2MF4A

1h, 13c, 15n chemical shift assignments of streptomyces virginiae vira acp5a
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
85
structure length
85
Chain Sequence
b'GPGSAGRQEEIAEEVARLLAGVLYLEPDRLDPEETFLTLGVDSILGVEFVAAVNAAYPVGVKATALYDHPTPAAFARHIAESLGA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Hybrid polyketide synthase-non ribosomal peptide synthetase
publication title NMR assignements of ACP5a
rcsb
source organism Streptomyces virginiae
molecule tags Transferase
total genus 21
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2013-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2mf4A01
1DV5A 2XZ1C 4NEOA 2LL8A 1KLPA 2ROQA 2CGQA 4BPGA 2KGCA 2MY5A 3LMOA 2K0YA 1OR5A 4IZ6A 4H2YC 3EJDA 1X3OA 3GZMA 1F80D 2KGDA 1L0IA 4R0MA 2LIUA 2AFDA 4BPHA 2JGPA 5KP8B 2KG8A 5KP7B 2K94A 2KW2A 4PXHB 2GDYA 1VKUA 2KGEA 2MVVA 1NQ4A 2AF8A 2L4BA 3EJBA 1HY8A 2VSQA 2KOQA 3CE7A 4MRTC 2KWLA 3GZLA 2CNRA 2FADA 2K2QA 2JU1A 2MR8A 1HQBA 4CA3A 5CZDB 2FACA 2KR5A 2L9FA 2KOOA 2KORA 2N5IA 2FHSC 2XZ0D 2L0QA 5KP6B 2LIWA 2MVUA 2PNGA 2M5RA 2JQ4A 2EHTA 2AVAA 2FVFA 2JU2A 2FAEA 2FVAA 2DNWA 4H2XC 2KG9A 2CQ8A 4PWVB 4HKGA 4DG9A 2KOPA 2CG5B 2FQ1A 3NY7B 2LPKA 1T8KA 2LMLA 2KOSA 2N6ZA 1DNYA 2FQ0A 2EHSA 2K93A 2N6YA 2N98A 5HV8A 2X2BA 2N5HA 2LTEA 2MF4A 2K0XA 3RG2A 2KGAA 2FQ2A 5HVCA 3EJEA 2L22A 2MD9A 1ACPA 2AFEA 1L0HA 2FVEA 2MR7A 2QNWA 2LKIA 2GDWA 5EJDA 2GDXA 4BPFA 2N50A 2KG6A 1AF8A 2LOLA 2K92A 4H2WC
chains in the Genus database with same CATH superfamily
3CC2P 2M8LA 4NEOA 1E0HA 2ROQA 4GR6A 3CCMP 1YJNP 2K0YA 1OR5A 3CCUP 4H2YC 1VQKP 1IMQA 2EIAA 1L0IA 3G28A 2AFDA 3H0DA 3DS0A 2K5XA 2BUOA 5KP8B 1YITP 2KG8A 1VKUA 2NO8A 2AF8A 1HY8A 2VSQA 4WYMA 1M1KQ 2CNRA 2VLPA 5BS1A 2JU1A 1AUMA 1GXGA 1UNKA 5CZDB 2KR5A 2KORA 2N5IA 2CWOA 2XZ0D 3CC7P 1QVFO 1A8OA 2L0QA 3CXCO 2LIWA 2PNGA 2JO0A 2M5RA 2EHTA 1RO2A 2FAEA 2FVAA 2JYLA 4H2XC 2CQ8A 1JJ2O 1RO0A 4HKGA 5HGOA 2PEKA 5HGLA 2PEOA 2FQ1A 1T8KA 3CMAP 4XROA 1M74A 1YJ9P 2GZFA 2EHSA 1M90Q 4GR2A 3I56P 1KQSO 2PEIA 3G6EP 2VLQA 3P05A 3CCLP 2OTJP 2MD9A 1YHQP 3G1IA 5EJDA 2GDXA 2N50A 2GZGA 2PENA 4XFZA 2LOLA 3CPWO 4QKOA 5F2OA 1Q82Q 2CGQA 1KC8Q 1VQ7P 3G29A 2KGCA 1MZ8A 4U0BA 5DCKA 2VLNA 4IZ6A 4U0AA 3GZMA 1YJWP 2PEQA 2KGDA 4R0MA 2P9XA 3CCEP 1IMPA 1NQ4A 2KOQA 3CE7A 1M6EX 2K2QA 1HQBA 3H47A 4U0FA 2FACA 2KOOA 1YI2P 2ERHA 5BS2A 3DTJA 1IUQA 2JQ4A 2OTLP 2LF4A 2AVAA 2JU2A 2KODA 2DNWA 1M6NA 2L6EA 1EMVA 2XXMA 4DG9A 5HGMA 2KOPA 2CG5B 2XT1A 3NY7B 2EG5A 2LPKA 1YIJP 2KOSA 1DNYA 3DS1A 2FQ0A 2GZIA 3CMEP 2K93A 2N6YA 3DS2A 3DS5A 2GYKA 3DS3A 3RG6C 1QVGO 2JBGA 2K0XA 3HYBA 3M1MA 2FQ2A 1VQNP 3U43A 2M8NA 1ACPA 1QRJA 4F37A 1L0HA 3Q20A 2FVEA 3G26A 1Q7YQ 2GDWA 4BPFA 5F2KA 4COCA 2DGYA 4PH0A 3VRLC 1AF8A 3G71P 2QEXP 1W2BO 5F2NA 1DV5A 1K30A 1BAJA 1VQ6P 3CD6P 2LL8A 1ZNVA 3CCQP 3G1GA 3LMOA 1X3OA 3GJNA 4IPYA 3NTEA 4BPHA 3CCRP 2GDYA 2KGEA 3EJBA 1AYIA 1UJZA 1KD1Q 2PEMA 1BXIA 2MR8A 1S72P 4CA3A 1VQLP 3I55P 2PY8A 2GZEA 2FHSC 1A43A 3B4QA 3CCVP 2MVUA 5EW5E 1VQOP 2BHVA 1Q86Q 5JPAA 2FVFA 1EIAA 1E6JP 1VQPP 4PWVB 4COPA 1RNIA 2JB0A 3B5IA 2LMLA 2K0DX 4UHPB 2JAZA 2VLOA 2M8PA 2N5HA 3HZQA 2LTEA 2MF4A 4XRQA 4U0DA 5HVCA 3EJEA 1D1DA 3G21A 3LRYA 2QNWA 1GPJA 2LKIA 3G0VA 2K92A 4M0IA 4QNBA 1VQ8P 3WBHA 2XZ1C 1VQMP 2EFJA 3MGEA 1KLPA 1EOQA 4BPGA 2MY5A 3GKLC 3DPHA 3OW2O 5HGNA 3EJDA 1F80D 3G4SP 2LIUA 3DS4A 2JGPA 5KP7B 5I4TG 2K94A 2KW2A 4PXHB 2ONTA 2E1MA 2MVVA 2L4BA 3E2DA 2Z46A 1N8RQ 2Z45A 4XFXA 4MRTC 2KWLA 3GZLA 2FADA 1FR2A 3CCJP 2Z44A 2L9FA 4U0CA 3CCSP 1Z6MA 5KP6B 1ZMBA 1Q81Q 3CC4P 2XV6A 2KG9A 1VHNA 2GZJA 1K8AQ 2N6ZA 2QA4P 7CEIA 2N98A 5HV8A 1VQ4P 2X2BA 1K9MQ 3H4EA 2WPTA 4U0EA 1K73Q 1GXHA 4XFYA 3RG2A 2KGAA 2L22A 2AFEA 2PEJA 2OARA 4PH1A 2MR7A 1CEIA 1VQ5P 2JYGA 2KG6A 1NJIQ 1VQ9P 4H2WC
chains in the Genus database with same CATH topology
1DV5A 2XZ1C 4NEOA 2LL8A 1KLPA 2ROQA 2CGQA 4BPGA 2KGCA 2MY5A 3LMOA 2K0YA 1OR5A 4IZ6A 4H2YC 3EJDA 1X3OA 3GZMA 1F80D 2KGDA 1L0IA 4R0MA 2LIUA 2AFDA 4BPHA 2JGPA 5KP8B 2KG8A 5KP7B 2K94A 2KW2A 4PXHB 2GDYA 1VKUA 2KGEA 2MVVA 1NQ4A 2AF8A 2L4BA 3EJBA 1HY8A 2VSQA 2KOQA 3CE7A 4MRTC 2KWLA 3GZLA 2CNRA 2FADA 2K2QA 2JU1A 2MR8A 1HQBA 4CA3A 5CZDB 2FACA 2KR5A 2L9FA 2KOOA 2KORA 2N5IA 2FHSC 2XZ0D 2L0QA 5KP6B 2LIWA 2MVUA 2PNGA 2M5RA 2JQ4A 2EHTA 2AVAA 2FVFA 2JU2A 2FAEA 2FVAA 2DNWA 4H2XC 2KG9A 2CQ8A 4PWVB 4HKGA 4DG9A 2KOPA 2CG5B 2FQ1A 3NY7B 2LPKA 1T8KA 2LMLA 2KOSA 2N6ZA 1DNYA 2FQ0A 2EHSA 2K93A 2N6YA 2N98A 5HV8A 2X2BA 2N5HA 2LTEA 2MF4A 2K0XA 3RG2A 2KGAA 2FQ2A 5HVCA 3EJEA 2L22A 2MD9A 1ACPA 2AFEA 1L0HA 2FVEA 2MR7A 2QNWA 2LKIA 2GDWA 5EJDA 2GDXA 4BPFA 2N50A 2KG6A 1AF8A 2LOLA 2K92A 4H2WC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DV5 A;  2XZ1 C;  4NEO A;  2LL8 A;  1KLP A;  2ROQ A;  2CGQ A;  4BPG A;  2KGC A;  2MY5 A;  3LMO A;  2K0Y A;  1OR5 A;  4IZ6 A;  4H2Y C;  3EJD A;  1X3O A;  3GZM A;  1F80 D;  2KGD A;  1L0I A;  4R0M A;  2LIU A;  2AFD A;  4BPH A;  2JGP A;  5KP8 B;  2KG8 A;  5KP7 B;  2K94 A;  2KW2 A;  4PXH B;  2GDY A;  1VKU A;  2KGE A;  2MVV A;  1NQ4 A;  2AF8 A;  2L4B A;  3EJB A;  1HY8 A;  2VSQ A;  2KOQ A;  3CE7 A;  4MRT C;  2KWL A;  3GZL A;  2CNR A;  2FAD A;  2K2Q A;  2JU1 A;  2MR8 A;  1HQB A;  4CA3 A;  5CZD B;  2FAC A;  2KR5 A;  2L9F A;  2KOO A;  2KOR A;  2N5I A;  2FHS C;  2XZ0 D;  2L0Q A;  5KP6 B;  2LIW A;  2MVU A;  2PNG A;  2M5R A;  2JQ4 A;  2EHT A;  2AVA A;  2FVF A;  2JU2 A;  2FAE A;  2FVA A;  2DNW A;  4H2X C;  2KG9 A;  2CQ8 A;  4PWV B;  4HKG A;  4DG9 A;  2KOP A;  2CG5 B;  2FQ1 A;  3NY7 B;  2LPK A;  1T8K A;  2LML A;  2KOS A;  2N6Z A;  1DNY A;  2FQ0 A;  2EHS A;  2K93 A;  2N6Y A;  2N98 A;  5HV8 A;  2X2B A;  2N5H A;  2LTE A;  2MF4 A;  2K0X A;  3RG2 A;  2KGA A;  2FQ2 A;  5HVC A;  3EJE A;  2L22 A;  2MD9 A;  1ACP A;  2AFE A;  1L0H A;  2FVE A;  2MR7 A;  2QNW A;  2LKI A;  2GDW A;  5EJD A;  2GDX A;  4BPF A;  2N50 A;  2KG6 A;  1AF8 A;  2LOL A;  2K92 A;  4H2W C; 
#chains in the Genus database with same CATH topology
 3CC2 P;  2M8L A;  4NEO A;  1E0H A;  2ROQ A;  4GR6 A;  3CCM P;  1YJN P;  2K0Y A;  1OR5 A;  3CCU P;  4H2Y C;  1VQK P;  1IMQ A;  2EIA A;  1L0I A;  3G28 A;  2AFD A;  3H0D A;  3DS0 A;  2K5X A;  2BUO A;  5KP8 B;  1YIT P;  2KG8 A;  1VKU A;  2NO8 A;  2AF8 A;  1HY8 A;  2VSQ A;  4WYM A;  1M1K Q;  2CNR A;  2VLP A;  5BS1 A;  2JU1 A;  1AUM A;  1GXG A;  1UNK A;  5CZD B;  2KR5 A;  2KOR A;  2N5I A;  2CWO A;  2XZ0 D;  3CC7 P;  1QVF O;  1A8O A;  2L0Q A;  3CXC O;  2LIW A;  2PNG A;  2JO0 A;  2M5R A;  2EHT A;  1RO2 A;  2FAE A;  2FVA A;  2JYL A;  4H2X C;  2CQ8 A;  1JJ2 O;  1RO0 A;  4HKG A;  5HGO A;  2PEK A;  5HGL A;  2PEO A;  2FQ1 A;  1T8K A;  3CMA P;  4XRO A;  1M74 A;  1YJ9 P;  2GZF A;  2EHS A;  1M90 Q;  4GR2 A;  3I56 P;  1KQS O;  2PEI A;  3G6E P;  2VLQ A;  3P05 A;  3CCL P;  2OTJ P;  2MD9 A;  1YHQ P;  3G1I A;  5EJD A;  2GDX A;  2N50 A;  2GZG A;  2PEN A;  4XFZ A;  2LOL A;  3CPW O;  4QKO A;  5F2O A;  1Q82 Q;  2CGQ A;  1KC8 Q;  1VQ7 P;  3G29 A;  2KGC A;  1MZ8 A;  4U0B A;  5DCK A;  2VLN A;  4IZ6 A;  4U0A A;  3GZM A;  1YJW P;  2PEQ A;  2KGD A;  4R0M A;  2P9X A;  3CCE P;  1IMP A;  1NQ4 A;  2KOQ A;  3CE7 A;  1M6E X;  2K2Q A;  1HQB A;  3H47 A;  4U0F A;  2FAC A;  2KOO A;  1YI2 P;  2ERH A;  5BS2 A;  3DTJ A;  1IUQ A;  2JQ4 A;  2OTL P;  2LF4 A;  2AVA A;  2JU2 A;  2KOD A;  2DNW A;  1M6N A;  2L6E A;  1EMV A;  2XXM A;  4DG9 A;  5HGM A;  2KOP A;  2CG5 B;  2XT1 A;  3NY7 B;  2EG5 A;  2LPK A;  1YIJ P;  2KOS A;  1DNY A;  3DS1 A;  2FQ0 A;  2GZI A;  3CME P;  2K93 A;  2N6Y A;  3DS2 A;  3DS5 A;  2GYK A;  3DS3 A;  3RG6 C;  1QVG O;  2JBG A;  2K0X A;  3HYB A;  3M1M A;  2FQ2 A;  1VQN P;  3U43 A;  2M8N A;  1ACP A;  1QRJ A;  4F37 A;  1L0H A;  3Q20 A;  2FVE A;  3G26 A;  1Q7Y Q;  2GDW A;  4BPF A;  5F2K A;  4COC A;  2DGY A;  4PH0 A;  3VRL C;  1AF8 A;  3G71 P;  2QEX P;  1W2B O;  5F2N A;  1DV5 A;  1K30 A;  1BAJ A;  1VQ6 P;  3CD6 P;  2LL8 A;  1ZNV A;  3CCQ P;  3G1G A;  3LMO A;  1X3O A;  3GJN A;  4IPY A;  3NTE A;  4BPH A;  3CCR P;  2GDY A;  2KGE A;  3EJB A;  1AYI A;  1UJZ A;  1KD1 Q;  2PEM A;  1BXI A;  2MR8 A;  1S72 P;  4CA3 A;  1VQL P;  3I55 P;  2PY8 A;  2GZE A;  2FHS C;  1A43 A;  3B4Q A;  3CCV P;  2MVU A;  5EW5 E;  1VQO P;  2BHV A;  1Q86 Q;  5JPA A;  2FVF A;  1EIA A;  1E6J P;  1VQP P;  4PWV B;  4COP A;  1RNI A;  2JB0 A;  3B5I A;  2LML A;  2K0D X;  4UHP B;  2JAZ A;  2VLO A;  2M8P A;  2N5H A;  3HZQ A;  2LTE A;  2MF4 A;  4XRQ A;  4U0D A;  5HVC A;  3EJE A;  1D1D A;  3G21 A;  3LRY A;  2QNW A;  1GPJ A;  2LKI A;  3G0V A;  2K92 A;  4M0I A;  4QNB A;  1VQ8 P;  3WBH A;  2XZ1 C;  1VQM P;  2EFJ A;  3MGE A;  1KLP A;  1EOQ A;  4BPG A;  2MY5 A;  3GKL C;  3DPH A;  3OW2 O;  5HGN A;  3EJD A;  1F80 D;  3G4S P;  2LIU A;  3DS4 A;  2JGP A;  5KP7 B;  5I4T G;  2K94 A;  2KW2 A;  4PXH B;  2ONT A;  2E1M A;  2MVV A;  2L4B A;  3E2D A;  2Z46 A;  1N8R Q;  2Z45 A;  4XFX A;  4MRT C;  2KWL A;  3GZL A;  2FAD A;  1FR2 A;  3CCJ P;  2Z44 A;  2L9F A;  4U0C A;  3CCS P;  1Z6M A;  5KP6 B;  1ZMB A;  1Q81 Q;  3CC4 P;  2XV6 A;  2KG9 A;  1VHN A;  2GZJ A;  1K8A Q;  2N6Z A;  2QA4 P;  7CEI A;  2N98 A;  5HV8 A;  1VQ4 P;  2X2B A;  1K9M Q;  3H4E A;  2WPT A;  4U0E A;  1K73 Q;  1GXH A;  4XFY A;  3RG2 A;  2KGA A;  2L22 A;  2AFE A;  2PEJ A;  2OAR A;  4PH1 A;  2MR7 A;  1CEI A;  1VQ5 P;  2JYG A;  2KG6 A;  1NJI Q;  1VQ9 P;  4H2W C; 
#chains in the Genus database with same CATH homology
 1DV5 A;  2XZ1 C;  4NEO A;  2LL8 A;  1KLP A;  2ROQ A;  2CGQ A;  4BPG A;  2KGC A;  2MY5 A;  3LMO A;  2K0Y A;  1OR5 A;  4IZ6 A;  4H2Y C;  3EJD A;  1X3O A;  3GZM A;  1F80 D;  2KGD A;  1L0I A;  4R0M A;  2LIU A;  2AFD A;  4BPH A;  2JGP A;  5KP8 B;  2KG8 A;  5KP7 B;  2K94 A;  2KW2 A;  4PXH B;  2GDY A;  1VKU A;  2KGE A;  2MVV A;  1NQ4 A;  2AF8 A;  2L4B A;  3EJB A;  1HY8 A;  2VSQ A;  2KOQ A;  3CE7 A;  4MRT C;  2KWL A;  3GZL A;  2CNR A;  2FAD A;  2K2Q A;  2JU1 A;  2MR8 A;  1HQB A;  4CA3 A;  5CZD B;  2FAC A;  2KR5 A;  2L9F A;  2KOO A;  2KOR A;  2N5I A;  2FHS C;  2XZ0 D;  2L0Q A;  5KP6 B;  2LIW A;  2MVU A;  2PNG A;  2M5R A;  2JQ4 A;  2EHT A;  2AVA A;  2FVF A;  2JU2 A;  2FAE A;  2FVA A;  2DNW A;  4H2X C;  2KG9 A;  2CQ8 A;  4PWV B;  4HKG A;  4DG9 A;  2KOP A;  2CG5 B;  2FQ1 A;  3NY7 B;  2LPK A;  1T8K A;  2LML A;  2KOS A;  2N6Z A;  1DNY A;  2FQ0 A;  2EHS A;  2K93 A;  2N6Y A;  2N98 A;  5HV8 A;  2X2B A;  2N5H A;  2LTE A;  2MF4 A;  2K0X A;  3RG2 A;  2KGA A;  2FQ2 A;  5HVC A;  3EJE A;  2L22 A;  2MD9 A;  1ACP A;  2AFE A;  1L0H A;  2FVE A;  2MR7 A;  2QNW A;  2LKI A;  2GDW A;  5EJD A;  2GDX A;  4BPF A;  2N50 A;  2KG6 A;  1AF8 A;  2LOL A;  2K92 A;  4H2W C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...