3CCSP

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2482a
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 45
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3ccsP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 3ccsP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 3ccsP02
1YITP 3G6EP 1K8AQ 1VQKP 3CD6P 1VQOP 1YJNP 1Q82Q 3CCUP 1NJIQ 1VQ4P 1VQNP 3CCSP 2OTLP 1KD1Q 1S72P 2OTJP 1QVFO 1YJWP 1YHQP 1M1KQ 1KC8Q 1Q7YQ 1VQPP 1VQ6P 1JJ2O 3CXCO 3G4SP 3CCRP 3CCVP 1YI2P 1K73Q 3I56P 1KQSO 1VQLP 3G71P 3CCEP 3CCLP 3CCMP 1QVGO 3CCJP 1VQMP 1K9MQ 3CC4P 3CCQP 3CC2P 1N8RQ 1YIJP 3I55P 1W2BO 1VQ7P 3CC7P 1M90Q 2QEXP 3CMAP 3CPWO 1YJ9P 1Q81Q 1VQ5P 2QA4P 1Q86Q 1VQ9P 3OW2O 1VQ8P 3CMEP
chains in the Genus database with same CATH superfamily
2H8PD 3G9RA 1MZ9A 1LWUB 1MV8A 4GOFA 4IL6X 2JBGA 5KKZC 1F80D 2VSQA 2E74D 4IL6E 1FZCB 3T97B 3JSVC 4EYYQ 3OW2O 2PNGA 3E1IA 5AVWB 1QL2A 2XNDH 2GDYA 1JCDA 1PFIA 2QJYB 1ZR2A 3O6QA 1BCCJ 1LP1B 2QJPC 1QVGO 1RNIA 4N78D 1WT6A 3H6PA 1NTMJ 1JUNA 1CI6B 1AV1A 3FXDA 1LTAC 4KJMA 1ZW0A 4H44C 3A2AA 1SQBG 4U0CA 2WPRA 2CWOA 2IYOA 4OH8B 1OWAA 1PGOA 3CX5D 1T8ZA 4BPFA 3DS1A 1OX3A 1NTMD 1IFMA 4U3FG 1YYCA 3L73G 4PJ0H 1DNYA 3VMXA 2Q7CA 1MKMA 1X9VA 3RK3B 1NU1G 4JYBA 3MP7B 1KORA 5KLVJ 2ZAEB 2WSEH 3HYBA 3WMM0 3D71A 1BSNA 1OFCX 2ZYAA 2MD9A 2K9YA 2Y0DA 3P8CE 3CCQP 2ZXXA 1IMPA 1SQVG 2N1TC 2V4HA 3B5IA 2H43A 1DV5A 3EFFK 1ZRTD 1J1DB 4CA3A 1GK6A 2QE7H 1AF8A 3L71D 2M5AA 3LIEA 2J59M 3L75D 1BDCA 1NTZJ 2E75D 2WITA 1KILA 5APSA 2KS1A 2XNXA 1X0TA 2N6ZA 2JYGA 1FOSF 2KOPA 5KKZB 5TISH 3H1KD 2P1JA 2KI7B 2E5YA 3L70D 2K0DX 1DEEG 3N4XA 2I8DA 2L6EA 2QJPB 1IO4A 2FACA 2L5GB 3M0DA 1BGYJ 2XV6A 1YBKA 1IJDB 3TGUE 4WY4D 4H44B 3BCCE 5KLIC 3U59A 3I5CA 1YIJP 2ZFCA 1N7SA 4QKOA 3CMEP 1JTHA 3TYYA 2GZFA 2XDJA 3VMZA 2WPSA 1YJWP 2NZ2A 3SWFA 1BGYD 3CCVP 3I56P 3CXHD 2KYVA 1L0NE 3CCLP 1JM0A 1KLPA 3L72D 1IK7A 1EQ7A 4D6TE 1EZVE 5APQA 2BCCJ 5DJUB 3AECC 3VMYA 2M8LA 3A5TA 1KQLA 4ZNCA 3HRNA 2Z44A 5CJ4A 4WBAA 2Y9ZA 3AEBC 5KAFH 2ZVNB 3L37A 1FZAA 3L73J 4BRYB 5EJDA 1U7JA 3AEEC 1T6AA 1BSHA 3WU2E 2BCCD 3AE8C 2P10A 1VQNP 3PP5A 1LJ2A 5KAIE 3P05A 2OYHA 3ABVC 3CCMP 2PY8A 1NVOA 4N6JA 1SQVJ 1KILE 1M90Q 2JWDA 3Q5RA 1H89A 3E1RA 1FS0E 3W67A 3USSA 1VDFA 4F37A 2KIKA 1AA0A 3F5HA 2BEQD 5HGMA 4PD4H 3KXDA 1RQUA 3CCUP 4R4LA 1GU4A 2FKWB 1DD3A 2PEIA 4OGQD 3M06A 3PLNA 2JO0A 2L0QA 1G2CB 3P8MC 1NYHA 3TGUG 3D6ZA 1HJ0A 1DEBA 1JY3O 1NHLA 2LIWA 3BCCG 3RG2A 3V2NA 4BXLA 3BRVB 4LLHA 2CK3H 1KILC 2XT1A 2ERHA 2HPCA 2M8PA 3A0HE 4N78E 2L4BA 1M8OB 1ACPA 1L0NG 3H32B 3V2RA 2RMZA 1LP1A 4HB1A 4JBZA 3GF3A 1NGMB 2JEEA 2M3BA 4D6TG 5GTIE 1EZVG 2E76C 3O6QB 5GTHE 2RH0A 2N5IA 1U7MA 2GDXA 2HG5D 3M0DC 3CX5E 1AJYA 5CZDB 1NTME 1R5SA 2LKIA 3DS4A 2AFEA 3SWYA 2Q6QA 1N7SC 2GZIA 4DZOA 3G3ZA 3PRJA 1JOCA 1PPJE 1ZP0C 3MZWB 1L4AD 1JO5A 5BS1A 2KG6A 4IL6H 2Q9IA 3TSIA 1EZVI 2GUVA 5CCHA 3VN0A 5I4TG 4C7RA 1ZRTE 3HE4A 1L2PA 3L71E 3L75E 2KK7A 2D2CD 1T2KD 2CPSA 3L74J 1RO2A 2N9YB 3M9BA 2GDWA 2YKOA 3V2QA 2MR8A 4HKGA 3UIAA 2Q1KA 2B88A 3M1MA 1YITP 1Z56A 2RN0A 2KZIA 1E79H 3H1KE 5AW3B 2WSFJ 2KLUA 1QEXA 3QH9A 4GIFA 2FFDA 1JY3N 2KP8A 1KILB 1EXIA 3L74D 3HD7D 2KB7P 3SSUA 2OYHC 3L70E 1EDKA 4EIJA 2NPSD 2E75C 1PIXA 1Q82Q 1VQ4P 4L76A 5AW5B 2KGDA 2JQ4A 1KB9I 1Y47A 5AW4B 3TGUJ 2Z45A 3GKLC 4C7NA 4RKUJ 3BCCJ 3V2PA 2E76B 1JY3P 2WPVB 3L4FA 1HGZA 1NTMG 4GKGA 1LT9A 1FDIA 1ZXGA 2V7QH 1USEA 2IDBA 1S5LX 4WVZA 1GZLA 2DGYA 1BGYE 1S5LE 3CXHE 1AVOA 5AW7B 3L72E 1L0NJ 4H2YC 1AYIA 4I6MC 4WY4C 1N7SB 3VMAA 1JTHB 1PPJG 2EHTA 3Q2YA 4HKZH 3V5BA 2BQ1E 3GHGA 1ZOYC 1FE6A 2YKPA 2GZEA 2C0XA 4NPEA 2WSFH 1SQQK 1GMJA 4H0LD 1Q7YQ 1N2DC 5E79H 5JPAA 3L71G 3CX5I 3L75G 1KYOI 1OZHA 2M5RA 2FXMA 1KV4A 2JWAA 2BCCE 1EZVD 1NTKK 3H1KG 5HVCA 3PHLA 3AEAC 3VOPA 3RBXA 2FYZA 1LTIC 2WSCJ 2C9NY 2KLVA 4BPHA 1QX8A 3L70G 3KHUA 3HE5B 1AQTA 2MY5A 1VQKP 5CCHC 1HQBA 1KFMA 2KG9A 3II6A 3AE9C 3Q20A 2E75B 2XZRA 2K37A 1NAYA 1EMVA 1Q86Q 1PGQA 5KP8B 1R5LA 2OTLP 1PL5A 1PEOA 4DOJA 5BVZA 1CSBA 1Q2NA 1KB9D 4OGQC 2R32A 2JJLA 1QRJA 1BGYG 1EDIA 1SQBK 1GDTA 2MKVA 2FFDC 5KP7B 4I2LC 3NTNA 1ZN5A 3L72G 3EFGA 5CBOA 2WMMA 3WU2H 3H32A 5AW6B 5AW8B 4WY4B 2HPCB 1YTZT 1PEUA 2EIAA 3EJDA 1KQGB 2AXTE 5CJ0A 2NRGA 5KAIH 2FVAA 3B5ND 2KUBA 4EOTA 3BASA 1NU1K 3Q3DA 2WSCH 1N8RQ 1HTLC 1RE4A 1HJBA 4GR2A 2I1KA 3O8ZA 1KTMA 2H89C 1NQ4A 1UNKA 3FX0A 2BCCG 4BWNA 1SQXK 1LTJA 1LT9C 1S3JA 2Z5HA 4XFZA 2LL8A 2LKMA 3CXHI 2PRRA 4XROA 5DJTB 4EI2A 2R3CA 2KOQA 1E6JP 5EFWB 4PXHB 1GW3A 2W8ZA 1KYOD 3RL0D 2QVAA 5HGLA 4YXWH 2YMKA 4IZ6A 4XFXA 1T3JA 1SFCD 3GHGC 5APYA 2FYUK 2K9JA 3U1AA 3L71J 1IUQA 3L75J 3A0HH 2JGPA 3NMDA 1SQPK 2PEQA 2EHSA 3CCJP 2WPTA 1PPJD 3AE5C 1W2BO 1OW8A 3HE4B 2VRSA 5GTIH 3MHVA 3RK2D 1OVRA 1RHZB 4BPGA 2ZT9C 1HUCA 1IMQA 5GTHH 3TDKA 3H1KJ 1PGPA 2AXCA 3CCEP 4WB4A 3CX5H 3L74E 2ZYDA 2D2CC 1T2KC 2HLOA 3L70J 1OVVA 4DCKA 3G1GA 2DNWA 2E5TA 1IFPA 1PZQA 2LOLA 3Q5SA 4OGQB 1K8AQ 2FFDB 2YXQB 1FJKA 3FWLA 1KD1Q 3MGNA 1VQ6P 5HGNA 5E79E 2M3EA 3V4WA 3G26A 3BVHA 3E7KA 2QNWA 3CMAP 3CI9A 2JYLA 2O01J 3H1HD 2JAZA 4MRTC 1KZUB 2FQ2A 4C7NB 2A45G 1ZLLA 3B5NA 2L91A 1IFDA 2P58A 1L0LK 2SPZA 3L72J 3PTZA 1NKZB 2KW2A 1LT9B 2WVRA 2WZ7A 4IOIH 3M0AA 3H1JD 2MVVA 2PAJA 2HR3A 3SFDC 1GXGA 3DPHA 4W7ZA 4O9BA 2XZ1C 1M1JA 3TK1A 1NTKD 1N7LA 1M74A 3DTJA 1VPCA 3GHGB 3NXSA 2BUOA 3CWBJ 1R8EA 2JB0A 2KSJA 5AVZB 1D7MA 1P84D 2KG8A 1RE4C 4U0EA 1CEIA 2FHSC 2A45I 4W80A 2XXMA 5AVYB 2O3JA 2O01N 2IYPA 1D1DA 5AW9B 1LTJC 2GA1A 4PV1D 3A0BE 2CPBA 2YKQA 2ZT9B 1MFZA 3CC2P 4OVNF 4C46A 3L74G 3TNUA 2QEXP 3CWBD 2X2BA 2O01H 1U57A 3L36A 1DIPA 3H4EA 4Z1MH 4COCA 2D2CB 1S1CX 3CXHH 3HE5A 1S5LH 2ONTA 1BDDA 1VQMP 3G29A 3HTKA 1RY3A 1VL2A 3MUDA 5AW0B 2WTYA 2K0YA 2Q3EA 1IFNA 1QVFO 1VF5D 2FYNC 3DS0A 1KB9E 1W5CE 5BS2A 3RGUA 1PEMA 1FZGA 1OMIA 2N5HA 7CEIA 1OR5A 4GOEA 2PFXA 5DCKA 4YTPC 4N3YB 5B66E 5L8RJ 3AE4C 1JNMA 4LGDE 4JQ0D 4WY4A 5F2KA 3CLQA 1EDLA 1GK4A 1Y9BA 5CCGD 1K9MQ 1IFIA 1SQXD 3A7OA 2MJZA 2XKMA 3OA7A 2Y0CA 3S1KA 2H88C 1GTWA 1G1JA 3H1IJ 2E74C 2KR5A 3LRYA 2WQYC 3AE6C 5AVSB 2N6YA 2H7HA 3KYQA 4PH1A 3B5NC 2ROQA 2A06D 2W83C 1DX7A 3AEGC 1KYOE 1PP9D 2FYUD 3OAKA 3NY7B 3VP9A 1XTCC 1SQPD 1HBWA 1LTJB 3EWKA 4KT0J 4UHPB 1YJNP 1NJIQ 2OYIA 3H1ID 1H0TA 3DS2A 2IBZI 4XFJA 4AUWA 3BRTB 3QWOC 1BXIA 4TLFA 3HUSA 3GZLA 2OYOA 4H2WC 4UB6E 4XE5B 1M1JC 1VHNA 3U1CA 1OVUA 5HGOA 1A43A 2GZJA 2K9JB 3RL0C 1S4XA 1JB0J 1RF0A 4IFFA 2AXTH 1GU5A 2YO2A 4NPFX 2QIWA 2N1TD 1UIIA 1VQ7P 1FDOA 3D70A 2FYNB 5M1BA 3C9IA 2AF8A 4I1LA 1Q81Q 2PEMA 1JY2N 1FDMA 1VQ8P 1KN7A 2A45H 3S9OA 4Y99B 3JCUE 1EOQA 2QM7A 2OTJP 1NTMK 3G0VA 1JJ2O 2HFED 3C8VA 1HGVA 1NKNA 3ZDMA 2I1JA 3H1HE 4ZMDA 3JC22 1BE3D 2G3AA 1LT1A 3MUDC 1L0LD 5K5GB 4OWFA 2NO8A 3V4QA 1GL2D 2E74B 5CCGA 1SQQE 3FWNA 5APWA 4UB8H 3VTPC 3H1JE 1H8AA 2R44A 5KLVK 1YQ3C 3L35A 3B5NB 2HODA 1OW7A 3B8EB 3MD0A 4DJGA 2XV5A 1VQPP 2IX7C 5KJ7D 1J1EC 4COPA 2KZJA 1NTKE 1QGKB 5HV8A 2WT7A 2B87A 5APXA 1J2JB 1L0HA 2GM4A 2VLPA 1P84E 4M0IA 4I7ZC 5KP6B 1NTZK 1VQOP 1RE3A 3PJSK 5H2FE 1M1JB 1M1KQ 2R5DA 2K93A 2QM8A 1Y8AA 2IBZD 3RL0B 1IZNB 3LW5J 2VLOA 1L4AA 2WPQA 1YJ9P 3CWBE 2K92A 2C9LY 4R0MA 3IF4A 3SWKA 2PEJA 2YO3A 1FU1A 2OYIC 3HZQA 5CMZA 3CE7A 3TNUB 2OQQA 4IPYA 3IN6A 4H13D 1OIPA 2MVUA 3H0DA 4PV1C 2KNCA 3HUSC 2FQ0A 3WUTA 4L75A 1SS1A 4QNBA 3H1HG 1URQD 1YHQP 1LNQA 3E2DA 3CXCO 2ZJSE 2M8NA 3H1LD 1RF0C 3HTKB 4NPDA 3HD7A 1GD2E 3RL0g 4NEOA 2LXBA 4EDFA 4YXDC 2NPSA 3EJEA 3H1JG 2KGAA 1M7LA 5AVUB 2OTKE 2W90A 2W27A 1GL2A 3A0BH 1VF5C 3LW5H 1SQXE 2ITAA 1VKUA 3W68A 2K94A 1NTKG 1FZFA 2OARA 1J1EB 2JR8A 3P7KA 1ZNVA 3LIDA 4DT0A 5CHXA 3VYIA 2XZ0D 2KOGA 3EQ2A 2FXOA 5KJ7A 2GYKA 3G4SP 4TT3H 2WSEJ 1Q90D 4I7ZB 2WWWA 2EG5A 5AW2B 2A06E 3K5BA 1PP9E 1JCCA 2FYUE 3F89A 1SVFA 5CCGC 2E76D 1SQPE 4RO0A 2LF4A 1ZMBA 1UJZA 5APUA 3AEDC 4HYTB 3Q1MA 1S9KD 3CWBG 2ZVOB 3H1IE 1QL1A 4AQRD 1RF1A 1EC5A 1SQVK 1X22A 1KB9H 3IAOA 2PENA 1KQSO 2QJKC 2AEFA 4K35A 1M6EX 5AVQB 5F2OA 2FBWC 3KDPB 1N7SD 1P84I 2OYIB 2E43A 1H0TB 3GZMA 1NO4A 1AUMA 5B66H 4PV1B 2EFJA 2BEZF 3HUSB 2N50A 1RE3C 1AVYA 1BCCD 5B5EE 3M9QA 3GF7A 3AEFC 4UB8E 2CQ8A 2G8YA 1NAFA 2QA4P 1L4AC 2K0XA 4PD4I 1LTBC 3CCSP 4GDOA 2P2UA 1URQA 1X8YA 5BU5A 1K05A 1KQFB 2N98A 5AVTB 3GW6A 1IC2A 1M6NA 2KODA 1KYOH 2OGUA 1SQXG 2FQ1A 1BE3E 5AVXB 1L0LE 3D6YA 3H1HJ 4RESB 1LTSC 1FJPA 1VF5B 2W6BA 4PH0A 1ZMEC 3NFQA 1YI2P 1UIXA 5KLVD 4L74A 2CGQA 1SQQJ 2B89A 4UB6H 2KORA 2A06G 1CZQA 1PP9G 2FYUG 3H1JJ 3FXEA 3HD7C 4XFYA 1SQPG 2AFDA 2K88A 1RH5B 2NPSC 3H1IG 1H88A 1NTKJ 3B4QA 1NTZD 3MGEA 4R4MA 2Y0EA 5CBNA 1GL2C 1SQQD 1FZBA 3CPWO 2CNRA 2HODB 1SLQA 1M56D 1FZEA 2QJKB 2Z5IA 3CD6P 3GG2A 3JCUH 4U0AA 3KZIE 2J5UA 2P67A 2WT7B 2B87B 2IBZE 2LTEA 3G21A 1GXHA 2RKLA 5KJ7C 2BHVA 4U7JA 2ZYGA 2JO1A 3H25A 3G1IA 2WSSH 2Z46A 2PP6A 3DS5A 1RO0A 3ITKA 5F2NA 1YQ4C 4XRQA 1SFCA 4GODA 2QSIA 1GW4A 1AQ5A 1RF1C 1L4AB 3S4RA 3V6IA 1ZR4A 3FGAD 4H0LC 3B71A 1FC2C 4JPZB 3MIWA 3KQGA 1N73A 1SQBJ 1KMIZ 1Z6MA 2K5XA 1BE3G 1L0LG 3WUUA 2PGDA 4PD4D 2M8RA 2BASA 1A02J 3DS3A 4ASVA 3H1LE 3RK3D 2N1TB 2C0WA 3WBHA 3U43A 2KNCB 4U3FJ 2MF4A 2O1JA 2JU2A 1P84H 4H13C 2Q5UA 1NU1J 5CCHD 1SQBD 1L0NK 3GJNA 5H2FH 1JY2O 2K3RA 3P32A 2J58A 1PV3A 3RG6C 1USDA 2LIUA 3HD7B 1URQC 3Q5PA 4HH2A 3C1LA 3VRLC 5KTBA 2UWJE 1SQXJ 4U3FD 1HH0A 2K2QA 3L73D 1QLED 3R2PA 4Y99C 3I55P 2E42A 2ZXEB 2NPSB 2LMLA 1NU1D 4H2XC 1TU3F 1GL2B 4DG9A 3AE2C 4U0BA 4KHXA 1LWUA 4LC1A 2AEJA 2IBZG 1PP9J 2FYUJ 1SQVD 4A7PA 1DH3A 4PJ0E 1S9KE 1SQPJ 2VLQA 3LMOA 5KLIB 1FZCA 3T97A 3SFEC 2CG5B 3VP8A 1KC8Q 2YNYA 2AEMA 1RQVA 2P9XA 1T3UA 3IFMA 4JF7A 4H44D 3G28A 1WMKA 4IFDK 2L9FA 1RF1B 2JKVA 1HWTC 1E0HA 1CI6A 4H0LB 2JP3A 2YMYA 1FOSE 1A02F 1ZV8A 3H47A 1BCCE 2FXPA 3M91A 1X79B 2LPKA 2W6JH 3H1LG 1LTTC 1NWQA 1MUUA 4CPGA 4WWIA 1L0IA 1IK9A 4ZKUA 1G1IA 3EJBA 2KGCA 5TISE 2LXCB 4QMAA 3CCRP 4H13B 1OW6A 1VQLP 4ASWA 1SFCC 1E5WA 2IZ0A 2ZT9D 4YPCA 1VQ5P 1KFNA 1BE3J 1L0LJ 1URQB 5APVA 2V7QJ 2K1AA 5AVRB 2FVFA 1N73C 5C39A 3TF5A 1EIAA 2FAEA 3RK2C 5KLVE 2IPPA 1XTGB 3G71P 2R3SA 1WRGA 1HVVA 1S2EA 2KWLA 1PGJA 3P8CD 2AVAA 4W7YA 4RJTA 2POHA 1NH4A 2FVEA 2KGEA 1SP4A 2M5AB 1A8OA 3G6EP 2N9BA 1JY2P 2E1MA 3NTEA 2P7JA 2KOOA 1JMBA 1X3OA 1K30A 4MN4C 5B5EH 1NTZE 2KS1B 4GT1A 2MR7A 5BU8B 2IFNA 3B4SA 1LTGC 2GZGA 3BATA 2DW3A 1MZ8A 3OJAB 3IR9A 1HY8A 2YIUC 2QRXA 1K04A 1PEQA 3R4YA 5KAFE 3A3YB 2QG4A 1BCCG 1AFOA 1MFTA 2Y9YA 5AW1B 3WUVA 3GMAA 1EDJA 1OXZA 1LWUC 2IZ1A 3KPEA 3PH0A 5TJHA 3GLMA 1JMMA 2R5BA 3AE7C 1S72P 2Z4EA 2VLNA 1FZCC 3MTUE 1EXJA 2Q3IA 4L73A 4XA4A 3TGUD 4M3LA 2O1KA 2W6AA 2L22A 4IFMA 3BCCD 4WYMA 4U0FA 2LR2A 2M0BA 4Y28J 4D6TJ 1DD4A 2QJYC 2FY8A 5AVVB 1NOHA 4GR6A 1SFCB 4PD4E 1FR2A 3RK3E 2PEKA 3AE1C 3H1LJ 1JEKA 2GUSA 3AE3C 1L0ND 5KLVG 1N73B 2PEOA 2N1TA 5APTA 3RK2B 2KXPB 4HJGH 4D6TD 2JDIH 1CW5A 1VQ9P 2JU1A 1M57D 4BRYA 1SQBE 1IFJA 4K3AA 3RBZA 2B9BA 2KOSA 3M9HA 3KZIH 4JYCA 3N7NA 1GPJA 1HF9A 2FADA 2YXRB 4AYCA 4U3FE 1W2EA 3CC4P 3L73E 3RK3C 4PWVB 1NTZG 1T8KA 1BAJA 3CC7P 5EW5E 1SQQG 1NU1E 2KSEA 1N86A 4ZKPA 2OYHB 2XU6A 4B86A 1K73Q 1FAVA 1SQVE 3CL3D 4U0DA 1J1DC 1G2CA 2YIUB 2IFMA 1LGHB 1YTZI 1KILD 2HYNA 1FBMA
chains in the Genus database with same CATH topology
4XFYA 5DCKA 1VQKP 1Q82Q 4XFXA 1VQ4P 1EOQA 2M8LA 1S72P 2PEJA 2OTJP 3G0VA 2Z44A 3DPHA 1JJ2O 3RG6C 1IUQA 3CCRP 2PENA 3HZQA 1KQSO 1VQLP 3Q20A 2PEQA 2Z45A 5F2KA 3VRLC 4IPYA 3MGEA 3CCJP 1K9MQ 1M74A 3DTJA 1M6EX 4U0FA 4WYMA 5F2OA 3H0DA 3I55P 1W2BO 2BUOA 3CPWO 1VQ5P 3DS4A 1Q86Q 3OW2O 4GR6A 4U0EA 1AUMA 2JYGA 3CD6P 4QNBA 1VQNP 2OTLP 4U0AA 1PEOA 3LRYA 1EIAA 2EFJA 2XXMA 2DGYA 2PEKA 3E2DA 1YHQP 3CXCO 1D1DA 3P05A 2M8NA 3G71P 3CCEP 3G21A 3CCMP 1QVGO 1RNIA 1QRJA 2PY8A 4U0BA 4PH1A 2PEOA 3CC2P 2BHVA 5BS1A 1M90Q 3G1GA 2QEXP 2QA4P 1VQ9P 2L6EA 3G1IA 2BQ1E 2Z46A 5I4TG 3H4EA 1A8OA 3G6EP 1K8AQ 3DS5A 5HGMA 1YJNP 1RO0A 2E1MA 3CCUP 4COCA 1NJIQ 3CCSP 5F2NA 3NTEA 2PEIA 1KD1Q 4XRQA 1PEUA 4U0CA 2EIAA 2JO0A 2XV6A 3DS2A 1VQPP 1Q7YQ 1KC8Q 1K30A 1VQ6P 4COPA 5HGNA 2CWOA 2ONTA 5JPAA 1RO2A 3G26A 1VQMP 3CC4P 2P9XA 1M6NA 3G29A 2KODA 1N8RQ 3DS1A 1YIJP 3G28A 1BAJA 3CC7P 3CMAP 4GR2A 2OARA 2JYLA 5HGOA 4M0IA 1A43A 3CMEP 3M1MA 1YITP 4PH0A 1VQOP 3H47A 2XT1A 1QVFO 1YJWP 1M1KQ 3DS3A 3DS0A 4XFZA 1K73Q 3G4SP 1PEQA 3CCVP 1YI2P 3I56P 2M8PA 3HYBA 3WBHA 4XROA 3CCLP 2EG5A 5BS2A 1E6JP 3CCQP 4U0DA 1PEMA 1VQ7P 1YJ9P 1Q81Q 2PEMA 2LF4A 1ZMBA 5HGLA 1VQ8P 3B5IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YIT P;  3G6E P;  1K8A Q;  1VQK P;  3CD6 P;  1VQO P;  1YJN P;  1Q82 Q;  3CCU P;  1NJI Q;  1VQ4 P;  1VQN P;  3CCS P;  2OTL P;  1KD1 Q;  1S72 P;  2OTJ P;  1QVF O;  1YJW P;  1YHQ P;  1M1K Q;  1KC8 Q;  1Q7Y Q;  1VQP P;  1VQ6 P;  1JJ2 O;  3CXC O;  3G4S P;  3CCR P;  3CCV P;  1YI2 P;  1K73 Q;  3I56 P;  1KQS O;  1VQL P;  3G71 P;  3CCE P;  3CCL P;  3CCM P;  1QVG O;  3CCJ P;  1VQM P;  1K9M Q;  3CC4 P;  3CCQ P;  3CC2 P;  1N8R Q;  1YIJ P;  3I55 P;  1W2B O;  1VQ7 P;  3CC7 P;  1M90 Q;  2QEX P;  3CMA P;  3CPW O;  1YJ9 P;  1Q81 Q;  1VQ5 P;  2QA4 P;  1Q86 Q;  1VQ9 P;  3OW2 O;  1VQ8 P;  3CME P; 
#chains in the Genus database with same CATH topology
 2H8P D;  3G9R A;  1MZ9 A;  1LWU B;  1MV8 A;  4GOF A;  4IL6 X;  2JBG A;  5KKZ C;  1F80 D;  2VSQ A;  2E74 D;  4IL6 E;  1FZC B;  3T97 B;  3JSV C;  4EYY Q;  3OW2 O;  2PNG A;  3E1I A;  5AVW B;  1QL2 A;  2XND H;  2GDY A;  1JCD A;  1PFI A;  2QJY B;  1ZR2 A;  3O6Q A;  1BCC J;  1LP1 B;  2QJP C;  1QVG O;  1RNI A;  4N78 D;  1WT6 A;  3H6P A;  1NTM J;  1JUN A;  1CI6 B;  1AV1 A;  3FXD A;  1LTA C;  4KJM A;  1ZW0 A;  4H44 C;  3A2A A;  1SQB G;  4U0C A;  2WPR A;  2CWO A;  2IYO A;  4OH8 B;  1OWA A;  1PGO A;  3CX5 D;  1T8Z A;  4BPF A;  3DS1 A;  1OX3 A;  1NTM D;  1IFM A;  4U3F G;  1YYC A;  3L73 G;  4PJ0 H;  1DNY A;  3VMX A;  2Q7C A;  1MKM A;  1X9V A;  3RK3 B;  1NU1 G;  4JYB A;  3MP7 B;  1KOR A;  5KLV J;  2ZAE B;  2WSE H;  3HYB A;  3WMM 0;  3D71 A;  1BSN A;  1OFC X;  2ZYA A;  2MD9 A;  2K9Y A;  2Y0D A;  3P8C E;  3CCQ P;  2ZXX A;  1IMP A;  1SQV G;  2N1T C;  2V4H A;  3B5I A;  2H43 A;  1DV5 A;  3EFF K;  1ZRT D;  1J1D B;  4CA3 A;  1GK6 A;  2QE7 H;  1AF8 A;  3L71 D;  2M5A A;  3LIE A;  2J59 M;  3L75 D;  1BDC A;  1NTZ J;  2E75 D;  2WIT A;  1KIL A;  5APS A;  2KS1 A;  2XNX A;  1X0T A;  2N6Z A;  2JYG A;  1FOS F;  2KOP A;  5KKZ B;  5TIS H;  3H1K D;  2P1J A;  2KI7 B;  2E5Y A;  3L70 D;  2K0D X;  1DEE G;  3N4X A;  2I8D A;  2L6E A;  2QJP B;  1IO4 A;  2FAC A;  2L5G B;  3M0D A;  1BGY J;  2XV6 A;  1YBK A;  1IJD B;  3TGU E;  4WY4 D;  4H44 B;  3BCC E;  5KLI C;  3U59 A;  3I5C A;  1YIJ P;  2ZFC A;  1N7S A;  4QKO A;  3CME P;  1JTH A;  3TYY A;  2GZF A;  2XDJ A;  3VMZ A;  2WPS A;  1YJW P;  2NZ2 A;  3SWF A;  1BGY D;  3CCV P;  3I56 P;  3CXH D;  2KYV A;  1L0N E;  3CCL P;  1JM0 A;  1KLP A;  3L72 D;  1IK7 A;  1EQ7 A;  4D6T E;  1EZV E;  5APQ A;  2BCC J;  5DJU B;  3AEC C;  3VMY A;  2M8L A;  3A5T A;  1KQL A;  4ZNC A;  3HRN A;  2Z44 A;  5CJ4 A;  4WBA A;  2Y9Z A;  3AEB C;  5KAF H;  2ZVN B;  3L37 A;  1FZA A;  3L73 J;  4BRY B;  5EJD A;  1U7J A;  3AEE C;  1T6A A;  1BSH A;  3WU2 E;  2BCC D;  3AE8 C;  2P10 A;  1VQN P;  3PP5 A;  1LJ2 A;  5KAI E;  3P05 A;  2OYH A;  3ABV C;  3CCM P;  2PY8 A;  1NVO A;  4N6J A;  1SQV J;  1KIL E;  1M90 Q;  2JWD A;  3Q5R A;  1H89 A;  3E1R A;  1FS0 E;  3W67 A;  3USS A;  1VDF A;  4F37 A;  2KIK A;  1AA0 A;  3F5H A;  2BEQ D;  5HGM A;  4PD4 H;  3KXD A;  1RQU A;  3CCU P;  4R4L A;  1GU4 A;  2FKW B;  1DD3 A;  2PEI A;  4OGQ D;  3M06 A;  3PLN A;  2JO0 A;  2L0Q A;  1G2C B;  3P8M C;  1NYH A;  3TGU G;  3D6Z A;  1HJ0 A;  1DEB A;  1JY3 O;  1NHL A;  2LIW A;  3BCC G;  3RG2 A;  3V2N A;  4BXL A;  3BRV B;  4LLH A;  2CK3 H;  1KIL C;  2XT1 A;  2ERH A;  2HPC A;  2M8P A;  3A0H E;  4N78 E;  2L4B A;  1M8O B;  1ACP A;  1L0N G;  3H32 B;  3V2R A;  2RMZ A;  1LP1 A;  4HB1 A;  4JBZ A;  3GF3 A;  1NGM B;  2JEE A;  2M3B A;  4D6T G;  5GTI E;  1EZV G;  2E76 C;  3O6Q B;  5GTH E;  2RH0 A;  2N5I A;  1U7M A;  2GDX A;  2HG5 D;  3M0D C;  3CX5 E;  1AJY A;  5CZD B;  1NTM E;  1R5S A;  2LKI A;  3DS4 A;  2AFE A;  3SWY A;  2Q6Q A;  1N7S C;  2GZI A;  4DZO A;  3G3Z A;  3PRJ A;  1JOC A;  1PPJ E;  1ZP0 C;  3MZW B;  1L4A D;  1JO5 A;  5BS1 A;  2KG6 A;  4IL6 H;  2Q9I A;  3TSI A;  1EZV I;  2GUV A;  5CCH A;  3VN0 A;  5I4T G;  4C7R A;  1ZRT E;  3HE4 A;  1L2P A;  3L71 E;  3L75 E;  2KK7 A;  2D2C D;  1T2K D;  2CPS A;  3L74 J;  1RO2 A;  2N9Y B;  3M9B A;  2GDW A;  2YKO A;  3V2Q A;  2MR8 A;  4HKG A;  3UIA A;  2Q1K A;  2B88 A;  3M1M A;  1YIT P;  1Z56 A;  2RN0 A;  2KZI A;  1E79 H;  3H1K E;  5AW3 B;  2WSF J;  2KLU A;  1QEX A;  3QH9 A;  4GIF A;  2FFD A;  1JY3 N;  2KP8 A;  1KIL B;  1EXI A;  3L74 D;  3HD7 D;  2KB7 P;  3SSU A;  2OYH C;  3L70 E;  1EDK A;  4EIJ A;  2NPS D;  2E75 C;  1PIX A;  1Q82 Q;  1VQ4 P;  4L76 A;  5AW5 B;  2KGD A;  2JQ4 A;  1KB9 I;  1Y47 A;  5AW4 B;  3TGU J;  2Z45 A;  3GKL C;  4C7N A;  4RKU J;  3BCC J;  3V2P A;  2E76 B;  1JY3 P;  2WPV B;  3L4F A;  1HGZ A;  1NTM G;  4GKG A;  1LT9 A;  1FDI A;  1ZXG A;  2V7Q H;  1USE A;  2IDB A;  1S5L X;  4WVZ A;  1GZL A;  2DGY A;  1BGY E;  1S5L E;  3CXH E;  1AVO A;  5AW7 B;  3L72 E;  1L0N J;  4H2Y C;  1AYI A;  4I6M C;  4WY4 C;  1N7S B;  3VMA A;  1JTH B;  1PPJ G;  2EHT A;  3Q2Y A;  4HKZ H;  3V5B A;  2BQ1 E;  3GHG A;  1ZOY C;  1FE6 A;  2YKP A;  2GZE A;  2C0X A;  4NPE A;  2WSF H;  1SQQ K;  1GMJ A;  4H0L D;  1Q7Y Q;  1N2D C;  5E79 H;  5JPA A;  3L71 G;  3CX5 I;  3L75 G;  1KYO I;  1OZH A;  2M5R A;  2FXM A;  1KV4 A;  2JWA A;  2BCC E;  1EZV D;  1NTK K;  3H1K G;  5HVC A;  3PHL A;  3AEA C;  3VOP A;  3RBX A;  2FYZ A;  1LTI C;  2WSC J;  2C9N Y;  2KLV A;  4BPH A;  1QX8 A;  3L70 G;  3KHU A;  3HE5 B;  1AQT A;  2MY5 A;  1VQK P;  5CCH C;  1HQB A;  1KFM A;  2KG9 A;  3II6 A;  3AE9 C;  3Q20 A;  2E75 B;  2XZR A;  2K37 A;  1NAY A;  1EMV A;  1Q86 Q;  1PGQ A;  5KP8 B;  1R5L A;  2OTL P;  1PL5 A;  1PEO A;  4DOJ A;  5BVZ A;  1CSB A;  1Q2N A;  1KB9 D;  4OGQ C;  2R32 A;  2JJL A;  1QRJ A;  1BGY G;  1EDI A;  1SQB K;  1GDT A;  2MKV A;  2FFD C;  5KP7 B;  4I2L C;  3NTN A;  1ZN5 A;  3L72 G;  3EFG A;  5CBO A;  2WMM A;  3WU2 H;  3H32 A;  5AW6 B;  5AW8 B;  4WY4 B;  2HPC B;  1YTZ T;  1PEU A;  2EIA A;  3EJD A;  1KQG B;  2AXT E;  5CJ0 A;  2NRG A;  5KAI H;  2FVA A;  3B5N D;  2KUB A;  4EOT A;  3BAS A;  1NU1 K;  3Q3D A;  2WSC H;  1N8R Q;  1HTL C;  1RE4 A;  1HJB A;  4GR2 A;  2I1K A;  3O8Z A;  1KTM A;  2H89 C;  1NQ4 A;  1UNK A;  3FX0 A;  2BCC G;  4BWN A;  1SQX K;  1LTJ A;  1LT9 C;  1S3J A;  2Z5H A;  4XFZ A;  2LL8 A;  2LKM A;  3CXH I;  2PRR A;  4XRO A;  5DJT B;  4EI2 A;  2R3C A;  2KOQ A;  1E6J P;  5EFW B;  4PXH B;  1GW3 A;  2W8Z A;  1KYO D;  3RL0 D;  2QVA A;  5HGL A;  4YXW H;  2YMK A;  4IZ6 A;  4XFX A;  1T3J A;  1SFC D;  3GHG C;  5APY A;  2FYU K;  2K9J A;  3U1A A;  3L71 J;  1IUQ A;  3L75 J;  3A0H H;  2JGP A;  3NMD A;  1SQP K;  2PEQ A;  2EHS A;  3CCJ P;  2WPT A;  1PPJ D;  3AE5 C;  1W2B O;  1OW8 A;  3HE4 B;  2VRS A;  5GTI H;  3MHV A;  3RK2 D;  1OVR A;  1RHZ B;  4BPG A;  2ZT9 C;  1HUC A;  1IMQ A;  5GTH H;  3TDK A;  3H1K J;  1PGP A;  2AXC A;  3CCE P;  4WB4 A;  3CX5 H;  3L74 E;  2ZYD A;  2D2C C;  1T2K C;  2HLO A;  3L70 J;  1OVV A;  4DCK A;  3G1G A;  2DNW A;  2E5T A;  1IFP A;  1PZQ A;  2LOL A;  3Q5S A;  4OGQ B;  1K8A Q;  2FFD B;  2YXQ B;  1FJK A;  3FWL A;  1KD1 Q;  3MGN A;  1VQ6 P;  5HGN A;  5E79 E;  2M3E A;  3V4W A;  3G26 A;  3BVH A;  3E7K A;  2QNW A;  3CMA P;  3CI9 A;  2JYL A;  2O01 J;  3H1H D;  2JAZ A;  4MRT C;  1KZU B;  2FQ2 A;  4C7N B;  2A45 G;  1ZLL A;  3B5N A;  2L91 A;  1IFD A;  2P58 A;  1L0L K;  2SPZ A;  3L72 J;  3PTZ A;  1NKZ B;  2KW2 A;  1LT9 B;  2WVR A;  2WZ7 A;  4IOI H;  3M0A A;  3H1J D;  2MVV A;  2PAJ A;  2HR3 A;  3SFD C;  1GXG A;  3DPH A;  4W7Z A;  4O9B A;  2XZ1 C;  1M1J A;  3TK1 A;  1NTK D;  1N7L A;  1M74 A;  3DTJ A;  1VPC A;  3GHG B;  3NXS A;  2BUO A;  3CWB J;  1R8E A;  2JB0 A;  2KSJ A;  5AVZ B;  1D7M A;  1P84 D;  2KG8 A;  1RE4 C;  4U0E A;  1CEI A;  2FHS C;  2A45 I;  4W80 A;  2XXM A;  5AVY B;  2O3J A;  2O01 N;  2IYP A;  1D1D A;  5AW9 B;  1LTJ C;  2GA1 A;  4PV1 D;  3A0B E;  2CPB A;  2YKQ A;  2ZT9 B;  1MFZ A;  3CC2 P;  4OVN F;  4C46 A;  3L74 G;  3TNU A;  2QEX P;  3CWB D;  2X2B A;  2O01 H;  1U57 A;  3L36 A;  1DIP A;  3H4E A;  4Z1M H;  4COC A;  2D2C B;  1S1C X;  3CXH H;  3HE5 A;  1S5L H;  2ONT A;  1BDD A;  1VQM P;  3G29 A;  3HTK A;  1RY3 A;  1VL2 A;  3MUD A;  5AW0 B;  2WTY A;  2K0Y A;  2Q3E A;  1IFN A;  1QVF O;  1VF5 D;  2FYN C;  3DS0 A;  1KB9 E;  1W5C E;  5BS2 A;  3RGU A;  1PEM A;  1FZG A;  1OMI A;  2N5H A;  7CEI A;  1OR5 A;  4GOE A;  2PFX A;  5DCK A;  4YTP C;  4N3Y B;  5B66 E;  5L8R J;  3AE4 C;  1JNM A;  4LGD E;  4JQ0 D;  4WY4 A;  5F2K A;  3CLQ A;  1EDL A;  1GK4 A;  1Y9B A;  5CCG D;  1K9M Q;  1IFI A;  1SQX D;  3A7O A;  2MJZ A;  2XKM A;  3OA7 A;  2Y0C A;  3S1K A;  2H88 C;  1GTW A;  1G1J A;  3H1I J;  2E74 C;  2KR5 A;  3LRY A;  2WQY C;  3AE6 C;  5AVS B;  2N6Y A;  2H7H A;  3KYQ A;  4PH1 A;  3B5N C;  2ROQ A;  2A06 D;  2W83 C;  1DX7 A;  3AEG C;  1KYO E;  1PP9 D;  2FYU D;  3OAK A;  3NY7 B;  3VP9 A;  1XTC C;  1SQP D;  1HBW A;  1LTJ B;  3EWK A;  4KT0 J;  4UHP B;  1YJN P;  1NJI Q;  2OYI A;  3H1I D;  1H0T A;  3DS2 A;  2IBZ I;  4XFJ A;  4AUW A;  3BRT B;  3QWO C;  1BXI A;  4TLF A;  3HUS A;  3GZL A;  2OYO A;  4H2W C;  4UB6 E;  4XE5 B;  1M1J C;  1VHN A;  3U1C A;  1OVU A;  5HGO A;  1A43 A;  2GZJ A;  2K9J B;  3RL0 C;  1S4X A;  1JB0 J;  1RF0 A;  4IFF A;  2AXT H;  1GU5 A;  2YO2 A;  4NPF X;  2QIW A;  2N1T D;  1UII A;  1VQ7 P;  1FDO A;  3D70 A;  2FYN B;  5M1B A;  3C9I A;  2AF8 A;  4I1L A;  1Q81 Q;  2PEM A;  1JY2 N;  1FDM A;  1VQ8 P;  1KN7 A;  2A45 H;  3S9O A;  4Y99 B;  3JCU E;  1EOQ A;  2QM7 A;  2OTJ P;  1NTM K;  3G0V A;  1JJ2 O;  2HFE D;  3C8V A;  1HGV A;  1NKN A;  3ZDM A;  2I1J A;  3H1H E;  4ZMD A;  3JC2 2;  1BE3 D;  2G3A A;  1LT1 A;  3MUD C;  1L0L D;  5K5G B;  4OWF A;  2NO8 A;  3V4Q A;  1GL2 D;  2E74 B;  5CCG A;  1SQQ E;  3FWN A;  5APW A;  4UB8 H;  3VTP C;  3H1J E;  1H8A A;  2R44 A;  5KLV K;  1YQ3 C;  3L35 A;  3B5N B;  2HOD A;  1OW7 A;  3B8E B;  3MD0 A;  4DJG A;  2XV5 A;  1VQP P;  2IX7 C;  5KJ7 D;  1J1E C;  4COP A;  2KZJ A;  1NTK E;  1QGK B;  5HV8 A;  2WT7 A;  2B87 A;  5APX A;  1J2J B;  1L0H A;  2GM4 A;  2VLP A;  1P84 E;  4M0I A;  4I7Z C;  5KP6 B;  1NTZ K;  1VQO P;  1RE3 A;  3PJS K;  5H2F E;  1M1J B;  1M1K Q;  2R5D A;  2K93 A;  2QM8 A;  1Y8A A;  2IBZ D;  3RL0 B;  1IZN B;  3LW5 J;  2VLO A;  1L4A A;  2WPQ A;  1YJ9 P;  3CWB E;  2K92 A;  2C9L Y;  4R0M A;  3IF4 A;  3SWK A;  2PEJ A;  2YO3 A;  1FU1 A;  2OYI C;  3HZQ A;  5CMZ A;  3CE7 A;  3TNU B;  2OQQ A;  4IPY A;  3IN6 A;  4H13 D;  1OIP A;  2MVU A;  3H0D A;  4PV1 C;  2KNC A;  3HUS C;  2FQ0 A;  3WUT A;  4L75 A;  1SS1 A;  4QNB A;  3H1H G;  1URQ D;  1YHQ P;  1LNQ A;  3E2D A;  3CXC O;  2ZJS E;  2M8N A;  3H1L D;  1RF0 C;  3HTK B;  4NPD A;  3HD7 A;  1GD2 E;  3RL0 g;  4NEO A;  2LXB A;  4EDF A;  4YXD C;  2NPS A;  3EJE A;  3H1J G;  2KGA A;  1M7L A;  5AVU B;  2OTK E;  2W90 A;  2W27 A;  1GL2 A;  3A0B H;  1VF5 C;  3LW5 H;  1SQX E;  2ITA A;  1VKU A;  3W68 A;  2K94 A;  1NTK G;  1FZF A;  2OAR A;  1J1E B;  2JR8 A;  3P7K A;  1ZNV A;  3LID A;  4DT0 A;  5CHX A;  3VYI A;  2XZ0 D;  2KOG A;  3EQ2 A;  2FXO A;  5KJ7 A;  2GYK A;  3G4S P;  4TT3 H;  2WSE J;  1Q90 D;  4I7Z B;  2WWW A;  2EG5 A;  5AW2 B;  2A06 E;  3K5B A;  1PP9 E;  1JCC A;  2FYU E;  3F89 A;  1SVF A;  5CCG C;  2E76 D;  1SQP E;  4RO0 A;  2LF4 A;  1ZMB A;  1UJZ A;  5APU A;  3AED C;  4HYT B;  3Q1M A;  1S9K D;  3CWB G;  2ZVO B;  3H1I E;  1QL1 A;  4AQR D;  1RF1 A;  1EC5 A;  1SQV K;  1X22 A;  1KB9 H;  3IAO A;  2PEN A;  1KQS O;  2QJK C;  2AEF A;  4K35 A;  1M6E X;  5AVQ B;  5F2O A;  2FBW C;  3KDP B;  1N7S D;  1P84 I;  2OYI B;  2E43 A;  1H0T B;  3GZM A;  1NO4 A;  1AUM A;  5B66 H;  4PV1 B;  2EFJ A;  2BEZ F;  3HUS B;  2N50 A;  1RE3 C;  1AVY A;  1BCC D;  5B5E E;  3M9Q A;  3GF7 A;  3AEF C;  4UB8 E;  2CQ8 A;  2G8Y A;  1NAF A;  2QA4 P;  1L4A C;  2K0X A;  4PD4 I;  1LTB C;  3CCS P;  4GDO A;  2P2U A;  1URQ A;  1X8Y A;  5BU5 A;  1K05 A;  1KQF B;  2N98 A;  5AVT B;  3GW6 A;  1IC2 A;  1M6N A;  2KOD A;  1KYO H;  2OGU A;  1SQX G;  2FQ1 A;  1BE3 E;  5AVX B;  1L0L E;  3D6Y A;  3H1H J;  4RES B;  1LTS C;  1FJP A;  1VF5 B;  2W6B A;  4PH0 A;  1ZME C;  3NFQ A;  1YI2 P;  1UIX A;  5KLV D;  4L74 A;  2CGQ A;  1SQQ J;  2B89 A;  4UB6 H;  2KOR A;  2A06 G;  1CZQ A;  1PP9 G;  2FYU G;  3H1J J;  3FXE A;  3HD7 C;  4XFY A;  1SQP G;  2AFD A;  2K88 A;  1RH5 B;  2NPS C;  3H1I G;  1H88 A;  1NTK J;  3B4Q A;  1NTZ D;  3MGE A;  4R4M A;  2Y0E A;  5CBN A;  1GL2 C;  1SQQ D;  1FZB A;  3CPW O;  2CNR A;  2HOD B;  1SLQ A;  1M56 D;  1FZE A;  2QJK B;  2Z5I A;  3CD6 P;  3GG2 A;  3JCU H;  4U0A A;  3KZI E;  2J5U A;  2P67 A;  2WT7 B;  2B87 B;  2IBZ E;  2LTE A;  3G21 A;  1GXH A;  2RKL A;  5KJ7 C;  2BHV A;  4U7J A;  2ZYG A;  2JO1 A;  3H25 A;  3G1I A;  2WSS H;  2Z46 A;  2PP6 A;  3DS5 A;  1RO0 A;  3ITK A;  5F2N A;  1YQ4 C;  4XRQ A;  1SFC A;  4GOD A;  2QSI A;  1GW4 A;  1AQ5 A;  1RF1 C;  1L4A B;  3S4R A;  3V6I A;  1ZR4 A;  3FGA D;  4H0L C;  3B71 A;  1FC2 C;  4JPZ B;  3MIW A;  3KQG A;  1N73 A;  1SQB J;  1KMI Z;  1Z6M A;  2K5X A;  1BE3 G;  1L0L G;  3WUU A;  2PGD A;  4PD4 D;  2M8R A;  2BAS A;  1A02 J;  3DS3 A;  4ASV A;  3H1L E;  3RK3 D;  2N1T B;  2C0W A;  3WBH A;  3U43 A;  2KNC B;  4U3F J;  2MF4 A;  2O1J A;  2JU2 A;  1P84 H;  4H13 C;  2Q5U A;  1NU1 J;  5CCH D;  1SQB D;  1L0N K;  3GJN A;  5H2F H;  1JY2 O;  2K3R A;  3P32 A;  2J58 A;  1PV3 A;  3RG6 C;  1USD A;  2LIU A;  3HD7 B;  1URQ C;  3Q5P A;  4HH2 A;  3C1L A;  3VRL C;  5KTB A;  2UWJ E;  1SQX J;  4U3F D;  1HH0 A;  2K2Q A;  3L73 D;  1QLE D;  3R2P A;  4Y99 C;  3I55 P;  2E42 A;  2ZXE B;  2NPS B;  2LML A;  1NU1 D;  4H2X C;  1TU3 F;  1GL2 B;  4DG9 A;  3AE2 C;  4U0B A;  4KHX A;  1LWU A;  4LC1 A;  2AEJ A;  2IBZ G;  1PP9 J;  2FYU J;  1SQV D;  4A7P A;  1DH3 A;  4PJ0 E;  1S9K E;  1SQP J;  2VLQ A;  3LMO A;  5KLI B;  1FZC A;  3T97 A;  3SFE C;  2CG5 B;  3VP8 A;  1KC8 Q;  2YNY A;  2AEM A;  1RQV A;  2P9X A;  1T3U A;  3IFM A;  4JF7 A;  4H44 D;  3G28 A;  1WMK A;  4IFD K;  2L9F A;  1RF1 B;  2JKV A;  1HWT C;  1E0H A;  1CI6 A;  4H0L B;  2JP3 A;  2YMY A;  1FOS E;  1A02 F;  1ZV8 A;  3H47 A;  1BCC E;  2FXP A;  3M91 A;  1X79 B;  2LPK A;  2W6J H;  3H1L G;  1LTT C;  1NWQ A;  1MUU A;  4CPG A;  4WWI A;  1L0I A;  1IK9 A;  4ZKU A;  1G1I A;  3EJB A;  2KGC A;  5TIS E;  2LXC B;  4QMA A;  3CCR P;  4H13 B;  1OW6 A;  1VQL P;  4ASW A;  1SFC C;  1E5W A;  2IZ0 A;  2ZT9 D;  4YPC A;  1VQ5 P;  1KFN A;  1BE3 J;  1L0L J;  1URQ B;  5APV A;  2V7Q J;  2K1A A;  5AVR B;  2FVF A;  1N73 C;  5C39 A;  3TF5 A;  1EIA A;  2FAE A;  3RK2 C;  5KLV E;  2IPP A;  1XTG B;  3G71 P;  2R3S A;  1WRG A;  1HVV A;  1S2E A;  2KWL A;  1PGJ A;  3P8C D;  2AVA A;  4W7Y A;  4RJT A;  2POH A;  1NH4 A;  2FVE A;  2KGE A;  1SP4 A;  2M5A B;  1A8O A;  3G6E P;  2N9B A;  1JY2 P;  2E1M A;  3NTE A;  2P7J A;  2KOO A;  1JMB A;  1X3O A;  1K30 A;  4MN4 C;  5B5E H;  1NTZ E;  2KS1 B;  4GT1 A;  2MR7 A;  5BU8 B;  2IFN A;  3B4S A;  1LTG C;  2GZG A;  3BAT A;  2DW3 A;  1MZ8 A;  3OJA B;  3IR9 A;  1HY8 A;  2YIU C;  2QRX A;  1K04 A;  1PEQ A;  3R4Y A;  5KAF E;  3A3Y B;  2QG4 A;  1BCC G;  1AFO A;  1MFT A;  2Y9Y A;  5AW1 B;  3WUV A;  3GMA A;  1EDJ A;  1OXZ A;  1LWU C;  2IZ1 A;  3KPE A;  3PH0 A;  5TJH A;  3GLM A;  1JMM A;  2R5B A;  3AE7 C;  1S72 P;  2Z4E A;  2VLN A;  1FZC C;  3MTU E;  1EXJ A;  2Q3I A;  4L73 A;  4XA4 A;  3TGU D;  4M3L A;  2O1K A;  2W6A A;  2L22 A;  4IFM A;  3BCC D;  4WYM A;  4U0F A;  2LR2 A;  2M0B A;  4Y28 J;  4D6T J;  1DD4 A;  2QJY C;  2FY8 A;  5AVV B;  1NOH A;  4GR6 A;  1SFC B;  4PD4 E;  1FR2 A;  3RK3 E;  2PEK A;  3AE1 C;  3H1L J;  1JEK A;  2GUS A;  3AE3 C;  1L0N D;  5KLV G;  1N73 B;  2PEO A;  2N1T A;  5APT A;  3RK2 B;  2KXP B;  4HJG H;  4D6T D;  2JDI H;  1CW5 A;  1VQ9 P;  2JU1 A;  1M57 D;  4BRY A;  1SQB E;  1IFJ A;  4K3A A;  3RBZ A;  2B9B A;  2KOS A;  3M9H A;  3KZI H;  4JYC A;  3N7N A;  1GPJ A;  1HF9 A;  2FAD A;  2YXR B;  4AYC A;  4U3F E;  1W2E A;  3CC4 P;  3L73 E;  3RK3 C;  4PWV B;  1NTZ G;  1T8K A;  1BAJ A;  3CC7 P;  5EW5 E;  1SQQ G;  1NU1 E;  2KSE A;  1N86 A;  4ZKP A;  2OYH B;  2XU6 A;  4B86 A;  1K73 Q;  1FAV A;  1SQV E;  3CL3 D;  4U0D A;  1J1D C;  1G2C A;  2YIU B;  2IFM A;  1LGH B;  1YTZ I;  1KIL D;  2HYN A;  1FBM A; 
#chains in the Genus database with same CATH homology
 4XFY A;  5DCK A;  1VQK P;  1Q82 Q;  4XFX A;  1VQ4 P;  1EOQ A;  2M8L A;  1S72 P;  2PEJ A;  2OTJ P;  3G0V A;  2Z44 A;  3DPH A;  1JJ2 O;  3RG6 C;  1IUQ A;  3CCR P;  2PEN A;  3HZQ A;  1KQS O;  1VQL P;  3Q20 A;  2PEQ A;  2Z45 A;  5F2K A;  3VRL C;  4IPY A;  3MGE A;  3CCJ P;  1K9M Q;  1M74 A;  3DTJ A;  1M6E X;  4U0F A;  4WYM A;  5F2O A;  3H0D A;  3I55 P;  1W2B O;  2BUO A;  3CPW O;  1VQ5 P;  3DS4 A;  1Q86 Q;  3OW2 O;  4GR6 A;  4U0E A;  1AUM A;  2JYG A;  3CD6 P;  4QNB A;  1VQN P;  2OTL P;  4U0A A;  1PEO A;  3LRY A;  1EIA A;  2EFJ A;  2XXM A;  2DGY A;  2PEK A;  3E2D A;  1YHQ P;  3CXC O;  1D1D A;  3P05 A;  2M8N A;  3G71 P;  3CCE P;  3G21 A;  3CCM P;  1QVG O;  1RNI A;  1QRJ A;  2PY8 A;  4U0B A;  4PH1 A;  2PEO A;  3CC2 P;  2BHV A;  5BS1 A;  1M90 Q;  3G1G A;  2QEX P;  2QA4 P;  1VQ9 P;  2L6E A;  3G1I A;  2BQ1 E;  2Z46 A;  5I4T G;  3H4E A;  1A8O A;  3G6E P;  1K8A Q;  3DS5 A;  5HGM A;  1YJN P;  1RO0 A;  2E1M A;  3CCU P;  4COC A;  1NJI Q;  3CCS P;  5F2N A;  3NTE A;  2PEI A;  1KD1 Q;  4XRQ A;  1PEU A;  4U0C A;  2EIA A;  2JO0 A;  2XV6 A;  3DS2 A;  1VQP P;  1Q7Y Q;  1KC8 Q;  1K30 A;  1VQ6 P;  4COP A;  5HGN A;  2CWO A;  2ONT A;  5JPA A;  1RO2 A;  3G26 A;  1VQM P;  3CC4 P;  2P9X A;  1M6N A;  3G29 A;  2KOD A;  1N8R Q;  3DS1 A;  1YIJ P;  3G28 A;  1BAJ A;  3CC7 P;  3CMA P;  4GR2 A;  2OAR A;  2JYL A;  5HGO A;  4M0I A;  1A43 A;  3CME P;  3M1M A;  1YIT P;  4PH0 A;  1VQO P;  3H47 A;  2XT1 A;  1QVF O;  1YJW P;  1M1K Q;  3DS3 A;  3DS0 A;  4XFZ A;  1K73 Q;  3G4S P;  1PEQ A;  3CCV P;  1YI2 P;  3I56 P;  2M8P A;  3HYB A;  3WBH A;  4XRO A;  3CCL P;  2EG5 A;  5BS2 A;  1E6J P;  3CCQ P;  4U0D A;  1PEM A;  1VQ7 P;  1YJ9 P;  1Q81 Q;  2PEM A;  2LF4 A;  1ZMB A;  5HGL A;  1VQ8 P;  3B5I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...