2MF4A

1h, 13c, 15n chemical shift assignments of streptomyces virginiae vira acp5a
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
85
structure length
85
Chain Sequence
GPGSAGRQEEIAEEVARLLAGVLYLEPDRLDPEETFLTLGVDSILGVEFVAAVNAAYPVGVKATALYDHPTPAAFARHIAESLGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Hybrid polyketide synthase-non ribosomal peptide synthetase
publication title NMR assignements of ACP5a
rcsb
source organism Streptomyces virginiae
total genus 21
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2013-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2mf4A01
4CA3A 2FACA 1ACPA 2FAEA 2KG9A 2KOSA 5KP8B 2L22A 2GDWA 2PNGA 1DV5A 1NQ4A 1X3OA 2N5HA 3EJDA 2LIUA 2FQ2A 3CE7A 1F80D 4IZ6A 2FQ1A 2LIWA 4BPGA 2QNWA 1KLPA 2CG5B 2KGCA 4DG9A 2N6YA 5HVCA 4HKGA 2KORA 2DNWA 2KGDA 1HY8A 1OR5A 2FVAA 2MVVA 2ROQA 3GZMA 3LMOA 4PWVB 1L0IA 2FADA 2L0QA 2K92A 2K93A 2LKIA 2MVUA 4BPHA 2L9FA 3RG2A 2K94A 2KW2A 4R0MA 5CZDB 5HV8A 2AFDA 2LPKA 1HQBA 4PXHB 2FVEA 2GDYA 2M5RA 2MR7A 2KOPA 2JU1A 2CQ8A 2CGQA 4MRTC 4H2XC 2K2QA 2N5IA 4BPFA 2LMLA 2MD9A 2CNRA 2EHTA 2N6ZA 2VSQA 2LL8A 2KGEA 2L4BA 3EJBA 2XZ1C 2KOOA 2KR5A 2FQ0A 2MF4A 3EJEA 1T8KA 2LTEA 4H2YC 2LOLA 2KOQA 5KP7B 2K0XA 4H2WC 4NEOA 2AF8A 1VKUA 1L0HA 3NY7B 1DNYA 5KP6B 2JQ4A 2KG8A 2JU2A 2KWLA 2X2BA 2KG6A 5EJDA 1AF8A 2EHSA 2K0YA 2GDXA 2XZ0D 2JGPA 2N50A 2AVAA 2FHSC 2N98A 2FVFA 3GZLA 2KGAA 2MR8A 2AFEA 2MY5A
chains in the Genus database with same CATH superfamily
3E2DA 1YIJP 4CA3A 4XRQA 1VQ5P 2EFJA 2GZJA 2KG9A 4U0BA 1YJNP 1QVGO 4UHPB 1KQSO 1BXIA 2PNGA 4U0CA 1DV5A 2GZGA 1X3OA 2N5HA 3EJDA 2JAZA 4IZ6A 4BPGA 2M8NA 4IPYA 1NJIQ 2CG5B 3CC7P 1GPJA 1HY8A 3GJNA 3LMOA 1VQ4P 2BHVA 2VLNA 4COPA 4BPHA 3RG2A 4R0MA 1E6JP 1VQLP 2Z44A 1EMVA 2OARA 4U0DA 3Q20A 3CCLP 1Z6MA 4M0IA 1M74A 3DTJA 3G26A 2K2QA 3G1IA 3CPWO 2JYGA 2MD9A 2EHTA 2LL8A 3EJEA 1QRJA 3WBHA 2VLQA 4U0AA 1CEIA 1EOQA 2PEKA 5KP6B 2JQ4A 5I4TG 2X2BA 5EJDA 1YJWP 2K0YA 2XZ0D 1Q82Q 2N98A 4QKOA 3CCMP 3G28A 5HGNA 3VRLC 3GZLA 2KGAA 2AFEA 2JYLA 2FACA 5JPAA 1AUMA 3H0DA 1A43A 1W2BO 1YHQP 4U0FA 5KP8B 5F2NA 2LIUA 3CE7A 2QNWA 1KLPA 1FR2A 2KGCA 3CXCO 1VQMP 3G4SP 2E1MA 1GXHA 1YI2P 3CMEP 2LKIA 2K93A 2MVUA 2L9FA 4F37A 2OTJP 1ZNVA 5HV8A 2AFDA 4PXHB 1A8OA 1RO2A 3CC4P 2FVEA 2EG5A 2MR7A 4PH0A 1JJ2O 4MRTC 3G29A 4PH1A 2VSQA 3U43A 1ZMBA 2VLPA 2K0XA 2QEXP 3B5IA 4NEOA 4WYMA 1IUQA 1M6EX 2GZIA 2ONTA 1K9MQ 2KWLA 1BAJA 2EHSA 3H47A 1S72P 5HGOA 3G6EP 2GDXA 2GZFA 2N50A 3DS2A 3CCVP 2FHSC 2XV6A 3H4EA 2EIAA 1MZ8A 2FVFA 1M90Q 4DG9A 2MY5A 2WPTA 1IMQA 1UNKA 3B4QA 3G1GA 1VQ7P 2XT1A 5BS2A 3I55P 2ERHA 1NQ4A 2PEOA 2FQ2A 1IMPA 4XFXA 1EIAA 2N6YA 2PEJA 4COCA 2M8LA 5HVCA 4HKGA 2KORA 2DNWA 4GR2A 2MVVA 2ROQA 2K5XA 1L0IA 3CC2P 2QA4P 2DGYA 2JBGA 1KD1Q 2KW2A 5CZDB 3DS4A 1K73Q 2JU1A 2CGQA 4H2XC 2N5IA 2JO0A 3OW2O 2CNRA 2N6ZA 2XZ1C 2L6EA 1GXGA 1N8RQ 4U0EA 2FQ0A 1Q7YQ 1T8KA 2LTEA 2LOLA 2KOQA 3LRYA 5KP7B 3CMAP 3DPHA 2PY8A 1L0HA 2JB0A 1D1DA 1Q86Q 1DNYA 2Z46A 3M1MA 1K8AQ 2JU2A 3G21A 2JGPA 3G71P 3DS1A 3CCEP 3CCSP 3MGEA 2KODA 1VQKP 4QNBA 2MR8A 1YITP 4GR6A 1VQ8P 1ACPA 2FAEA 3HZQA 5F2KA 5DCKA 2KOSA 3CCJP 2PEQA 5BS1A 2BUOA 2L22A 2GDWA 2PEIA 3RG6C 2GZEA 2P9XA 1VQOP 1F80D 3CCUP 2FQ1A 2LIWA 3NTEA 2GYKA 2NO8A 1QVFO 3CD6P 1RNIA 3P05A 2Z45A 2KGDA 3DS5A 1OR5A 2FVAA 3DS0A 2PENA 3GZMA 2OTLP 4PWVB 2FADA 2L0QA 2K92A 1AYIA 4XROA 2K94A 2K0DX 5HGMA 2LPKA 1HQBA 1K30A 2GDYA 2M5RA 2KOPA 2CQ8A 4BPFA 1YJ9P 2LMLA 1UJZA 2M8PA 3HYBA 3G0VA 2KGEA 2L4BA 3EJBA 4XFZA 2KOOA 2KR5A 1Q81Q 1M1KQ 5F2OA 2XXMA 1VHNA 2MF4A 4H2YC 1RO0A 4XFYA 3I56P 2CWOA 2PEMA 3CCQP 4H2WC 1VQ9P 3CCRP 2AF8A 1KC8Q 1VKUA 3NY7B 2VLOA 1M6NA 3DS3A 2KG8A 5EW5E 3GKLC 2KG6A 1AF8A 2LF4A 7CEIA 1VQNP 2AVAA 5HGLA 1VQ6P 1VQPP 1E0HA
chains in the Genus database with same CATH topology
4CA3A 2FACA 1ACPA 2FAEA 2KG9A 2KOSA 5KP8B 2L22A 2GDWA 2PNGA 1DV5A 1NQ4A 1X3OA 2N5HA 3EJDA 2LIUA 2FQ2A 3CE7A 1F80D 4IZ6A 2FQ1A 2LIWA 4BPGA 2QNWA 1KLPA 2CG5B 2KGCA 4DG9A 2N6YA 5HVCA 4HKGA 2KORA 2DNWA 2KGDA 1HY8A 1OR5A 2FVAA 2MVVA 2ROQA 3GZMA 3LMOA 4PWVB 1L0IA 2FADA 2L0QA 2K92A 2K93A 2LKIA 2MVUA 4BPHA 2L9FA 3RG2A 2K94A 2KW2A 4R0MA 5CZDB 5HV8A 2AFDA 2LPKA 1HQBA 4PXHB 2FVEA 2GDYA 2M5RA 2MR7A 2KOPA 2JU1A 2CQ8A 2CGQA 4MRTC 4H2XC 2K2QA 2N5IA 4BPFA 2LMLA 2MD9A 2CNRA 2EHTA 2N6ZA 2VSQA 2LL8A 2KGEA 2L4BA 3EJBA 2XZ1C 2KOOA 2KR5A 2FQ0A 2MF4A 3EJEA 1T8KA 2LTEA 4H2YC 2LOLA 2KOQA 5KP7B 2K0XA 4H2WC 4NEOA 2AF8A 1VKUA 1L0HA 3NY7B 1DNYA 5KP6B 2JQ4A 2KG8A 2JU2A 2KWLA 2X2BA 2KG6A 5EJDA 1AF8A 2EHSA 2K0YA 2GDXA 2XZ0D 2JGPA 2N50A 2AVAA 2FHSC 2N98A 2FVFA 3GZLA 2KGAA 2MR8A 2AFEA 2MY5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CA3 A;  2FAC A;  1ACP A;  2FAE A;  2KG9 A;  2KOS A;  5KP8 B;  2L22 A;  2GDW A;  2PNG A;  1DV5 A;  1NQ4 A;  1X3O A;  2N5H A;  3EJD A;  2LIU A;  2FQ2 A;  3CE7 A;  1F80 D;  4IZ6 A;  2FQ1 A;  2LIW A;  4BPG A;  2QNW A;  1KLP A;  2CG5 B;  2KGC A;  4DG9 A;  2N6Y A;  5HVC A;  4HKG A;  2KOR A;  2DNW A;  2KGD A;  1HY8 A;  1OR5 A;  2FVA A;  2MVV A;  2ROQ A;  3GZM A;  3LMO A;  4PWV B;  1L0I A;  2FAD A;  2L0Q A;  2K92 A;  2K93 A;  2LKI A;  2MVU A;  4BPH A;  2L9F A;  3RG2 A;  2K94 A;  2KW2 A;  4R0M A;  5CZD B;  5HV8 A;  2AFD A;  2LPK A;  1HQB A;  4PXH B;  2FVE A;  2GDY A;  2M5R A;  2MR7 A;  2KOP A;  2JU1 A;  2CQ8 A;  2CGQ A;  4MRT C;  4H2X C;  2K2Q A;  2N5I A;  4BPF A;  2LML A;  2MD9 A;  2CNR A;  2EHT A;  2N6Z A;  2VSQ A;  2LL8 A;  2KGE A;  2L4B A;  3EJB A;  2XZ1 C;  2KOO A;  2KR5 A;  2FQ0 A;  2MF4 A;  3EJE A;  1T8K A;  2LTE A;  4H2Y C;  2LOL A;  2KOQ A;  5KP7 B;  2K0X A;  4H2W C;  4NEO A;  2AF8 A;  1VKU A;  1L0H A;  3NY7 B;  1DNY A;  5KP6 B;  2JQ4 A;  2KG8 A;  2JU2 A;  2KWL A;  2X2B A;  2KG6 A;  5EJD A;  1AF8 A;  2EHS A;  2K0Y A;  2GDX A;  2XZ0 D;  2JGP A;  2N50 A;  2AVA A;  2FHS C;  2N98 A;  2FVF A;  3GZL A;  2KGA A;  2MR8 A;  2AFE A;  2MY5 A; 
#chains in the Genus database with same CATH topology
 3E2D A;  1YIJ P;  4CA3 A;  4XRQ A;  1VQ5 P;  2EFJ A;  2GZJ A;  2KG9 A;  4U0B A;  1YJN P;  1QVG O;  4UHP B;  1KQS O;  1BXI A;  2PNG A;  4U0C A;  1DV5 A;  2GZG A;  1X3O A;  2N5H A;  3EJD A;  2JAZ A;  4IZ6 A;  4BPG A;  2M8N A;  4IPY A;  1NJI Q;  2CG5 B;  3CC7 P;  1GPJ A;  1HY8 A;  3GJN A;  3LMO A;  1VQ4 P;  2BHV A;  2VLN A;  4COP A;  4BPH A;  3RG2 A;  4R0M A;  1E6J P;  1VQL P;  2Z44 A;  1EMV A;  2OAR A;  4U0D A;  3Q20 A;  3CCL P;  1Z6M A;  4M0I A;  1M74 A;  3DTJ A;  3G26 A;  2K2Q A;  3G1I A;  3CPW O;  2JYG A;  2MD9 A;  2EHT A;  2LL8 A;  3EJE A;  1QRJ A;  3WBH A;  2VLQ A;  4U0A A;  1CEI A;  1EOQ A;  2PEK A;  5KP6 B;  2JQ4 A;  5I4T G;  2X2B A;  5EJD A;  1YJW P;  2K0Y A;  2XZ0 D;  1Q82 Q;  2N98 A;  4QKO A;  3CCM P;  3G28 A;  5HGN A;  3VRL C;  3GZL A;  2KGA A;  2AFE A;  2JYL A;  2FAC A;  5JPA A;  1AUM A;  3H0D A;  1A43 A;  1W2B O;  1YHQ P;  4U0F A;  5KP8 B;  5F2N A;  2LIU A;  3CE7 A;  2QNW A;  1KLP A;  1FR2 A;  2KGC A;  3CXC O;  1VQM P;  3G4S P;  2E1M A;  1GXH A;  1YI2 P;  3CME P;  2LKI A;  2K93 A;  2MVU A;  2L9F A;  4F37 A;  2OTJ P;  1ZNV A;  5HV8 A;  2AFD A;  4PXH B;  1A8O A;  1RO2 A;  3CC4 P;  2FVE A;  2EG5 A;  2MR7 A;  4PH0 A;  1JJ2 O;  4MRT C;  3G29 A;  4PH1 A;  2VSQ A;  3U43 A;  1ZMB A;  2VLP A;  2K0X A;  2QEX P;  3B5I A;  4NEO A;  4WYM A;  1IUQ A;  1M6E X;  2GZI A;  2ONT A;  1K9M Q;  2KWL A;  1BAJ A;  2EHS A;  3H47 A;  1S72 P;  5HGO A;  3G6E P;  2GDX A;  2GZF A;  2N50 A;  3DS2 A;  3CCV P;  2FHS C;  2XV6 A;  3H4E A;  2EIA A;  1MZ8 A;  2FVF A;  1M90 Q;  4DG9 A;  2MY5 A;  2WPT A;  1IMQ A;  1UNK A;  3B4Q A;  3G1G A;  1VQ7 P;  2XT1 A;  5BS2 A;  3I55 P;  2ERH A;  1NQ4 A;  2PEO A;  2FQ2 A;  1IMP A;  4XFX A;  1EIA A;  2N6Y A;  2PEJ A;  4COC A;  2M8L A;  5HVC A;  4HKG A;  2KOR A;  2DNW A;  4GR2 A;  2MVV A;  2ROQ A;  2K5X A;  1L0I A;  3CC2 P;  2QA4 P;  2DGY A;  2JBG A;  1KD1 Q;  2KW2 A;  5CZD B;  3DS4 A;  1K73 Q;  2JU1 A;  2CGQ A;  4H2X C;  2N5I A;  2JO0 A;  3OW2 O;  2CNR A;  2N6Z A;  2XZ1 C;  2L6E A;  1GXG A;  1N8R Q;  4U0E A;  2FQ0 A;  1Q7Y Q;  1T8K A;  2LTE A;  2LOL A;  2KOQ A;  3LRY A;  5KP7 B;  3CMA P;  3DPH A;  2PY8 A;  1L0H A;  2JB0 A;  1D1D A;  1Q86 Q;  1DNY A;  2Z46 A;  3M1M A;  1K8A Q;  2JU2 A;  3G21 A;  2JGP A;  3G71 P;  3DS1 A;  3CCE P;  3CCS P;  3MGE A;  2KOD A;  1VQK P;  4QNB A;  2MR8 A;  1YIT P;  4GR6 A;  1VQ8 P;  1ACP A;  2FAE A;  3HZQ A;  5F2K A;  5DCK A;  2KOS A;  3CCJ P;  2PEQ A;  5BS1 A;  2BUO A;  2L22 A;  2GDW A;  2PEI A;  3RG6 C;  2GZE A;  2P9X A;  1VQO P;  1F80 D;  3CCU P;  2FQ1 A;  2LIW A;  3NTE A;  2GYK A;  2NO8 A;  1QVF O;  3CD6 P;  1RNI A;  3P05 A;  2Z45 A;  2KGD A;  3DS5 A;  1OR5 A;  2FVA A;  3DS0 A;  2PEN A;  3GZM A;  2OTL P;  4PWV B;  2FAD A;  2L0Q A;  2K92 A;  1AYI A;  4XRO A;  2K94 A;  2K0D X;  5HGM A;  2LPK A;  1HQB A;  1K30 A;  2GDY A;  2M5R A;  2KOP A;  2CQ8 A;  4BPF A;  1YJ9 P;  2LML A;  1UJZ A;  2M8P A;  3HYB A;  3G0V A;  2KGE A;  2L4B A;  3EJB A;  4XFZ A;  2KOO A;  2KR5 A;  1Q81 Q;  1M1K Q;  5F2O A;  2XXM A;  1VHN A;  2MF4 A;  4H2Y C;  1RO0 A;  4XFY A;  3I56 P;  2CWO A;  2PEM A;  3CCQ P;  4H2W C;  1VQ9 P;  3CCR P;  2AF8 A;  1KC8 Q;  1VKU A;  3NY7 B;  2VLO A;  1M6N A;  3DS3 A;  2KG8 A;  5EW5 E;  3GKL C;  2KG6 A;  1AF8 A;  2LF4 A;  7CEI A;  1VQN P;  2AVA A;  5HGL A;  1VQ6 P;  1VQP P;  1E0H A; 
#chains in the Genus database with same CATH homology
 4CA3 A;  2FAC A;  1ACP A;  2FAE A;  2KG9 A;  2KOS A;  5KP8 B;  2L22 A;  2GDW A;  2PNG A;  1DV5 A;  1NQ4 A;  1X3O A;  2N5H A;  3EJD A;  2LIU A;  2FQ2 A;  3CE7 A;  1F80 D;  4IZ6 A;  2FQ1 A;  2LIW A;  4BPG A;  2QNW A;  1KLP A;  2CG5 B;  2KGC A;  4DG9 A;  2N6Y A;  5HVC A;  4HKG A;  2KOR A;  2DNW A;  2KGD A;  1HY8 A;  1OR5 A;  2FVA A;  2MVV A;  2ROQ A;  3GZM A;  3LMO A;  4PWV B;  1L0I A;  2FAD A;  2L0Q A;  2K92 A;  2K93 A;  2LKI A;  2MVU A;  4BPH A;  2L9F A;  3RG2 A;  2K94 A;  2KW2 A;  4R0M A;  5CZD B;  5HV8 A;  2AFD A;  2LPK A;  1HQB A;  4PXH B;  2FVE A;  2GDY A;  2M5R A;  2MR7 A;  2KOP A;  2JU1 A;  2CQ8 A;  2CGQ A;  4MRT C;  4H2X C;  2K2Q A;  2N5I A;  4BPF A;  2LML A;  2MD9 A;  2CNR A;  2EHT A;  2N6Z A;  2VSQ A;  2LL8 A;  2KGE A;  2L4B A;  3EJB A;  2XZ1 C;  2KOO A;  2KR5 A;  2FQ0 A;  2MF4 A;  3EJE A;  1T8K A;  2LTE A;  4H2Y C;  2LOL A;  2KOQ A;  5KP7 B;  2K0X A;  4H2W C;  4NEO A;  2AF8 A;  1VKU A;  1L0H A;  3NY7 B;  1DNY A;  5KP6 B;  2JQ4 A;  2KG8 A;  2JU2 A;  2KWL A;  2X2B A;  2KG6 A;  5EJD A;  1AF8 A;  2EHS A;  2K0Y A;  2GDX A;  2XZ0 D;  2JGP A;  2N50 A;  2AVA A;  2FHS C;  2N98 A;  2FVF A;  3GZL A;  2KGA A;  2MR8 A;  2AFE A;  2MY5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...