2MF4A

1h, 13c, 15n chemical shift assignments of streptomyces virginiae vira acp5a
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
85
structure length
85
Chain Sequence
GPGSAGRQEEIAEEVARLLAGVLYLEPDRLDPEETFLTLGVDSILGVEFVAAVNAAYPVGVKATALYDHPTPAAFARHIAESLGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Hybrid polyketide synthase-non ribosomal peptide synthetase
publication title NMR assignements of ACP5a
rcsb
source organism Streptomyces virginiae
molecule tags Transferase
total genus 21
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2013-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2mf4A01
2LKIA 2M5RA 2KW2A 2FAEA 3EJDA 2CQ8A 5KP8B 2L0QA 4IZ6A 5HVCA 2KGEA 2K2QA 4H2YC 1OR5A 2L4BA 4NEOA 3NY7B 2N5HA 2FHSC 2K0XA 2X2BA 2K93A 2JU2A 2FQ0A 2MD9A 2K94A 2KGCA 4PWVB 2KWLA 1DV5A 2FVEA 2KGDA 2XZ0D 3LMOA 5EJDA 5HV8A 1NQ4A 2QNWA 2L9FA 2AFDA 2FACA 2XZ1C 4H2XC 2GDWA 2KR5A 2JQ4A 2AFEA 2KGAA 2N98A 2JGPA 4CA3A 1DNYA 3EJBA 2KOPA 2EHTA 1X3OA 1F80D 1HQBA 2MVUA 1VKUA 2LIWA 1AF8A 2DNWA 2LOLA 2EHSA 2FQ2A 2N6YA 4R0MA 4H2WC 2LTEA 2MF4A 5CZDB 2ROQA 2L22A 2JU1A 2MR7A 2K0YA 2KOSA 5KP6B 2N5IA 1KLPA 2KORA 4MRTC 2AF8A 5KP7B 3CE7A 1T8KA 2FVAA 2FVFA 2GDXA 4DG9A 3GZLA 2MY5A 2KOOA 2CGQA 2CNRA 2LMLA 2CG5B 3GZMA 4HKGA 1HY8A 2K92A 2VSQA 4BPFA 4BPHA 1ACPA 2FQ1A 4BPGA 2KOQA 3RG2A 2PNGA 2MVVA 2KG8A 2KG6A 3EJEA 1L0HA 2KG9A 2LIUA 2GDYA 4PXHB 2N6ZA 2AVAA 2MR8A 2LL8A 2N50A 2LPKA 1L0IA 2FADA
chains in the Genus database with same CATH superfamily
2LKIA 3G4SP 2M5RA 2EIAA 2GZIA 5KP8B 1RO2A 2KGEA 5HVCA 3DS2A 1W2BO 1VQ9P 2L4BA 4NEOA 4F37A 2FQ0A 2MD9A 2KODA 3WBHA 2KGCA 2KGDA 2XZ0D 3G1IA 1E6JP 2L6EA 1E0HA 1NQ4A 3HYBA 2L9FA 2QEXP 1ZNVA 4XRQA 1AUMA 1JJ2O 1K73Q 2K5XA 1KQSO 5BS1A 2JGPA 2KOPA 4XFXA 2EFJA 3U43A 2LIWA 5HGOA 2QA4P 1EMVA 1AF8A 5F2OA 3I55P 2NO8A 3CCMP 2DGYA 4R0MA 3DS1A 2JU1A 5KP6B 4COCA 2AF8A 5KP7B 2E1MA 3CC7P 2GDXA 5JPAA 1VQ6P 1ZMBA 3GZLA 2VLNA 2BUOA 1QRJA 4IPYA 2K92A 4PH1A 1RO0A 2PNGA 2MVVA 1GXGA 1EIAA 2KG9A 2LIUA 2XT1A 4GR2A 2MR8A 3E2DA 1IUQA 2LL8A 3HZQA 2N50A 1Q82Q 2PY8A 4XROA 2FADA 3EJDA 1FR2A 3B4QA 1OR5A 1KD1Q 4QKOA 3NY7B 2N5HA 2X2BA 4U0DA 2KWLA 2FVEA 4XFYA 3LMOA 2JB0A 2GZFA 1NJIQ 2XXMA 1YITP 2QNWA 2JYGA 1Q81Q 2XZ1C 2GDWA 1DNYA 2EHTA 1X3OA 1VKUA 4U0CA 5EW5E 2DNWA 4U0FA 1VHNA 3DS3A 2EHSA 2N6YA 4WYMA 1GXHA 5HGLA 2MF4A 1A43A 3G21A 3G29A 3LRYA 2N5IA 2KORA 2MY5A 2PEKA 2CG5B 2PEIA 1M74A 3GZMA 2M8NA 3DTJA 1HY8A 2PEQA 2FQ1A 5HGNA 2OTJP 2M8LA 3NTEA 3RG2A 2KG8A 2VLQA 1QVGO 4PH0A 3CMAP 3CCSP 3CCLP 2AVAA 1A8OA 1VQNP 2LPKA 1K9MQ 2JAZA 3GJNA 3G71P 4GR6A 2FAEA 2WPTA 3CCQP 2L0QA 4IZ6A 1VQLP 1D1DA 1AYIA 2K2QA 4H2YC 3MGEA 1Q86Q 1K8AQ 2GYKA 2K0XA 3DS5A 7CEIA 2K94A 4PWVB 5EJDA 5HV8A 2P9XA 3RG6C 5HGMA 2FACA 3G0VA 1VQMP 2JQ4A 2AFEA 3I56P 2Z46A 1BAJA 1GPJA 2PEMA 3EJBA 2MVUA 1Z6MA 1UNKA 3P05A 1VQOP 2LF4A 2LOLA 3CCRP 1CEIA 1YJWP 1K30A 3G26A 2PENA 2JBGA 3GKLC 3DPHA 3H0DA 2L22A 1YHQP 4MRTC 3G28A 3CC4P 3CE7A 1MZ8A 1EOQA 2KOOA 3CC2P 2CGQA 2CNRA 2LMLA 3M1MA 4HKGA 4BPFA 4BPHA 1QVFO 5F2NA 4BPGA 2KOQA 2VLOA 2KG6A 3EJEA 1L0HA 3OW2O 1IMQA 2GDYA 4U0EA 4PXHB 2Z45A 5BS2A 1M6EX 4QNBA 1VQPP 3G1GA 1M1KQ 1YJ9P 1IMPA 1N8RQ 1M6NA 2KW2A 1VQ4P 2GZJA 2CQ8A 5F2KA 3H47A 2PEOA 2GZEA 1M90Q 2PEJA 3CCUP 2M8PA 3DS0A 2FHSC 2K93A 1VQKP 1YJNP 2JU2A 2XV6A 1DV5A 3CMEP 4XFZA 1S72P 5I4TG 2AFDA 3G6EP 2CWOA 4H2XC 2KR5A 2KGAA 4M0IA 2N98A 4CA3A 2OARA 1F80D 1HQBA 1KC8Q 3Q20A 3B5IA 3VRLC 2FQ2A 1UJZA 2Z44A 1Q7YQ 4H2WC 3CCVP 1YI2P 2LTEA 5CZDB 2ROQA 2MR7A 4U0BA 2K0YA 2KOSA 1VQ8P 3CPWO 2EG5A 1KLPA 1RNIA 5DCKA 1T8KA 4DG9A 2FVAA 2FVFA 2BHVA 4COPA 4U0AA 2JYLA 2VSQA 1VQ7P 1ACPA 1BXIA 2ERHA 1YIJP 3H4EA 3DS4A 3CXCO 2GZGA 2VLPA 3CD6P 4UHPB 2ONTA 2N6ZA 2OTLP 3CCEP 2K0DX 3CCJP 1VQ5P 1L0IA 2JO0A
chains in the Genus database with same CATH topology
2LKIA 2M5RA 2KW2A 2FAEA 3EJDA 2CQ8A 5KP8B 2L0QA 4IZ6A 5HVCA 2KGEA 2K2QA 4H2YC 1OR5A 2L4BA 4NEOA 3NY7B 2N5HA 2FHSC 2K0XA 2X2BA 2K93A 2JU2A 2FQ0A 2MD9A 2K94A 2KGCA 4PWVB 2KWLA 1DV5A 2FVEA 2KGDA 2XZ0D 3LMOA 5EJDA 5HV8A 1NQ4A 2QNWA 2L9FA 2AFDA 2FACA 2XZ1C 4H2XC 2GDWA 2KR5A 2JQ4A 2AFEA 2KGAA 2N98A 2JGPA 4CA3A 1DNYA 3EJBA 2KOPA 2EHTA 1X3OA 1F80D 1HQBA 2MVUA 1VKUA 2LIWA 1AF8A 2DNWA 2LOLA 2EHSA 2FQ2A 2N6YA 4R0MA 4H2WC 2LTEA 2MF4A 5CZDB 2ROQA 2L22A 2JU1A 2MR7A 2K0YA 2KOSA 5KP6B 2N5IA 1KLPA 2KORA 4MRTC 2AF8A 5KP7B 3CE7A 1T8KA 2FVAA 2FVFA 2GDXA 4DG9A 3GZLA 2MY5A 2KOOA 2CGQA 2CNRA 2LMLA 2CG5B 3GZMA 4HKGA 1HY8A 2K92A 2VSQA 4BPFA 4BPHA 1ACPA 2FQ1A 4BPGA 2KOQA 3RG2A 2PNGA 2MVVA 2KG8A 2KG6A 3EJEA 1L0HA 2KG9A 2LIUA 2GDYA 4PXHB 2N6ZA 2AVAA 2MR8A 2LL8A 2N50A 2LPKA 1L0IA 2FADA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LKI A;  2M5R A;  2KW2 A;  2FAE A;  3EJD A;  2CQ8 A;  5KP8 B;  2L0Q A;  4IZ6 A;  5HVC A;  2KGE A;  2K2Q A;  4H2Y C;  1OR5 A;  2L4B A;  4NEO A;  3NY7 B;  2N5H A;  2FHS C;  2K0X A;  2X2B A;  2K93 A;  2JU2 A;  2FQ0 A;  2MD9 A;  2K94 A;  2KGC A;  4PWV B;  2KWL A;  1DV5 A;  2FVE A;  2KGD A;  2XZ0 D;  3LMO A;  5EJD A;  5HV8 A;  1NQ4 A;  2QNW A;  2L9F A;  2AFD A;  2FAC A;  2XZ1 C;  4H2X C;  2GDW A;  2KR5 A;  2JQ4 A;  2AFE A;  2KGA A;  2N98 A;  2JGP A;  4CA3 A;  1DNY A;  3EJB A;  2KOP A;  2EHT A;  1X3O A;  1F80 D;  1HQB A;  2MVU A;  1VKU A;  2LIW A;  1AF8 A;  2DNW A;  2LOL A;  2EHS A;  2FQ2 A;  2N6Y A;  4R0M A;  4H2W C;  2LTE A;  2MF4 A;  5CZD B;  2ROQ A;  2L22 A;  2JU1 A;  2MR7 A;  2K0Y A;  2KOS A;  5KP6 B;  2N5I A;  1KLP A;  2KOR A;  4MRT C;  2AF8 A;  5KP7 B;  3CE7 A;  1T8K A;  2FVA A;  2FVF A;  2GDX A;  4DG9 A;  3GZL A;  2MY5 A;  2KOO A;  2CGQ A;  2CNR A;  2LML A;  2CG5 B;  3GZM A;  4HKG A;  1HY8 A;  2K92 A;  2VSQ A;  4BPF A;  4BPH A;  1ACP A;  2FQ1 A;  4BPG A;  2KOQ A;  3RG2 A;  2PNG A;  2MVV A;  2KG8 A;  2KG6 A;  3EJE A;  1L0H A;  2KG9 A;  2LIU A;  2GDY A;  4PXH B;  2N6Z A;  2AVA A;  2MR8 A;  2LL8 A;  2N50 A;  2LPK A;  1L0I A;  2FAD A; 
#chains in the Genus database with same CATH topology
 2LKI A;  3G4S P;  2M5R A;  2EIA A;  2GZI A;  5KP8 B;  1RO2 A;  2KGE A;  5HVC A;  3DS2 A;  1W2B O;  1VQ9 P;  2L4B A;  4NEO A;  4F37 A;  2FQ0 A;  2MD9 A;  2KOD A;  3WBH A;  2KGC A;  2KGD A;  2XZ0 D;  3G1I A;  1E6J P;  2L6E A;  1E0H A;  1NQ4 A;  3HYB A;  2L9F A;  2QEX P;  1ZNV A;  4XRQ A;  1AUM A;  1JJ2 O;  1K73 Q;  2K5X A;  1KQS O;  5BS1 A;  2JGP A;  2KOP A;  4XFX A;  2EFJ A;  3U43 A;  2LIW A;  5HGO A;  2QA4 P;  1EMV A;  1AF8 A;  5F2O A;  3I55 P;  2NO8 A;  3CCM P;  2DGY A;  4R0M A;  3DS1 A;  2JU1 A;  5KP6 B;  4COC A;  2AF8 A;  5KP7 B;  2E1M A;  3CC7 P;  2GDX A;  5JPA A;  1VQ6 P;  1ZMB A;  3GZL A;  2VLN A;  2BUO A;  1QRJ A;  4IPY A;  2K92 A;  4PH1 A;  1RO0 A;  2PNG A;  2MVV A;  1GXG A;  1EIA A;  2KG9 A;  2LIU A;  2XT1 A;  4GR2 A;  2MR8 A;  3E2D A;  1IUQ A;  2LL8 A;  3HZQ A;  2N50 A;  1Q82 Q;  2PY8 A;  4XRO A;  2FAD A;  3EJD A;  1FR2 A;  3B4Q A;  1OR5 A;  1KD1 Q;  4QKO A;  3NY7 B;  2N5H A;  2X2B A;  4U0D A;  2KWL A;  2FVE A;  4XFY A;  3LMO A;  2JB0 A;  2GZF A;  1NJI Q;  2XXM A;  1YIT P;  2QNW A;  2JYG A;  1Q81 Q;  2XZ1 C;  2GDW A;  1DNY A;  2EHT A;  1X3O A;  1VKU A;  4U0C A;  5EW5 E;  2DNW A;  4U0F A;  1VHN A;  3DS3 A;  2EHS A;  2N6Y A;  4WYM A;  1GXH A;  5HGL A;  2MF4 A;  1A43 A;  3G21 A;  3G29 A;  3LRY A;  2N5I A;  2KOR A;  2MY5 A;  2PEK A;  2CG5 B;  2PEI A;  1M74 A;  3GZM A;  2M8N A;  3DTJ A;  1HY8 A;  2PEQ A;  2FQ1 A;  5HGN A;  2OTJ P;  2M8L A;  3NTE A;  3RG2 A;  2KG8 A;  2VLQ A;  1QVG O;  4PH0 A;  3CMA P;  3CCS P;  3CCL P;  2AVA A;  1A8O A;  1VQN P;  2LPK A;  1K9M Q;  2JAZ A;  3GJN A;  3G71 P;  4GR6 A;  2FAE A;  2WPT A;  3CCQ P;  2L0Q A;  4IZ6 A;  1VQL P;  1D1D A;  1AYI A;  2K2Q A;  4H2Y C;  3MGE A;  1Q86 Q;  1K8A Q;  2GYK A;  2K0X A;  3DS5 A;  7CEI A;  2K94 A;  4PWV B;  5EJD A;  5HV8 A;  2P9X A;  3RG6 C;  5HGM A;  2FAC A;  3G0V A;  1VQM P;  2JQ4 A;  2AFE A;  3I56 P;  2Z46 A;  1BAJ A;  1GPJ A;  2PEM A;  3EJB A;  2MVU A;  1Z6M A;  1UNK A;  3P05 A;  1VQO P;  2LF4 A;  2LOL A;  3CCR P;  1CEI A;  1YJW P;  1K30 A;  3G26 A;  2PEN A;  2JBG A;  3GKL C;  3DPH A;  3H0D A;  2L22 A;  1YHQ P;  4MRT C;  3G28 A;  3CC4 P;  3CE7 A;  1MZ8 A;  1EOQ A;  2KOO A;  3CC2 P;  2CGQ A;  2CNR A;  2LML A;  3M1M A;  4HKG A;  4BPF A;  4BPH A;  1QVF O;  5F2N A;  4BPG A;  2KOQ A;  2VLO A;  2KG6 A;  3EJE A;  1L0H A;  3OW2 O;  1IMQ A;  2GDY A;  4U0E A;  4PXH B;  2Z45 A;  5BS2 A;  1M6E X;  4QNB A;  1VQP P;  3G1G A;  1M1K Q;  1YJ9 P;  1IMP A;  1N8R Q;  1M6N A;  2KW2 A;  1VQ4 P;  2GZJ A;  2CQ8 A;  5F2K A;  3H47 A;  2PEO A;  2GZE A;  1M90 Q;  2PEJ A;  3CCU P;  2M8P A;  3DS0 A;  2FHS C;  2K93 A;  1VQK P;  1YJN P;  2JU2 A;  2XV6 A;  1DV5 A;  3CME P;  4XFZ A;  1S72 P;  5I4T G;  2AFD A;  3G6E P;  2CWO A;  4H2X C;  2KR5 A;  2KGA A;  4M0I A;  2N98 A;  4CA3 A;  2OAR A;  1F80 D;  1HQB A;  1KC8 Q;  3Q20 A;  3B5I A;  3VRL C;  2FQ2 A;  1UJZ A;  2Z44 A;  1Q7Y Q;  4H2W C;  3CCV P;  1YI2 P;  2LTE A;  5CZD B;  2ROQ A;  2MR7 A;  4U0B A;  2K0Y A;  2KOS A;  1VQ8 P;  3CPW O;  2EG5 A;  1KLP A;  1RNI A;  5DCK A;  1T8K A;  4DG9 A;  2FVA A;  2FVF A;  2BHV A;  4COP A;  4U0A A;  2JYL A;  2VSQ A;  1VQ7 P;  1ACP A;  1BXI A;  2ERH A;  1YIJ P;  3H4E A;  3DS4 A;  3CXC O;  2GZG A;  2VLP A;  3CD6 P;  4UHP B;  2ONT A;  2N6Z A;  2OTL P;  3CCE P;  2K0D X;  3CCJ P;  1VQ5 P;  1L0I A;  2JO0 A; 
#chains in the Genus database with same CATH homology
 2LKI A;  2M5R A;  2KW2 A;  2FAE A;  3EJD A;  2CQ8 A;  5KP8 B;  2L0Q A;  4IZ6 A;  5HVC A;  2KGE A;  2K2Q A;  4H2Y C;  1OR5 A;  2L4B A;  4NEO A;  3NY7 B;  2N5H A;  2FHS C;  2K0X A;  2X2B A;  2K93 A;  2JU2 A;  2FQ0 A;  2MD9 A;  2K94 A;  2KGC A;  4PWV B;  2KWL A;  1DV5 A;  2FVE A;  2KGD A;  2XZ0 D;  3LMO A;  5EJD A;  5HV8 A;  1NQ4 A;  2QNW A;  2L9F A;  2AFD A;  2FAC A;  2XZ1 C;  4H2X C;  2GDW A;  2KR5 A;  2JQ4 A;  2AFE A;  2KGA A;  2N98 A;  2JGP A;  4CA3 A;  1DNY A;  3EJB A;  2KOP A;  2EHT A;  1X3O A;  1F80 D;  1HQB A;  2MVU A;  1VKU A;  2LIW A;  1AF8 A;  2DNW A;  2LOL A;  2EHS A;  2FQ2 A;  2N6Y A;  4R0M A;  4H2W C;  2LTE A;  2MF4 A;  5CZD B;  2ROQ A;  2L22 A;  2JU1 A;  2MR7 A;  2K0Y A;  2KOS A;  5KP6 B;  2N5I A;  1KLP A;  2KOR A;  4MRT C;  2AF8 A;  5KP7 B;  3CE7 A;  1T8K A;  2FVA A;  2FVF A;  2GDX A;  4DG9 A;  3GZL A;  2MY5 A;  2KOO A;  2CGQ A;  2CNR A;  2LML A;  2CG5 B;  3GZM A;  4HKG A;  1HY8 A;  2K92 A;  2VSQ A;  4BPF A;  4BPH A;  1ACP A;  2FQ1 A;  4BPG A;  2KOQ A;  3RG2 A;  2PNG A;  2MVV A;  2KG8 A;  2KG6 A;  3EJE A;  1L0H A;  2KG9 A;  2LIU A;  2GDY A;  4PXH B;  2N6Z A;  2AVA A;  2MR8 A;  2LL8 A;  2N50 A;  2LPK A;  1L0I A;  2FAD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...