2MF4A

1h, 13c, 15n chemical shift assignments of streptomyces virginiae vira acp5a
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
85
structure length
85
Chain Sequence
GPGSAGRQEEIAEEVARLLAGVLYLEPDRLDPEETFLTLGVDSILGVEFVAAVNAAYPVGVKATALYDHPTPAAFARHIAESLGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Hybrid polyketide synthase-non ribosomal peptide synthetase
publication title NMR assignements of ACP5a
rcsb
source organism Streptomyces virginiae
molecule tags Transferase
total genus 21
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2013-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2mf4A01
2FADA 1F80D 2K92A 2KOSA 2KGEA 2LIUA 2CG5B 3LMOA 2KW2A 2DNWA 4MRTC 2N5HA 2XZ0D 2FACA 2KGAA 2AFDA 2FQ1A 2LIWA 2K0XA 1ACPA 5HV8A 5CZDB 2KGCA 1VKUA 2N5IA 4HKGA 2GDYA 2KR5A 2CQ8A 2N98A 2L4BA 1DV5A 2JGPA 3RG2A 2LTEA 1L0IA 1T8KA 2KOQA 2K2QA 5KP8B 2EHTA 2KG9A 3EJEA 2X2BA 2MD9A 2FQ2A 4CA3A 2FVFA 2K93A 1X3OA 2MR8A 2LOLA 4NEOA 1HQBA 2MF4A 1DNYA 4PXHB 2VSQA 2KG8A 4DG9A 4H2YC 2GDWA 2MY5A 2CNRA 2QNWA 3CE7A 5HVCA 2JQ4A 2KG6A 2MR7A 2JU1A 2M5RA 2FAEA 2KWLA 4H2WC 4R0MA 2LPKA 2LL8A 3GZLA 2KOPA 2GDXA 2ROQA 4BPGA 2K94A 2N50A 2K0YA 2EHSA 2L9FA 5EJDA 2KORA 1NQ4A 2L22A 4H2XC 4PWVB 1AF8A 5KP6B 1HY8A 1L0HA 2XZ1C 2MVVA 4BPHA 2AF8A 2LMLA 2FQ0A 2PNGA 2N6YA 2LKIA 1OR5A 2FHSC 2AVAA 3GZMA 2KOOA 2CGQA 3EJBA 2FVAA 2N6ZA 5KP7B 2KGDA 2FVEA 2JU2A 1KLPA 2L0QA 4BPFA 3NY7B 2AFEA 2MVUA 4IZ6A 3EJDA
chains in the Genus database with same CATH superfamily
2KOSA 2KGEA 2CG5B 2M8PA 2KW2A 2DNWA 4MRTC 1K73Q 2FACA 2K5XA 1VQ8P 2PENA 1D1DA 2K0XA 1IMPA 2N98A 1DV5A 2JO0A 3CXCO 2LTEA 1T8KA 3G29A 3G1GA 5KP8B 2VLOA 1YHQP 4GR6A 1X3OA 4XROA 2VLQA 3CC7P 1YJNP 3G28A 2KG8A 4DG9A 3DS2A 3MGEA 3CE7A 2JAZA 1GXHA 2KWLA 2LL8A 3CD6P 4BPGA 2N50A 2KORA 1NQ4A 5F2KA 4PWVB 4U0CA 1EOQA 4COCA 4U0DA 2L6EA 1MZ8A 4GR2A 4XFYA 2FQ0A 2PEJA 1S72P 1Q82Q 1OR5A 3DPHA 3I55P 4UHPB 3CCLP 3GJNA 2N6ZA 5KP7B 1K9MQ 1YITP 2JU2A 1KLPA 4BPFA 3B5IA 2AFEA 2EFJA 4U0EA 1M6EX 2OTLP 2PEOA 3U43A 1VQNP 1YI2P 1RNIA 5HGLA 2N5HA 1Z6MA 2KGAA 3G1IA 5BS1A 2LF4A 4XFZA 1ACPA 4U0BA 2GZGA 5HV8A 1VKUA 2GDYA 1Q86Q 3HYBA 1VQPP 1QRJA 1BXIA 3CCRP 2X2BA 2MD9A 2VLPA 1M90Q 3G26A 1RO2A 4PH1A 1RO0A 3DS5A 2NO8A 1FR2A 2MR8A 2PEKA 1DNYA 1VQMP 2VSQA 3CCSP 4WYMA 2GDWA 3CPWO 2MY5A 3H47A 5HVCA 3LRYA 2JQ4A 3DS0A 1EIAA 1ZNVA 2JYLA 2Z44A 2PEQA 4H2WC 2PY8A 4XRQA 2BUOA 3GZLA 2GDXA 2M8NA 1Q7YQ 3CCJP 4F37A 2L9FA 5EJDA 4H2XC 2ERHA 2WPTA 2PEIA 1HY8A 1L0HA 2JB0A 1VQ4P 4BPHA 1KQSO 2LMLA 3CCMP 1Q81Q 3CC4P 3M1MA 2JYGA 5BS2A 1BAJA 1ZMBA 2AVAA 3GZMA 4M0IA 2FVAA 2GZEA 2FVEA 4XFXA 4IZ6A 3EJDA 2PEMA 2K92A 1KC8Q 1M74A 3H4EA 1W2BO 1YIJP 1VQ6P 4COPA 5HGOA 2KGCA 2N5IA 4PH0A 4HKGA 2L4BA 3CCVP 3RG2A 1A43A 1IUQA 1GPJA 2EHTA 3DS1A 2KG9A 4U0FA 1EMVA 4QNBA 4CA3A 3H0DA 2K93A 1N8RQ 1IMQA 4IPYA 5EW5E 1HQBA 2MF4A 4PXHB 1QVFO 2CWOA 2KG6A 2JU1A 2M5RA 2Z46A 3G6EP 2GZIA 1K30A 2QA4P 2GZJA 4R0MA 2LPKA 3G21A 2KOPA 1CEIA 2ROQA 2K94A 2P9XA 3DS3A 3CCQP 1KD1Q 1VQOP 1AF8A 2GZFA 4U0AA 2L22A 3VRLC 1QVGO 3G0VA 1NJIQ 3CMAP 5KP6B 3Q20A 2XV6A 5F2OA 3P05A 2DGYA 3HZQA 3CMEP 5HGNA 2N6YA 2LKIA 2XXMA 3EJBA 1M1KQ 1M6NA 2VLNA 5F2NA 2KGDA 1YJWP 2M8LA 2OARA 3NY7B 7CEIA 2MVUA 5DCKA 3CCEP 2EG5A 2OTJP 3E2DA 2FADA 1F80D 1UJZA 2LIUA 1JJ2O 3B4QA 3LMOA 1VQ9P 3RG6C 2XZ0D 5HGMA 3WBHA 2JBGA 2AFDA 2FQ1A 2LIWA 3GKLC 1GXGA 5CZDB 2KR5A 2CQ8A 2JGPA 2GYKA 3G71P 3NTEA 1L0IA 3CCUP 2KOQA 2K2QA 3I56P 3EJEA 2FQ2A 1E6JP 2FVFA 5JPAA 1E0HA 2LOLA 4NEOA 1VQLP 2XT1A 4H2YC 2CNRA 4QKOA 1YJ9P 2QNWA 3G4SP 3OW2O 1VQ5P 2K0DX 2MR7A 1VHNA 2FAEA 2BHVA 2E1MA 2K0YA 2EHSA 1VQKP 3CC2P 1K8AQ 2KODA 2ONTA 2XZ1C 2QEXP 2MVVA 2AF8A 5I4TG 1A8OA 2PNGA 1UNKA 2Z45A 3DTJA 1VQ7P 2FHSC 2KOOA 1AYIA 2CGQA 3DS4A 1AUMA 2L0QA 2EIAA
chains in the Genus database with same CATH topology
2FADA 1F80D 2K92A 2KOSA 2KGEA 2LIUA 2CG5B 3LMOA 2KW2A 2DNWA 4MRTC 2N5HA 2XZ0D 2FACA 2KGAA 2AFDA 2FQ1A 2LIWA 2K0XA 1ACPA 5HV8A 5CZDB 2KGCA 1VKUA 2N5IA 4HKGA 2GDYA 2KR5A 2CQ8A 2N98A 2L4BA 1DV5A 2JGPA 3RG2A 2LTEA 1L0IA 1T8KA 2KOQA 2K2QA 5KP8B 2EHTA 2KG9A 3EJEA 2X2BA 2MD9A 2FQ2A 4CA3A 2FVFA 2K93A 1X3OA 2MR8A 2LOLA 4NEOA 1HQBA 2MF4A 1DNYA 4PXHB 2VSQA 2KG8A 4DG9A 4H2YC 2GDWA 2MY5A 2CNRA 2QNWA 3CE7A 5HVCA 2JQ4A 2KG6A 2MR7A 2JU1A 2M5RA 2FAEA 2KWLA 4H2WC 4R0MA 2LPKA 2LL8A 3GZLA 2KOPA 2GDXA 2ROQA 4BPGA 2K94A 2N50A 2K0YA 2EHSA 2L9FA 5EJDA 2KORA 1NQ4A 2L22A 4H2XC 4PWVB 1AF8A 5KP6B 1HY8A 1L0HA 2XZ1C 2MVVA 4BPHA 2AF8A 2LMLA 2FQ0A 2PNGA 2N6YA 2LKIA 1OR5A 2FHSC 2AVAA 3GZMA 2KOOA 2CGQA 3EJBA 2FVAA 2N6ZA 5KP7B 2KGDA 2FVEA 2JU2A 1KLPA 2L0QA 4BPFA 3NY7B 2AFEA 2MVUA 4IZ6A 3EJDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FAD A;  1F80 D;  2K92 A;  2KOS A;  2KGE A;  2LIU A;  2CG5 B;  3LMO A;  2KW2 A;  2DNW A;  4MRT C;  2N5H A;  2XZ0 D;  2FAC A;  2KGA A;  2AFD A;  2FQ1 A;  2LIW A;  2K0X A;  1ACP A;  5HV8 A;  5CZD B;  2KGC A;  1VKU A;  2N5I A;  4HKG A;  2GDY A;  2KR5 A;  2CQ8 A;  2N98 A;  2L4B A;  1DV5 A;  2JGP A;  3RG2 A;  2LTE A;  1L0I A;  1T8K A;  2KOQ A;  2K2Q A;  5KP8 B;  2EHT A;  2KG9 A;  3EJE A;  2X2B A;  2MD9 A;  2FQ2 A;  4CA3 A;  2FVF A;  2K93 A;  1X3O A;  2MR8 A;  2LOL A;  4NEO A;  1HQB A;  2MF4 A;  1DNY A;  4PXH B;  2VSQ A;  2KG8 A;  4DG9 A;  4H2Y C;  2GDW A;  2MY5 A;  2CNR A;  2QNW A;  3CE7 A;  5HVC A;  2JQ4 A;  2KG6 A;  2MR7 A;  2JU1 A;  2M5R A;  2FAE A;  2KWL A;  4H2W C;  4R0M A;  2LPK A;  2LL8 A;  3GZL A;  2KOP A;  2GDX A;  2ROQ A;  4BPG A;  2K94 A;  2N50 A;  2K0Y A;  2EHS A;  2L9F A;  5EJD A;  2KOR A;  1NQ4 A;  2L22 A;  4H2X C;  4PWV B;  1AF8 A;  5KP6 B;  1HY8 A;  1L0H A;  2XZ1 C;  2MVV A;  4BPH A;  2AF8 A;  2LML A;  2FQ0 A;  2PNG A;  2N6Y A;  2LKI A;  1OR5 A;  2FHS C;  2AVA A;  3GZM A;  2KOO A;  2CGQ A;  3EJB A;  2FVA A;  2N6Z A;  5KP7 B;  2KGD A;  2FVE A;  2JU2 A;  1KLP A;  2L0Q A;  4BPF A;  3NY7 B;  2AFE A;  2MVU A;  4IZ6 A;  3EJD A; 
#chains in the Genus database with same CATH topology
 2KOS A;  2KGE A;  2CG5 B;  2M8P A;  2KW2 A;  2DNW A;  4MRT C;  1K73 Q;  2FAC A;  2K5X A;  1VQ8 P;  2PEN A;  1D1D A;  2K0X A;  1IMP A;  2N98 A;  1DV5 A;  2JO0 A;  3CXC O;  2LTE A;  1T8K A;  3G29 A;  3G1G A;  5KP8 B;  2VLO A;  1YHQ P;  4GR6 A;  1X3O A;  4XRO A;  2VLQ A;  3CC7 P;  1YJN P;  3G28 A;  2KG8 A;  4DG9 A;  3DS2 A;  3MGE A;  3CE7 A;  2JAZ A;  1GXH A;  2KWL A;  2LL8 A;  3CD6 P;  4BPG A;  2N50 A;  2KOR A;  1NQ4 A;  5F2K A;  4PWV B;  4U0C A;  1EOQ A;  4COC A;  4U0D A;  2L6E A;  1MZ8 A;  4GR2 A;  4XFY A;  2FQ0 A;  2PEJ A;  1S72 P;  1Q82 Q;  1OR5 A;  3DPH A;  3I55 P;  4UHP B;  3CCL P;  3GJN A;  2N6Z A;  5KP7 B;  1K9M Q;  1YIT P;  2JU2 A;  1KLP A;  4BPF A;  3B5I A;  2AFE A;  2EFJ A;  4U0E A;  1M6E X;  2OTL P;  2PEO A;  3U43 A;  1VQN P;  1YI2 P;  1RNI A;  5HGL A;  2N5H A;  1Z6M A;  2KGA A;  3G1I A;  5BS1 A;  2LF4 A;  4XFZ A;  1ACP A;  4U0B A;  2GZG A;  5HV8 A;  1VKU A;  2GDY A;  1Q86 Q;  3HYB A;  1VQP P;  1QRJ A;  1BXI A;  3CCR P;  2X2B A;  2MD9 A;  2VLP A;  1M90 Q;  3G26 A;  1RO2 A;  4PH1 A;  1RO0 A;  3DS5 A;  2NO8 A;  1FR2 A;  2MR8 A;  2PEK A;  1DNY A;  1VQM P;  2VSQ A;  3CCS P;  4WYM A;  2GDW A;  3CPW O;  2MY5 A;  3H47 A;  5HVC A;  3LRY A;  2JQ4 A;  3DS0 A;  1EIA A;  1ZNV A;  2JYL A;  2Z44 A;  2PEQ A;  4H2W C;  2PY8 A;  4XRQ A;  2BUO A;  3GZL A;  2GDX A;  2M8N A;  1Q7Y Q;  3CCJ P;  4F37 A;  2L9F A;  5EJD A;  4H2X C;  2ERH A;  2WPT A;  2PEI A;  1HY8 A;  1L0H A;  2JB0 A;  1VQ4 P;  4BPH A;  1KQS O;  2LML A;  3CCM P;  1Q81 Q;  3CC4 P;  3M1M A;  2JYG A;  5BS2 A;  1BAJ A;  1ZMB A;  2AVA A;  3GZM A;  4M0I A;  2FVA A;  2GZE A;  2FVE A;  4XFX A;  4IZ6 A;  3EJD A;  2PEM A;  2K92 A;  1KC8 Q;  1M74 A;  3H4E A;  1W2B O;  1YIJ P;  1VQ6 P;  4COP A;  5HGO A;  2KGC A;  2N5I A;  4PH0 A;  4HKG A;  2L4B A;  3CCV P;  3RG2 A;  1A43 A;  1IUQ A;  1GPJ A;  2EHT A;  3DS1 A;  2KG9 A;  4U0F A;  1EMV A;  4QNB A;  4CA3 A;  3H0D A;  2K93 A;  1N8R Q;  1IMQ A;  4IPY A;  5EW5 E;  1HQB A;  2MF4 A;  4PXH B;  1QVF O;  2CWO A;  2KG6 A;  2JU1 A;  2M5R A;  2Z46 A;  3G6E P;  2GZI A;  1K30 A;  2QA4 P;  2GZJ A;  4R0M A;  2LPK A;  3G21 A;  2KOP A;  1CEI A;  2ROQ A;  2K94 A;  2P9X A;  3DS3 A;  3CCQ P;  1KD1 Q;  1VQO P;  1AF8 A;  2GZF A;  4U0A A;  2L22 A;  3VRL C;  1QVG O;  3G0V A;  1NJI Q;  3CMA P;  5KP6 B;  3Q20 A;  2XV6 A;  5F2O A;  3P05 A;  2DGY A;  3HZQ A;  3CME P;  5HGN A;  2N6Y A;  2LKI A;  2XXM A;  3EJB A;  1M1K Q;  1M6N A;  2VLN A;  5F2N A;  2KGD A;  1YJW P;  2M8L A;  2OAR A;  3NY7 B;  7CEI A;  2MVU A;  5DCK A;  3CCE P;  2EG5 A;  2OTJ P;  3E2D A;  2FAD A;  1F80 D;  1UJZ A;  2LIU A;  1JJ2 O;  3B4Q A;  3LMO A;  1VQ9 P;  3RG6 C;  2XZ0 D;  5HGM A;  3WBH A;  2JBG A;  2AFD A;  2FQ1 A;  2LIW A;  3GKL C;  1GXG A;  5CZD B;  2KR5 A;  2CQ8 A;  2JGP A;  2GYK A;  3G71 P;  3NTE A;  1L0I A;  3CCU P;  2KOQ A;  2K2Q A;  3I56 P;  3EJE A;  2FQ2 A;  1E6J P;  2FVF A;  5JPA A;  1E0H A;  2LOL A;  4NEO A;  1VQL P;  2XT1 A;  4H2Y C;  2CNR A;  4QKO A;  1YJ9 P;  2QNW A;  3G4S P;  3OW2 O;  1VQ5 P;  2K0D X;  2MR7 A;  1VHN A;  2FAE A;  2BHV A;  2E1M A;  2K0Y A;  2EHS A;  1VQK P;  3CC2 P;  1K8A Q;  2KOD A;  2ONT A;  2XZ1 C;  2QEX P;  2MVV A;  2AF8 A;  5I4T G;  1A8O A;  2PNG A;  1UNK A;  2Z45 A;  3DTJ A;  1VQ7 P;  2FHS C;  2KOO A;  1AYI A;  2CGQ A;  3DS4 A;  1AUM A;  2L0Q A;  2EIA A; 
#chains in the Genus database with same CATH homology
 2FAD A;  1F80 D;  2K92 A;  2KOS A;  2KGE A;  2LIU A;  2CG5 B;  3LMO A;  2KW2 A;  2DNW A;  4MRT C;  2N5H A;  2XZ0 D;  2FAC A;  2KGA A;  2AFD A;  2FQ1 A;  2LIW A;  2K0X A;  1ACP A;  5HV8 A;  5CZD B;  2KGC A;  1VKU A;  2N5I A;  4HKG A;  2GDY A;  2KR5 A;  2CQ8 A;  2N98 A;  2L4B A;  1DV5 A;  2JGP A;  3RG2 A;  2LTE A;  1L0I A;  1T8K A;  2KOQ A;  2K2Q A;  5KP8 B;  2EHT A;  2KG9 A;  3EJE A;  2X2B A;  2MD9 A;  2FQ2 A;  4CA3 A;  2FVF A;  2K93 A;  1X3O A;  2MR8 A;  2LOL A;  4NEO A;  1HQB A;  2MF4 A;  1DNY A;  4PXH B;  2VSQ A;  2KG8 A;  4DG9 A;  4H2Y C;  2GDW A;  2MY5 A;  2CNR A;  2QNW A;  3CE7 A;  5HVC A;  2JQ4 A;  2KG6 A;  2MR7 A;  2JU1 A;  2M5R A;  2FAE A;  2KWL A;  4H2W C;  4R0M A;  2LPK A;  2LL8 A;  3GZL A;  2KOP A;  2GDX A;  2ROQ A;  4BPG A;  2K94 A;  2N50 A;  2K0Y A;  2EHS A;  2L9F A;  5EJD A;  2KOR A;  1NQ4 A;  2L22 A;  4H2X C;  4PWV B;  1AF8 A;  5KP6 B;  1HY8 A;  1L0H A;  2XZ1 C;  2MVV A;  4BPH A;  2AF8 A;  2LML A;  2FQ0 A;  2PNG A;  2N6Y A;  2LKI A;  1OR5 A;  2FHS C;  2AVA A;  3GZM A;  2KOO A;  2CGQ A;  3EJB A;  2FVA A;  2N6Z A;  5KP7 B;  2KGD A;  2FVE A;  2JU2 A;  1KLP A;  2L0Q A;  4BPF A;  3NY7 B;  2AFE A;  2MVU A;  4IZ6 A;  3EJD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...