UNKA 2FFDB 3G28A 2XXMA 3CXHE 2FBWC 1VDFA 3U59A 2FVEA 2N6ZA 3Q3DA 3CCUP 3G0VA 3RG2A 2MD9A 1YJ9P 4L76A 3IFMA 3N4XA 5KLVG 5TISE 1T2KD 2JR8A 5B5EH 4CPGA 5CHXA 3L75G 2RN0A 3G71P 1JUNA 2XV6A 1F80D 2WSEJ 2HLOA 4D6TD 2LTEA 2FYUJ 3RK3D 4L73A 1QEXA 3B4SA 3VP8A 4DJGA 2MVUA 1L2PA 3GZLA 3EJEA 5HGOA 5B66E 3QWOC 2SPZA 1SQPJ 2P67A 2FYUG 2FXPA 2I8DA 2QA4P 4UB8E 1FZAA 1M1KQ 1VQ7P 1VQOP 1N7SC 1OVVA 5BVZA 1JTHB 3LIEA 3B5NA 5M1BA 1M1JB 2IFMA 3L70G 4KHXA 2KG9A 2PNGA 3HE4A 3MTUE 3B8EB 4H0LD 3CC2P 5APXA 4LC1A 3Q5RA 4OVNF 2A06G 1BE3D 2WZ7A 1NU1J 1OWAA 2GUVA 1SQVD 5DJTB
chains in the Genus database with same CATH topology
3WBHA 3CCUP 4XFXA 3G0VA 1A43A 4XFZA 2L6EA 1Q86Q 2PY8A 3CCVP 1YJ9P 1Q7YQ 5HGNA 4WYMA 3CMAP 2JO0A 3OW2O 1KC8Q 5DCKA 1VQ5P 2JYLA 2PEMA 3G21A 5HGLA 1K8AQ 3P05A 2DGYA 2ONTA 1VQ6P 3MGEA 3DS2A 5BS1A 2P9XA 3G71P 2XV6A 1D1DA 3DPHA 1PEQA 3DS1A 5I4TG 3H47A 1KQSO 3CPWO 3G26A 3CCEP 3G29A 4U0EA 1YIJP 2PEOA 3HYBA 1YJNP 1VQ8P 1M6NA 1M6EX 1AUMA 1RO0A 5HGOA 3CC7P 3DS3A 2OTLP 2BQ1E 3CCSP 1Q81Q 3B5IA 3CCLP 3CCJP 2KODA 1EIAA 1BAJA 2OARA 1VQ4P 3RG6C 3LRYA 3CC4P 3CCRP 4PH0A 1VQPP 2M8NA 3CD6P 5F2OA 2PEJA 4XFYA 2QA4P 3VRLC 2OTJP 4QNBA 3Q20A 1NJIQ 3DS0A 2Z46A 4GR6A 3G6EP 1M1KQ 2BUOA 3HZQA 3DTJA 1QVGO 1VQ7P 3CMEP 1VQOP 1EOQA 2LF4A 3E2DA 2EIAA 2M8PA 4U0AA 4XROA 1K9MQ 5BS2A 1S72P 1M74A 2XT1A 1YI2P 1Q82Q 3G1GA 2Z44A 3CXCO 2EFJA 2BHVA 2EG5A 3DS5A 3G1IA 2Z45A 4U0CA 1E6JP 2PEIA 1QRJA 4COPA 2PEQA 2E1MA 4XRQA 5JPAA 4M0IA 3I55P 4U0DA 5F2NA 1VQLP 3CC2P 1VQ9P 1PEUA 1VQKP 1VQNP 4COCA 2M8LA 1RNIA 1ZMBA 4U0FA 1VQMP 3H0DA 1M90Q 2PENA 3CCQP 3M1MA 1YHQP 1KD1Q 5F2KA 1PEMA 1YITP 2JYGA 2PEKA 4IPYA 1K73Q 4GR2A 5HGMA 4U0BA 1IUQA 1K30A 1W2BO 3I56P 3DS4A 3G4SP 4PH1A 3G28A 1QVFO 2QEXP 1PEOA 1YJWP 1JJ2O 2XXMA 1RO2A 2CWOA 1A8OA 1N8RQ 3NTEA 3H4EA 3CCMP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KQS O;  3CPW O;  3CCU P;  2OTJ P;  1NJI Q;  3CCE P;  1YIJ P;  3I55 P;  3G6E P;  1Q86 Q;  1M1K Q;  1VQ7 P;  1QVG O;  1VQL P;  3CME P;  3CCV P;  1VQO P;  1YJ9 P;  1Q7Y Q;  1VQ9 P;  3CC2 P;  1VQK P;  1YJN P;  1VQ8 P;  1VQN P;  3CMA P;  3OW2 O;  1VQM P;  1KC8 Q;  1K9M Q;  1M90 Q;  1S72 P;  3CCQ P;  1VQ5 P;  1YHQ P;  3CC7 P;  1KD1 Q;  2OTL P;  3CCS P;  1YIT P;  1Q81 Q;  1YI2 P;  1K73 Q;  1W2B O;  1K8A Q;  3CCL P;  1Q82 Q;  3CCJ P;  3I56 P;  3CXC O;  3G4S P;  1VQ6 P;  1VQ4 P;  1QVF O;  2QEX P;  1YJW P;  1JJ2 O;  3G71 P;  3CC4 P;  3CCR P;  1VQP P;  3CD6 P;  1N8R Q;  2QA4 P;  3CCM P; 
#chains in the Genus database with same CATH topology
 3WBH A;  2E76 D;  4GDO A;  1JMM A;  4WY4 B;  1LTJ B;  1GL2 B;  2KOO A;  1MZ9 A;  3KXD A;  3GHG B;  2MKV A;  3OJA B;  1JY2 P;  2Q9I A;  2OYI C;  2VLQ A;  1D1D A;  1HWT C;  1R5L A;  5GTH H;  1OVU A;  1FAV A;  3E1R A;  1M56 D;  1SQB J;  2JP3 A;  2L22 A;  2M5A A;  3RL0 C;  2Q5U A;  3H6P A;  1KTM A;  1MFT A;  1CEI A;  1EMV A;  2D2C C;  2K94 A;  2KOP A;  1BAJ A;  2CGQ A;  4IFM A;  2GDY A;  5AW1 B;  3CD6 P;  3M0D C;  1NKZ B;  3L74 D;  4HKG A;  4GR6 A;  3G6E P;  2VRS A;  2H7H A;  1VL2 A;  4DOJ A;  4H44 C;  1HQB A;  1LT9 A;  2X2B A;  1YI2 P;  1N86 A;  3PJS K;  3CXC O;  2MJZ A;  1LTI C;  3EJD A;  1PPJ E;  2G8Y A;  2P1J A;  3DS5 A;  1DV5 A;  2KI7 B;  1HJ0 A;  4XRQ A;  3I55 P;  3O6Q B;  1RF1 A;  4O9B A;  3CX5 H;  1PEU A;  2WSF H;  5C39 A;  4ZKP A;  4NEO A;  1S4X A;  1ZMB A;  3JC2 2;  3HUS C;  3H0D A;  3GJN A;  4IFF A;  4GR2 A;  2VLN A;  1N7S B;  1E5W A;  2QEX P;  1NTM D;  5TJH A;  2GDX A;  5CBO A;  4H13 C;  2GZG A;  3H4E A;  4ZKU A;  2KOQ A;  3AE7 C;  4BPH A;  1RE3 A;  1EXI A;  5HVC A;  3OAK A;  2NZ2 A;  1L0L K;  2O01 N;  1HGZ A;  4IL6 E;  1L0N D;  5HGL A;  4U3F D;  4K35 A;  3V4Q A;  1SQV G;  3SWF A;  5BS1 A;  2W6J H;  2HYN A;  1ZP0 C;  1JY2 N;  2ZAE B;  3PH0 A;  5H2F H;  2ZT9 B;  3L72 D;  2ZVO B;  2OTK E;  2MR8 A;  2QJK C;  1J1E C;  3GLM A;  3CC7 P;  1G2C A;  1RF1 C;  1NTK K;  2Y0E A;  3TGU E;  3BAS A;  2Y0D A;  2JEE A;  4C46 A;  4NPF X;  3RG6 C;  1IMP A;  1WT6 A;  2JDI H;  1PIX A;  3EFG A;  3BAT A;  3M0A A;  2FAC A;  4M3L A;  1MUU A;  2PRR A;  3MIW A;  3H1J D;  4RO0 A;  5AW0 B;  1HY8 A;  3CL3 D;  4H0L C;  1FZF A;  4YXD C;  2B87 A;  1EZV E;  2QJP C;  1IC2 A;  5K5G B;  2LXC B;  3L73 E;  5JPA A;  2LIU A;  2H43 A;  1OZH A;  2ZYG A;  4U0D A;  4DT0 A;  3HE5 B;  1NQ4 A;  2KZJ A;  5KAI E;  1N2D C;  1OW8 A;  1PGQ A;  2CPB A;  4PJ0 H;  1NHL A;  1FDM A;  2ZYD A;  2JYG A;  2PEK A;  5HGM A;  5CZD B;  3G4S P;  3H1K D;  2MF4 A;  4H44 B;  4I6M C;  2ROQ A;  1XTG B;  5EFW B;  4XFZ A;  3VYI A;  4GKG A;  3AE4 C;  4N78 E;  2Q3I A;  4PD4 H;  2OYH B;  5E79 H;  1FZC C;  2O1J A;  1GL2 D;  3M06 A;  2A45 H;  2QM8 A;  1H89 A;  1NTM G;  4DZO A;  4BPG A;  1A02 J;  1ZRT E;  3CX5 I;  1SQQ K;  2ZVN B;  3BCC E;  2H89 C;  2Y9Z A;  4NPE A;  2XZ1 C;  1PEQ A;  2B9B A;  3AE1 C;  2FFD A;  2ZXE B;  2KWL A;  2FY8 A;  2LXB A;  1J2J B;  2QG4 A;  3KZI H;  2KGC A;  1GU5 A;  1NTZ K;  1PPJ G;  4JPZ B;  1P84 E;  4GOE A;  1VQ4 P;  2NO8 A;  3PP5 A;  1CW5 A;  3LRY A;  5AVU B;  1LTG C;  2C0X A;  2K92 A;  5AW7 B;  2MR7 A;  1NJI Q;  1OVR A;  3DS0 A;  1FJK A;  5CJ4 A;  3DTJ A;  5CCG A;  2LF4 A;  5APV A;  4U7J A;  5CCH C;  4U0A A;  1GW4 A;  3AEB C;  1BCC E;  2O01 J;  3JCU H;  4WVZ A;  3HD7 B;  1KIL E;  2QIW A;  2Z44 A;  2QJK B;  1J1E B;  2FYN C;  2UWJ E;  3GKL C;  5H2F E;  3HRN A;  2KUB A;  2YKP A;  2IZ0 A;  5L8R J;  3H1J G;  5APT A;  2PEQ A;  3T97 B;  2KG8 A;  1USD A;  2IPP A;  2FFD C;  2BEZ F;  1BGY D;  2LKM A;  1AYI A;  3TGU J;  3M1M A;  1T8Z A;  4IOI H;  4K3A A;  1FJP A;  4LLH A;  1N7S D;  2MVV A;  1PEO A;  1HGV A;  2FQ1 A;  3GMA A;  3SWY A;  2K3R A;  3I5C A;  1NGM B;  1FZG A;  2L6E A;  1LTA C;  2E75 C;  1SQX E;  3TGU G;  2QJP B;  5DCK A;  3H1K G;  1IK7 A;  2KK7 A;  2DGY A;  2AFE A;  2ONT A;  3L37 A;  4HJG H;  3CI9 A;  3MGE A;  4JF7 A;  2BAS A;  2Z4E A;  3L73 J;  2H88 C;  3B4Q A;  3CPW O;  2ZT9 D;  1ZW0 A;  4Y99 B;  2V7Q J;  3O8Z A;  4PJ0 E;  4WB4 A;  3MP7 B;  1AVY A;  1GD2 E;  2WSS H;  1LTJ A;  3V2P A;  1GL2 A;  1HUC A;  1R5S A;  4MN4 C;  2KOD A;  2CK3 H;  3L73 G;  3GHG A;  4PD4 I;  1FZC B;  4GOD A;  1IFD A;  2A45 I;  1RF0 A;  4WWI A;  1QVG O;  1M1J C;  2FYU D;  2R32 A;  2K0Y A;  2GZJ A;  4QMA A;  3F89 A;  1LP1 B;  3A3Y B;  2XU6 A;  4TLF A;  3BCC J;  3P8C D;  2EFJ A;  1SQP D;  3AE3 C;  4HYT B;  4EOT A;  5KP7 B;  2KP8 A;  2Z45 A;  1MV8 A;  1PP9 E;  1G1I A;  2WSF J;  1X9V A;  4R0M A;  3CLQ A;  4RES B;  3AEA C;  1K30 A;  3WMM 0;  5KLV K;  1GK4 A;  3DS4 A;  1JEK A;  4WY4 C;  2Q7C A;  4H44 D;  1NWQ A;  1LTJ C;  4XFX A;  3VN0 A;  3D6Z A;  1RQV A;  1BGY G;  1BCC J;  2FYN B;  3L4F A;  2YNY A;  2AEM A;  1KC8 Q;  3O6Q A;  1LT1 A;  5APQ A;  3PHL A;  5GTI H;  2R5D A;  2IX7 C;  2YKQ A;  1PV3 A;  2YO2 A;  3H1H E;  1S9K E;  1N7S A;  1NU1 D;  3RK3 E;  1KYO E;  2XZ0 D;  1S5L E;  2J5U A;  2B88 A;  4UB6 H;  1FS0 E;  1AUM A;  4H13 D;  3V4W A;  3DS3 A;  2N6Y A;  2AEJ A;  3WUU A;  2E75 B;  2FVA A;  2OAR A;  3V2N A;  2Z5H A;  3N7N A;  4PH0 A;  2KW2 A;  1HVV A;  2IBZ D;  2W83 C;  5AVW B;  1SQX J;  1YYC A;  2FXM A;  3VP9 A;  1SQB D;  2HFE D;  2XND H;  2K1A A;  2VLO A;  2JQ4 A;  1JY3 O;  3HD7 D;  1D7M A;  4IZ6 A;  5APU A;  2G3A A;  4R4L A;  3CXH D;  3H1L E;  2C9L Y;  1YBK A;  2CG5 B;  2ZFC A;  1JO5 A;  1URQ B;  1KN7 A;  3Q5P A;  2WQY C;  2GDW A;  3A7O A;  4GIF A;  1LTT C;  1JCC A;  1VQ9 P;  1M90 Q;  3USS A;  1FU1 A;  3VOP A;  3EJB A;  2M8R A;  1YIT P;  2OYI A;  2BEQ D;  2NRG A;  3Q5S A;  1SQP G;  2WTY A;  1ZNV A;  1L0H A;  1ZR4 A;  5HV8 A;  1H88 A;  3PTZ A;  4RJT A;  1RQU A;  3CCV P;  1Q7Y Q;  3LID A;  3CMA P;  2FAE A;  1VQ5 P;  3HE5 A;  3W68 A;  2JJL A;  2AVA A;  3S4R A;  2ZT9 C;  3H1I J;  3M0D A;  3DS2 A;  1PP9 J;  5KAF E;  3DPH A;  4H2X C;  3AE8 C;  3DS1 A;  5I4T G;  4EYY Q;  2Q6Q A;  2GM4 A;  2GZF A;  4U0E A;  2YKO A;  2XV5 A;  4N3Y B;  2LML A;  1L0L E;  1QX8 A;  3G9R A;  1YJN P;  2AEF A;  3II6 A;  3KQG A;  1IFI A;  2XKM A;  1GK6 A;  4EIJ A;  3CCS P;  2YMY A;  3B5I A;  1PP9 G;  2KNC B;  1IFM A;  1NU1 G;  5AVY B;  3FXD A;  2J58 A;  1KB9 H;  3TNU B;  1VQP P;  2M8N A;  2K2Q A;  2PEJ A;  2AXT H;  1Q90 D;  5AW3 B;  2OTJ P;  2FQ0 A;  3HUS A;  3E2D A;  4AYC A;  2WPT A;  4Z1M H;  1NTK E;  1S72 P;  4I2L C;  3AEE C;  4L74 A;  3H1H J;  2IBZ G;  3GF3 A;  2BHV A;  4W80 A;  2AFD A;  2AF8 A;  2KOG A;  2PP6 A;  3GG2 A;  1IJD B;  2M3E A;  1AQT A;  1SQB G;  3QH9 A;  5BU5 A;  3WU2 H;  5B5E E;  1CZQ A;  4H2Y C;  4LGD E;  1DD4 A;  3H1H G;  3ABV C;  4U0B A;  1IUQ A;  2JKV A;  4R4M A;  3CWB E;  2IFN A;  1LTB C;  5CCH D;  1KV4 A;  2OYH C;  2QNW A;  1SQV K;  3H32 B;  5EW5 E;  2PY8 A;  1FC2 C;  1SVF A;  1BXI A;  4C7N B;  3T97 A;  1JB0 J;  3OA7 A;  3AE5 C;  1Z6M A;  2JYL A;  2GUS A;  3H1L J;  1A02 F;  5KJ7 C;  2N50 A;  4I7Z B;  3IN6 A;  1LNQ A;  4ZNC A;  4IL6 X;  4C7R A;  2O3J A;  4JYC A;  3KYQ A;  2PFX A;  3PLN A;  2R44 A;  1T8K A;  3VMX A;  3H1L G;  1KIL B;  1SQQ E;  3CCJ P;  3VMA A;  4PV1 B;  2E75 D;  4XE5 B;  1PPJ D;  1GW3 A;  1EQ7 A;  3NY7 B;  2GYK A;  2HG5 D;  3AE9 C;  1U7J A;  1EDI A;  3RGU A;  2K0X A;  1BDC A;  3HD7 C;  2Y0C A;  2VSQ A;  1NTZ E;  1FDI A;  1JOC A;  1KQG B;  2IYP A;  1T3U A;  1OIP A;  4L75 A;  7CEI A;  1KQL A;  4U0C A;  1URQ D;  2KLV A;  2LPK A;  1L0L J;  1FZC A;  1VQN P;  2KS1 B;  1KB9 I;  1MZ8 A;  3NMD A;  5CMZ A;  1K73 Q;  1IK9 A;  2IDB A;  5AVR B;  3U1C A;  1KB9 E;  2P10 A;  1LP1 A;  2KGA A;  5GTH E;  1NAF A;  1NTM K;  3RBX A;  3WUV A;  3CCM P;  2HPC A;  4N6J A;  2JAZ A;  2E5T A;  2WSE H;  1NTK J;  5HGN A;  1DEB A;  3OW2 O;  2ITA A;  5DJU B;  2KGD A;  3AED C;  3E7K A;  3TGU D;  3HE4 B;  1KFM A;  1L0N K;  3L36 A;  2WPR A;  2P9X A;  4Y99 C;  1FZB A;  3H47 A;  1EDJ A;  3G26 A;  5CCH A;  2ZXX A;  3CCE P;  1KQF B;  2PEO A;  2P58 A;  2EHS A;  4WY4 D;  3CE7 A;  2R3S A;  5AW9 B;  3CWB J;  1M57 D;  3Q2Y A;  3HTK B;  2KIK A;  1EZV D;  2N5H A;  1YQ3 C;  2QSI A;  3L71 E;  2GA1 A;  3L73 D;  4HB1 A;  3CX5 E;  2KYV A;  4XA4 A;  3NXS A;  3CWB G;  1SS1 A;  4BXL A;  1Q82 Q;  1Y8A A;  2M5A B;  2YXR B;  2CQ8 A;  4N78 D;  4COC A;  2Q1K A;  1NO4 A;  3E1I A;  1SQQ J;  1RE4 C;  2I1K A;  3CCQ P;  1VPC A;  2L4B A;  5KTB A;  2L0Q A;  3A2A A;  2W27 A;  1W2B O;  1ZRT D;  1OFC X;  3BCC D;  2CWO A;  5KLI B;  4XFJ A;  1N8R Q;  3RK3 B;  2QM7 A;  1URQ A;  1NTZ J;  3P7K A;  2IYO A;  1UII A;  2JO0 A;  1OXZ A;  2LKI A;  5KLV E;  3G21 A;  3IF4 A;  3P05 A;  4TT3 H;  1VQ6 P;  1P84 D;  4UHP B;  3SFD C;  1JTH A;  1L4A C;  3CXH H;  3L75 E;  1M1J A;  2CNR A;  3BRV B;  5CJ0 A;  3G3Z A;  1S1C X;  3V2R A;  2M3B A;  1NTZ G;  5EJD A;  3Q1M A;  2E42 A;  1M6E X;  1BCC D;  1Q81 Q;  1KIL D;  3TDK A;  3U43 A;  5APS A;  4AUW A;  3M9B A;  4PV1 D;  1JMB A;  2GZI A;  2CPS A;  1IFP A;  3S1K A;  1M7L A;  3AE2 C;  3CC4 P;  1K04 A;  3MGN A;  1WMK A;  1HH0 A;  5F2O A;  2I1J A;  2OYO A;  2FVF A;  3CME P;  4OWF A;  3M9H A;  2OQQ A;  3FGA D;  2EIA A;  3EQ2 A;  5BS2 A;  2C9N Y;  2QE7 H;  2JWD A;  4ZMD A;  1URQ C;  4WY4 A;  5AVX B;  1EZV G;  2ZYA A;  3A5T A;  2FKW B;  1NKN A;  3RBZ A;  1CI6 B;  2HOD B;  1W5C E;  4W7Z A;  1QL2 A;  2E76 B;  3LW5 H;  3L70 E;  3TNU A;  2RH0 A;  1SQX D;  2L5G B;  4PD4 E;  2FYZ A;  5E79 E;  1VF5 C;  2WVR A;  3MHV A;  1X0T A;  2BCC E;  2A06 E;  1YJW P;  3L71 J;  2J59 M;  3H1I E;  1A8O A;  3GZM A;  4BWN A;  1UJZ A;  2R3C A;  1CSB A;  3KZI E;  2MY5 A;  1YQ4 C;  2O1K A;  4DG9 A;  2E74 C;  3BCC G;  1BDD A;  1AFO A;  1KLP A;  3VMZ A;  1FR2 A;  1FBM A;  1MKM A;  2LL8 A;  1FE6 A;  3NTN A;  3G29 A;  2RMZ A;  1FZE A;  1M6N A;  3JCU E;  3H32 A;  3P8M C;  2IBZ I;  1SFC C;  3FWN A;  2LIW A;  4C7N A;  3CCL P;  1GPJ A;  3TK1 A;  4BRY B;  2VLP A;  2KSE A;  2K9Y A;  4YXW H;  1PP9 D;  4D6T E;  1JY3 P;  1SP4 A;  2WPV B;  1GXH A;  1AVO A;  1PL5 A;  1BCC G;  5KJ7 D;  1GXG A;  2LR2 A;  1JM0 A;  1TU3 F;  2OGU A;  1L4A B;  3CXH I;  3EWK A;  5KLV J;  2FYU K;  1K9M Q;  2N1T B;  3S9O A;  3A0H H;  1ZXG A;  3L75 J;  2R5B A;  1KIL A;  2K5X A;  1YTZ I;  3SSU A;  3AEC C;  1SQP K;  1QRJ A;  1T3J A;  1FOS E;  2M5R A;  1VQL P;  2WT7 B;  2QRX A;  1KFN A;  3VTP C;  1EDK A;  1Y9B A;  5AW5 B;  2PEN A;  1KD1 Q;  4GOF A;  1LWU B;  3I56 P;  1OX3 A;  4I1L A;  1JJ2 O;  3R2P A;  2KG6 A;  1RO2 A;  3H25 A;  2QJY B;  3H1H D;  1FOS F;  1S9K D;  1X22 A;  3JSV C;  1SQX G;  2NPS C;  1KYO D;  5AVZ B;  3RK2 C;  2FQ2 A;  5KKZ C;  3UIA A;  3ITK A;  2P2U A;  4I7Z C;  2C0W A;  2KS1 A;  1DIP A;  1BE3 E;  3D6Y A;  2ZJS E;  1EC5 A;  1VF5 B;  3L70 J;  1SQV E;  1NU1 K;  1KIL C;  4KT0 J;  4PV1 C;  2EHT A;  1NYH A;  2BCC J;  2WPQ A;  4IL6 H;  4ASW A;  2BQ1 E;  2E5Y A;  2O01 H;  1T6A A;  3GF7 A;  1UIX A;  3H1L D;  4HKZ H;  1RY3 A;  2E74 B;  2PAJ A;  5APW A;  1OR5 A;  3KDP B;  2A45 G;  3KHU A;  1OW6 A;  4B86 A;  2BCC G;  2N5I A;  1SQB K;  1JY3 N;  4OGQ C;  3L35 A;  3H1I G;  1Y47 A;  2OYH A;  3GW6 A;  1IZN B;  3HTK A;  1SFC B;  1GZL A;  1OW7 A;  1PZQ A;  1DX7 A;  1JCD A;  3L74 E;  2E1M A;  1SLQ A;  4DCK A;  2K0D X;  4BPF A;  2WSC H;  5KJ7 A;  3D71 A;  1N73 B;  5F2K A;  1S2E A;  4JYB A;  5GTI E;  1EDL A;  4Y28 J;  1ZME C;  2XDJ A;  1PGO A;  1ZR2 A;  3SFE C;  1KOR A;  1GDT A;  4D6T J;  2RKL A;  3B5N C;  2LOL A;  1MFZ A;  2AXC A;  2KZI A;  4UB6 E;  2KLU A;  1L0L D;  2WIT A;  5KAI H;  1VKU A;  2V7Q H;  3A0H E;  3C8V A;  2Z5I A;  1K8A Q;  2FAD A;  1Q2N A;  1H0T B;  5AW6 B;  4D6T G;  1NTM E;  3HD7 A;  3BVH A;  4JQ0 D;  1X8Y A;  2Q3E A;  2JB0 A;  2N9Y B;  1JY2 O;  1VQ8 P;  2W6B A;  1NTK D;  2NPS B;  2OTL P;  2KR5 A;  1L0N E;  4U3F E;  1GMJ A;  5APY A;  2K88 A;  3RK2 B;  5KKZ B;  1HBW A;  3CCR P;  1G1J A;  2M0B A;  3D70 A;  1U57 A;  3AEG C;  4XFY A;  2L91 A;  1IFN A;  3VRL C;  3L72 E;  4QNB A;  3RL0 g;  2H8P D;  2K9J B;  2KOR A;  2FHS C;  3V6I A;  1L4A D;  2M8P A;  1BE3 J;  1AV1 A;  1M74 A;  2N1T D;  4CA3 A;  2K93 A;  2XT1 A;  1ACP A;  2N9B A;  3CWB D;  3LW5 J;  3TSI A;  5AVS B;  3IR9 A;  1P84 H;  1SQV J;  4EDF A;  1KZU B;  2EG5 A;  1T2K C;  2FXO A;  4IFD K;  1HJB A;  4H2W C;  4COP A;  4HH2 A;  1ZLL A;  4PWV B;  3H1J E;  1VQK P;  2YIU C;  1BE3 G;  1RNI A;  2WMM A;  2KGE A;  1AF8 A;  1IMQ A;  5KLI C;  1AJY A;  3NFQ A;  3RK3 C;  3B71 A;  1WRG A;  2JU1 A;  1LT9 C;  3K5B A;  4OGQ B;  1NVO A;  5CCG D;  3NTE A;  1RO0 A;  2IZ1 A;  1CI6 A;  3KPE A;  2HOD A;  5AVQ B;  4A7P A;  4W7Y A;  3IAO A;  1SQQ D;  1ZOY C;  3BRT B;  3A0B H;  3H1K E;  2QVA A;  1VF5 D;  3L74 J;  2AXT E;  3VMY A;  1L0L G;  1HF9 A;  3U1A A;  5BU8 B;  1YIJ P;  1USE A;  2OYI B;  3B5N B;  1EZV I;  1NTZ D;  1ZV8 A;  1RE3 C;  2YXQ B;  3RL0 B;  5AVT B;  1EIA A;  3C1L A;  1AQ5 A;  1KMI Z;  3L74 G;  1M8O B;  1Z56 A;  2DNW A;  2D2C B;  3FWL A;  1BSN A;  2JBG A;  3PRJ A;  3ZDM A;  2E74 D;  3TF5 A;  1RE4 A;  3WU2 E;  2Z46 A;  2W8Z A;  1X79 B;  1NTK G;  1EOQ A;  2N98 A;  4QKO A;  2P7J A;  3R4Y A;  1LGH B;  4WBA A;  2E76 C;  2Y9Y A;  1NTM J;  2JO1 A;  2KB7 P;  1KB9 D;  4GT1 A;  1GTW A;  3F5H A;  1S3J A;  1SFC D;  4BRY A;  2JWA A;  2E43 A;  5F2N A;  1DD3 A;  4KJM A;  2HR3 A;  1VQM P;  1VHN A;  1L0N J;  4U3F J;  1PEM A;  1NAY A;  1L4A A;  1JNM A;  3MZW B;  2N1T A;  4PH1 A;  1QVF O;  3HUS B;  3L72 J;  3TYY A;  1PFI A;  1A43 A;  1FDO A;  1DNY A;  1P84 I;  4RKU J;  1L0N G;  4U3F G;  4H13 B;  1BGY E;  2WT7 A;  4YPC A;  4ASV A;  3LMO A;  2PEM A;  2W6A A;  1DH3 A;  4F37 A;  2YIU B;  3L72 G;  3M91 A;  1LWU A;  2KOS A;  3L71 D;  1PGP A;  3H1J J;  3W67 A;  2L9F A;  3CX5 D;  1LT9 B;  3HYB A;  3AE6 C;  1XTC C;  1SQQ G;  4AQR D;  3FX0 A;  2NPS D;  3V2Q A;  1J1D C;  3RK2 D;  1L0I A;  1RF1 B;  2WWW A;  4MRT C;  1LJ2 A;  2N1T C;  3Q20 A;  1KYO H;  4OH8 B;  1S5L H;  3HZQ A;  1NOH A;  2POH A;  1BSH A;  5TIS H;  2WPS A;  3H1K J;  1YTZ T;  3A0B E;  3G1G A;  3AEF C;  2K37 A;  1AA0 A;  3G1I A;  1QLE D;  1E6J P;  1RHZ B;  2WSC J;  4H0L B;  2KSJ A;  3EFF K;  2FYU E;  1LWU C;  1GU4 A;  1OMI A;  2QJY C;  4EI2 A;  5CCG C;  5KLV D;  4IPY A;  5B66 H;  3V5B A;  3P8C E;  5AW2 B;  1SQP E;  3L75 D;  4OGQ D;  1X3O A;  2KNC A;  2JU2 A;  1QGK B;  4UB8 H;  1R8E A;  1Q86 Q;  1SFC A;  2YMK A;  1G2C B;  2ERH A;  5AVV B;  4WYM A;  4PXH B;  2V4H A;  1LTS C;  2W90 A;  3SWK A;  3MUD A;  1N73 A;  2XNX A;  1EXJ A;  5KP8 B;  1KQS O;  4NPD A;  4JBZ A;  1IO4 A;  2YO3 A;  1E79 H;  3B5N D;  2KXP B;  2B87 B;  3P32 A;  1H8A A;  1RH5 B;  2B89 A;  2DW3 A;  1HTL C;  3RL0 D;  2HPC B;  3L71 G;  3WUT A;  4YTP C;  1E0H A;  5KAF H;  1PGJ A;  1NU1 E;  1H0T A;  3L70 D;  2D2C D;  2XZR A;  2BUO A;  1BGY J;  3FXE A;  1DEE G;  5CBN A;  2PGD A;  4PD4 D;  3M9Q A;  4XRO A;  2GZE A;  1QL1 A;  5AW8 B;  1U7M A;  2BCC D;  2A06 D;  1W2E A;  3C9I A;  2NPS A;  3MD0 A;  1N7L A;  3MUD C;  3H1I D;  1S5L X;  1GL2 C;  2IBZ E;  5AW4 B;  5KP6 B;  2PEI A;  3GHG C;  1ZN5 A;  1N73 C;  2JGP A;  4M0I A;  1J1D B;  1K05 A;  1SQB E;  2M8L A;  2K9J A;  4U0F A;  1SQX K;  1RF0 C;  1IFJ A;  1YHQ P;  1KYO I;  1NH4 A;  1UNK A;  2FFD B;  3G28 A;  2XXM A;  3CXH E;  2FBW C;  1VDF A;  3U59 A;  2FVE A;  2N6Z A;  3Q3D A;  3CCU P;  3G0V A;  3RG2 A;  2MD9 A;  1YJ9 P;  4L76 A;  3IFM A;  3N4X A;  5KLV G;  5TIS E;  1T2K D;  2JR8 A;  5B5E H;  4CPG A;  5CHX A;  3L75 G;  2RN0 A;  3G71 P;  1JUN A;  2XV6 A;  1F80 D;  2WSE J;  2HLO A;  4D6T D;  2LTE A;  2FYU J;  3RK3 D;  4L73 A;  1QEX A;  3B4S A;  3VP8 A;  4DJG A;  2MVU A;  1L2P A;  3GZL A;  3EJE A;  5HGO A;  5B66 E;  3QWO C;  2SPZ A;  1SQP J;  2P67 A;  2FYU G;  2FXP A;  2I8D A;  2QA4 P;  4UB8 E;  1FZA A;  1M1K Q;  1VQ7 P;  1VQO P;  1N7S C;  1OVV A;  5BVZ A;  1JTH B;  3LIE A;  3B5N A;  5M1B A;  1M1J B;  2IFM A;  3L70 G;  4KHX A;  2KG9 A;  2PNG A;  3HE4 A;  3MTU E;  3B8E B;  4H0L D;  3CC2 P;  5APX A;  4LC1 A;  3Q5R A;  4OVN F;  2A06 G;  1BE3 D;  2WZ7 A;  1NU1 J;  1OWA A;  2GUV A;  1SQV D;  5DJT B; 
#chains in the Genus database with same CATH homology
 3WBH A;  3CCU P;  4XFX A;  3G0V A;  1A43 A;  4XFZ A;  2L6E A;  1Q86 Q;  2PY8 A;  3CCV P;  1YJ9 P;  1Q7Y Q;  5HGN A;  4WYM A;  3CMA P;  2JO0 A;  3OW2 O;  1KC8 Q;  5DCK A;  1VQ5 P;  2JYL A;  2PEM A;  3G21 A;  5HGL A;  1K8A Q;  3P05 A;  2DGY A;  2ONT A;  1VQ6 P;  3MGE A;  3DS2 A;  5BS1 A;  2P9X A;  3G71 P;  2XV6 A;  1D1D A;  3DPH A;  1PEQ A;  3DS1 A;  5I4T G;  3H47 A;  1KQS O;  3CPW O;  3G26 A;  3CCE P;  3G29 A;  4U0E A;  1YIJ P;  2PEO A;  3HYB A;  1YJN P;  1VQ8 P;  1M6N A;  1M6E X;  1AUM A;  1RO0 A;  5HGO A;  3CC7 P;  3DS3 A;  2OTL P;  2BQ1 E;  3CCS P;  1Q81 Q;  3B5I A;  3CCL P;  3CCJ P;  2KOD A;  1EIA A;  1BAJ A;  2OAR A;  1VQ4 P;  3RG6 C;  3LRY A;  3CC4 P;  3CCR P;  4PH0 A;  1VQP P;  2M8N A;  3CD6 P;  5F2O A;  2PEJ A;  4XFY A;  2QA4 P;  3VRL C;  2OTJ P;  4QNB A;  3Q20 A;  1NJI Q;  3DS0 A;  2Z46 A;  4GR6 A;  3G6E P;  1M1K Q;  2BUO A;  3HZQ A;  3DTJ A;  1QVG O;  1VQ7 P;  3CME P;  1VQO P;  1EOQ A;  2LF4 A;  3E2D A;  2EIA A;  2M8P A;  4U0A A;  4XRO A;  1K9M Q;  5BS2 A;  1S72 P;  1M74 A;  2XT1 A;  1YI2 P;  1Q82 Q;  3G1G A;  2Z44 A;  3CXC O;  2EFJ A;  2BHV A;  2EG5 A;  3DS5 A;  3G1I A;  2Z45 A;  4U0C A;  1E6J P;  2PEI A;  1QRJ A;  4COP A;  2PEQ A;  2E1M A;  4XRQ A;  5JPA A;  4M0I A;  3I55 P;  4U0D A;  5F2N A;  1VQL P;  3CC2 P;  1VQ9 P;  1PEU A;  1VQK P;  1VQN P;  4COC A;  2M8L A;  1RNI A;  1ZMB A;  4U0F A;  1VQM P;  3H0D A;  1M90 Q;  2PEN A;  3CCQ P;  3M1M A;  1YHQ P;  1KD1 Q;  5F2K A;  1PEM A;  1YIT P;  2JYG A;  2PEK A;  4IPY A;  1K73 Q;  4GR2 A;  5HGM A;  4U0B A;  1IUQ A;  1K30 A;  1W2B O;  3I56 P;  3DS4 A;  3G4S P;  4PH1 A;  3G28 A;  1QVF O;  2QEX P;  1PEO A;  1YJW P;  1JJ2 O;  2XXM A;  1RO2 A;  2CWO A;  1A8O A;  1N8R Q;  3NTE A;  3H4E A;  3CCM P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...