1EOQA

Rous sarcoma virus capsid protein: c-terminal domain
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
77
structure length
77
Chain Sequence
MDIMQGPSESFVDFANRLIKAVEGSDLPPSARAPVIIDCFRQKSQPDIQQLIRTAPSTLTTPGEIIKYVLDRQKTAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GAG POLYPROTEIN CAPSID PROTEIN P27
publication title Structure and self-association of the Rous sarcoma virus capsid protein.
pubmed doi rcsb
source organism Rous sarcoma virus - prague c
molecule tags Viral protein
total genus 19
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2000-03-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1eoqA00
4XFZA 3VRLC 3G21A 2JO0A 2KODA 3DS5A 1A43A 3G0VA 3DTJA 4COCA 5I4TG 2L6EA 2LF4A 2M8PA 2XXMA 4WYMA 4QNBA 2XT1A 4U0DA 3G1IA 2ONTA 5HGLA 4U0EA 1BAJA 2JYGA 1E6JP 2EIAA 3MGEA 4U0CA 4XRQA 2M8LA 4COPA 2JYLA 3DS3A 3G28A 1QRJA 2BUOA 3P05A 4PH1A 4M0IA 3G29A 3H4EA 3G26A 4XFYA 1EOQA 4PH0A 3DPHA 3NTEA 5JPAA 1AUMA 5HGNA 1EIAA 3LRYA 2XV6A 4XFXA 5HGMA 4U0AA 1D1DA 3H47A 3DS2A 3DS1A 5DCKA 4U0FA 4XROA 3DS0A 3G1GA 4IPYA 4U0BA 1A8OA 2M8NA 3DS4A 5HGOA
chains in the Genus database with same CATH superfamily
2GDXA 3G21A 3DS5A 4U0DA 2FVEA 2GYKA 5EW5E 1BAJA 1UJZA 1VQKP 2BHVA 3P05A 2ERHA 2OTLP 2KORA 2EHTA 4GR6A 1RNIA 3CPWO 3G1GA 1M6EX 3LRYA 5HGOA 2N6ZA 3VRLC 2Z45A 5I4TG 1YIJP 4BPHA 1L0HA 2L0QA 5CZDB 1K9MQ 1E6JP 4DG9A 3I56P 2FQ2A 1YJWP 2Z46A 2EHSA 1YJ9P 2GZIA 2FHSC 2K92A 2GZFA 1VQ6P 1VQNP 2VLQA 2L6EA 3G1IA 1VQLP 3EJDA 4PWVB 1KC8Q 1VQ7P 1Q7YQ 2VLOA 1VKUA 2PEOA 1DNYA 1KLPA 1MZ8A 1Q86Q 2JU1A 2XV6A 2MD9A 3GZLA 5HGMA 5DCKA 4H2XC 4U0BA 1YITP 1W2BO 2MR7A 1VQ4P 3B4QA 2P9XA 2PEJA 3CC7P 1X3OA 2AVAA 2CQ8A 4H2YC 3CC2P 3CXCO 3RG2A 5HVCA 5KP7B 1VQ9P 3G0VA 1A43A 2K0DX 2K0YA 1YHQP 1YI2P 2JYGA 3E2DA 2FAEA 3M1MA 3CCUP 2NO8A 1AUMA 3CE7A 1EIAA 2MVVA 2KGCA 2JU2A 1CEIA 1VQOP 2PENA 2PEKA 2KODA 3DTJA 2EFJA 2LF4A 2JB0A 2XXMA 2CG5B 1T8KA 2K93A 5HGLA 3MGEA 1F80D 2DGYA 4GR2A 1QRJA 3G6EP 2JQ4A 2QA4P 4U0AA 1L0IA 3DS0A 4IPYA 3WBHA 2M8NA 1K73Q 1K30A 3OW2O 1KQSO 1AF8A 4U0EA 2L22A 2LKIA 3DS3A 3U43A 2N50A 3CCJP 1QVGO 4QKOA 4XFXA 5BS2A 3DS2A 4U0FA 2CGQA 2M5RA 3EJBA 2WPTA 2N98A 1M6NA 2K94A 1OR5A 2JBGA 3I55P 2XZ0D 1M74A 4IZ6A 2BUOA 3CCSP 2L9FA 2XZ1C 7CEIA 2LMLA 3GZMA 2K2QA 4UHPB 1Z6MA 1BXIA 4XFZA 1S72P 1GXGA 1KD1Q 2FACA 1M1KQ 2PEQA 2K0XA 3G28A 4PH1A 4HKGA 3G29A 3G26A 1K8AQ 1UNKA 5KP6B 2GZGA 1GPJA 2N5IA 1A8OA 2MR8A 2KWLA 2N5HA 1DV5A 1QVFO 3HYBA 2LOLA 2PEMA 1ZNVA 4BPGA 1IUQA 1HY8A 1EMVA 2EIAA 1RO2A 2JGPA 3H4EA 2CNRA 4XFYA 3CCQP 4PH0A 4H2WC 5BS1A 2GZJA 5HGNA 2FADA 2KR5A 3CCVP 1N8RQ 2KOOA 2MF4A 2QEXP 3H0DA 3CD6P 4F37A 1JJ2O 2LIUA 5F2NA 3CCLP 4COPA 3CCMP 4BPFA 3G71P 4M0IA 4NEOA 3HZQA 2AFDA 1D1DA 1VQMP 2K5XA 1ACPA 2N6YA 1NQ4A 2OTJP 4QNBA 3GJNA 1M90Q 2Z44A 2KGAA 2ROQA 3EJEA 1VQ5P 3CC4P 2KG9A 2L4BA 2X2BA 1GXHA 5F2OA 3H47A 2AFEA 4XROA 1HQBA 2GDWA 2AF8A 2JAZA 1VQ8P 4R0MA 1AYIA 3B5IA 2PY8A 2EG5A 1VQPP 2M8LA 4MRTC 2FVAA 1NJIQ 5JPAA 5HV8A 3DS1A 1IMQA 1RO0A 2KOQA 2KGDA 3GKLC 2JO0A 4COCA 2E1MA 2CWOA 1Q82Q 2PNGA 2KOPA 4WYMA 2KG6A 1VHNA 3DPHA 2MVUA 3NTEA 2LL8A 3RG6C 2FQ0A 3CCEP 2FVFA 1Q81Q 5EJDA 2KG8A 2LTEA 3CMAP 2M8PA 1ZMBA 5KP8B 3CMEP 3Q20A 2XT1A 2VSQA 2KGEA 2ONTA 2OARA 4CA3A 2MY5A 4XRQA 1IMPA 4U0CA 2JYLA 2DNWA 2QNWA 3NY7B 2GDYA 2LPKA 1E0HA 3DS4A 5F2KA 2PEIA 4PXHB 3G4SP 2LIWA 1YJNP 1FR2A 3LMOA 3CCRP 2KW2A 2GZEA 2KOSA 1EOQA 2FQ1A 2VLPA 2VLNA
chains in the Genus database with same CATH topology
1VQ8P 1VQ9P 4XFZA 1S72P 3G21A 3DS5A 1A43A 3G0VA 1KD1Q 1YHQP 3B5IA 1M1KQ 2PEQA 2PY8A 4U0DA 2EG5A 1YI2P 1BAJA 2JYGA 1VQPP 3E2DA 2M8LA 3G28A 1VQKP 2BHVA 3M1MA 3P05A 4PH1A 3G29A 3CCUP 3G26A 1K8AQ 2OTLP 1NJIQ 5JPAA 1AUMA 1EIAA 4GR6A 1RNIA 3CPWO 3DS1A 1RO0A 3G1GA 1A8OA 1VQOP 2PENA 3LRYA 1M6EX 5HGOA 3VRLC 2PEKA 2JO0A 2KODA 1QVFO 3HYBA 2Z45A 3DTJA 2PEMA 2E1MA 2EFJA 4COCA 5I4TG 2CWOA 1IUQA 2LF4A 1YIJP 1Q82Q 2XXMA 4WYMA 5HGLA 1K9MQ 1E6JP 2EIAA 3MGEA 1RO2A 3I56P 2DGYA 4GR2A 1QRJA 3H4EA 1YJWP 2Z46A 3G6EP 4XFYA 4PH0A 3CCQP 3DPHA 3NTEA 5BS1A 5HGNA 2QA4P 3RG6C 4U0AA 3CCEP 1YJ9P 3DS0A 4IPYA 3WBHA 2M8NA 3CCVP 1N8RQ 1K73Q 1VQ6P 2QEXP 1Q81Q 3CMAP 1VQNP 3H0DA 2L6EA 3CD6P 2M8PA 1ZMBA 1JJ2O 3CMEP 1K30A 3Q20A 5F2NA 2XT1A 3G1IA 1VQLP 2ONTA 2OARA 3OW2O 1KQSO 4U0EA 3CCLP 4XRQA 4COPA 4U0CA 2JYLA 3DS3A 3CCMP 3G71P 1KC8Q 4M0IA 1VQ7P 1Q7YQ 3CCJP 2PEOA 3HZQA 1QVGO 1Q86Q 2XV6A 4XFXA 5HGMA 1D1DA 1VQMP 5BS2A 3DS2A 5DCKA 4U0FA 4U0BA 1YITP 3DS4A 5F2KA 1W2BO 2PEIA 3G4SP 1YJNP 1VQ4P 2P9XA 2PEJA 3CCRP 2OTJP 4QNBA 3CC7P 1M6NA 3I55P 1M90Q 1M74A 2Z44A 2BUOA 3CC2P 3CCSP 1VQ5P 3CC4P 3CXCO 1EOQA 5F2OA 3H47A 4XROA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XFZ A;  3VRL C;  3G21 A;  2JO0 A;  2KOD A;  3DS5 A;  1A43 A;  3G0V A;  3DTJ A;  4COC A;  5I4T G;  2L6E A;  2LF4 A;  2M8P A;  2XXM A;  4WYM A;  4QNB A;  2XT1 A;  4U0D A;  3G1I A;  2ONT A;  5HGL A;  4U0E A;  1BAJ A;  2JYG A;  1E6J P;  2EIA A;  3MGE A;  4U0C A;  4XRQ A;  2M8L A;  4COP A;  2JYL A;  3DS3 A;  3G28 A;  1QRJ A;  2BUO A;  3P05 A;  4PH1 A;  4M0I A;  3G29 A;  3H4E A;  3G26 A;  4XFY A;  1EOQ A;  4PH0 A;  3DPH A;  3NTE A;  5JPA A;  1AUM A;  5HGN A;  1EIA A;  3LRY A;  2XV6 A;  4XFX A;  5HGM A;  4U0A A;  1D1D A;  3H47 A;  3DS2 A;  3DS1 A;  5DCK A;  4U0F A;  4XRO A;  3DS0 A;  3G1G A;  4IPY A;  4U0B A;  1A8O A;  2M8N A;  3DS4 A;  5HGO A; 
#chains in the Genus database with same CATH topology
 2GDX A;  3G21 A;  3DS5 A;  4U0D A;  2FVE A;  2GYK A;  5EW5 E;  1BAJ A;  1UJZ A;  1VQK P;  2BHV A;  3P05 A;  2ERH A;  2OTL P;  2KOR A;  2EHT A;  4GR6 A;  1RNI A;  3CPW O;  3G1G A;  1M6E X;  3LRY A;  5HGO A;  2N6Z A;  3VRL C;  2Z45 A;  5I4T G;  1YIJ P;  4BPH A;  1L0H A;  2L0Q A;  5CZD B;  1K9M Q;  1E6J P;  4DG9 A;  3I56 P;  2FQ2 A;  1YJW P;  2Z46 A;  2EHS A;  1YJ9 P;  2GZI A;  2FHS C;  2K92 A;  2GZF A;  1VQ6 P;  1VQN P;  2VLQ A;  2L6E A;  3G1I A;  1VQL P;  3EJD A;  4PWV B;  1KC8 Q;  1VQ7 P;  1Q7Y Q;  2VLO A;  1VKU A;  2PEO A;  1DNY A;  1KLP A;  1MZ8 A;  1Q86 Q;  2JU1 A;  2XV6 A;  2MD9 A;  3GZL A;  5HGM A;  5DCK A;  4H2X C;  4U0B A;  1YIT P;  1W2B O;  2MR7 A;  1VQ4 P;  3B4Q A;  2P9X A;  2PEJ A;  3CC7 P;  1X3O A;  2AVA A;  2CQ8 A;  4H2Y C;  3CC2 P;  3CXC O;  3RG2 A;  5HVC A;  5KP7 B;  1VQ9 P;  3G0V A;  1A43 A;  2K0D X;  2K0Y A;  1YHQ P;  1YI2 P;  2JYG A;  3E2D A;  2FAE A;  3M1M A;  3CCU P;  2NO8 A;  1AUM A;  3CE7 A;  1EIA A;  2MVV A;  2KGC A;  2JU2 A;  1CEI A;  1VQO P;  2PEN A;  2PEK A;  2KOD A;  3DTJ A;  2EFJ A;  2LF4 A;  2JB0 A;  2XXM A;  2CG5 B;  1T8K A;  2K93 A;  5HGL A;  3MGE A;  1F80 D;  2DGY A;  4GR2 A;  1QRJ A;  3G6E P;  2JQ4 A;  2QA4 P;  4U0A A;  1L0I A;  3DS0 A;  4IPY A;  3WBH A;  2M8N A;  1K73 Q;  1K30 A;  3OW2 O;  1KQS O;  1AF8 A;  4U0E A;  2L22 A;  2LKI A;  3DS3 A;  3U43 A;  2N50 A;  3CCJ P;  1QVG O;  4QKO A;  4XFX A;  5BS2 A;  3DS2 A;  4U0F A;  2CGQ A;  2M5R A;  3EJB A;  2WPT A;  2N98 A;  1M6N A;  2K94 A;  1OR5 A;  2JBG A;  3I55 P;  2XZ0 D;  1M74 A;  4IZ6 A;  2BUO A;  3CCS P;  2L9F A;  2XZ1 C;  7CEI A;  2LML A;  3GZM A;  2K2Q A;  4UHP B;  1Z6M A;  1BXI A;  4XFZ A;  1S72 P;  1GXG A;  1KD1 Q;  2FAC A;  1M1K Q;  2PEQ A;  2K0X A;  3G28 A;  4PH1 A;  4HKG A;  3G29 A;  3G26 A;  1K8A Q;  1UNK A;  5KP6 B;  2GZG A;  1GPJ A;  2N5I A;  1A8O A;  2MR8 A;  2KWL A;  2N5H A;  1DV5 A;  1QVF O;  3HYB A;  2LOL A;  2PEM A;  1ZNV A;  4BPG A;  1IUQ A;  1HY8 A;  1EMV A;  2EIA A;  1RO2 A;  2JGP A;  3H4E A;  2CNR A;  4XFY A;  3CCQ P;  4PH0 A;  4H2W C;  5BS1 A;  2GZJ A;  5HGN A;  2FAD A;  2KR5 A;  3CCV P;  1N8R Q;  2KOO A;  2MF4 A;  2QEX P;  3H0D A;  3CD6 P;  4F37 A;  1JJ2 O;  2LIU A;  5F2N A;  3CCL P;  4COP A;  3CCM P;  4BPF A;  3G71 P;  4M0I A;  4NEO A;  3HZQ A;  2AFD A;  1D1D A;  1VQM P;  2K5X A;  1ACP A;  2N6Y A;  1NQ4 A;  2OTJ P;  4QNB A;  3GJN A;  1M90 Q;  2Z44 A;  2KGA A;  2ROQ A;  3EJE A;  1VQ5 P;  3CC4 P;  2KG9 A;  2L4B A;  2X2B A;  1GXH A;  5F2O A;  3H47 A;  2AFE A;  4XRO A;  1HQB A;  2GDW A;  2AF8 A;  2JAZ A;  1VQ8 P;  4R0M A;  1AYI A;  3B5I A;  2PY8 A;  2EG5 A;  1VQP P;  2M8L A;  4MRT C;  2FVA A;  1NJI Q;  5JPA A;  5HV8 A;  3DS1 A;  1IMQ A;  1RO0 A;  2KOQ A;  2KGD A;  3GKL C;  2JO0 A;  4COC A;  2E1M A;  2CWO A;  1Q82 Q;  2PNG A;  2KOP A;  4WYM A;  2KG6 A;  1VHN A;  3DPH A;  2MVU A;  3NTE A;  2LL8 A;  3RG6 C;  2FQ0 A;  3CCE P;  2FVF A;  1Q81 Q;  5EJD A;  2KG8 A;  2LTE A;  3CMA P;  2M8P A;  1ZMB A;  5KP8 B;  3CME P;  3Q20 A;  2XT1 A;  2VSQ A;  2KGE A;  2ONT A;  2OAR A;  4CA3 A;  2MY5 A;  4XRQ A;  1IMP A;  4U0C A;  2JYL A;  2DNW A;  2QNW A;  3NY7 B;  2GDY A;  2LPK A;  1E0H A;  3DS4 A;  5F2K A;  2PEI A;  4PXH B;  3G4S P;  2LIW A;  1YJN P;  1FR2 A;  3LMO A;  3CCR P;  2KW2 A;  2GZE A;  2KOS A;  1EOQ A;  2FQ1 A;  2VLP A;  2VLN A; 
#chains in the Genus database with same CATH homology
 1VQ8 P;  1VQ9 P;  4XFZ A;  1S72 P;  3G21 A;  3DS5 A;  1A43 A;  3G0V A;  1KD1 Q;  1YHQ P;  3B5I A;  1M1K Q;  2PEQ A;  2PY8 A;  4U0D A;  2EG5 A;  1YI2 P;  1BAJ A;  2JYG A;  1VQP P;  3E2D A;  2M8L A;  3G28 A;  1VQK P;  2BHV A;  3M1M A;  3P05 A;  4PH1 A;  3G29 A;  3CCU P;  3G26 A;  1K8A Q;  2OTL P;  1NJI Q;  5JPA A;  1AUM A;  1EIA A;  4GR6 A;  1RNI A;  3CPW O;  3DS1 A;  1RO0 A;  3G1G A;  1A8O A;  1VQO P;  2PEN A;  3LRY A;  1M6E X;  5HGO A;  3VRL C;  2PEK A;  2JO0 A;  2KOD A;  1QVF O;  3HYB A;  2Z45 A;  3DTJ A;  2PEM A;  2E1M A;  2EFJ A;  4COC A;  5I4T G;  2CWO A;  1IUQ A;  2LF4 A;  1YIJ P;  1Q82 Q;  2XXM A;  4WYM A;  5HGL A;  1K9M Q;  1E6J P;  2EIA A;  3MGE A;  1RO2 A;  3I56 P;  2DGY A;  4GR2 A;  1QRJ A;  3H4E A;  1YJW P;  2Z46 A;  3G6E P;  4XFY A;  4PH0 A;  3CCQ P;  3DPH A;  3NTE A;  5BS1 A;  5HGN A;  2QA4 P;  3RG6 C;  4U0A A;  3CCE P;  1YJ9 P;  3DS0 A;  4IPY A;  3WBH A;  2M8N A;  3CCV P;  1N8R Q;  1K73 Q;  1VQ6 P;  2QEX P;  1Q81 Q;  3CMA P;  1VQN P;  3H0D A;  2L6E A;  3CD6 P;  2M8P A;  1ZMB A;  1JJ2 O;  3CME P;  1K30 A;  3Q20 A;  5F2N A;  2XT1 A;  3G1I A;  1VQL P;  2ONT A;  2OAR A;  3OW2 O;  1KQS O;  4U0E A;  3CCL P;  4XRQ A;  4COP A;  4U0C A;  2JYL A;  3DS3 A;  3CCM P;  3G71 P;  1KC8 Q;  4M0I A;  1VQ7 P;  1Q7Y Q;  3CCJ P;  2PEO A;  3HZQ A;  1QVG O;  1Q86 Q;  2XV6 A;  4XFX A;  5HGM A;  1D1D A;  1VQM P;  5BS2 A;  3DS2 A;  5DCK A;  4U0F A;  4U0B A;  1YIT P;  3DS4 A;  5F2K A;  1W2B O;  2PEI A;  3G4S P;  1YJN P;  1VQ4 P;  2P9X A;  2PEJ A;  3CCR P;  2OTJ P;  4QNB A;  3CC7 P;  1M6N A;  3I55 P;  1M90 Q;  1M74 A;  2Z44 A;  2BUO A;  3CC2 P;  3CCS P;  1VQ5 P;  3CC4 P;  3CXC O;  1EOQ A;  5F2O A;  3H47 A;  4XRO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...