1EOQA

Rous sarcoma virus capsid protein: c-terminal domain
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
77
structure length
77
Chain Sequence
MDIMQGPSESFVDFANRLIKAVEGSDLPPSARAPVIIDCFRQKSQPDIQQLIRTAPSTLTTPGEIIKYVLDRQKTAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein
molecule keywords GAG POLYPROTEIN CAPSID PROTEIN P27
publication title Structure and self-association of the Rous sarcoma virus capsid protein.
pubmed doi rcsb
source organism Rous sarcoma virus - prague c
total genus 19
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2000-03-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1eoqA00
3DS2A 4XFYA 1BAJA 2BUOA 5HGNA 5I4TG 4XFZA 3G26A 4XRQA 2M8PA 1A8OA 2EIAA 4WYMA 4COPA 3DS3A 3NTEA 3G1GA 3G29A 4XROA 3DS5A 5HGLA 5HGMA 4COCA 1E6JP 2LF4A 4U0CA 3LRYA 2M8LA 1EIAA 4M0IA 3DS4A 3H47A 4PH1A 2L6EA 4U0AA 2ONTA 4U0BA 5JPAA 3P05A 3MGEA 4PH0A 2KODA 2XT1A 3DS0A 5HGOA 2JO0A 1A43A 1QRJA 2XV6A 2XXMA 3DPHA 3DS1A 3G0VA 1AUMA 2JYGA 3G28A 3H4EA 1EOQA 1D1DA 3G21A 4QNBA 2M8NA 4U0DA 4XFXA 3G1IA 4U0FA 3VRLC 3DTJA 4IPYA 2JYLA 4U0EA 5DCKA
chains in the Genus database with same CATH superfamily
1QVGO 3HZQA 5EJDA 2FVAA 4BPGA 5HGMA 5KP7B 1M74A 2PENA 4M0IA 3CC7P 2K93A 3RG2A 2CNRA 3NY7B 1QVFO 2N98A 1VQ4P 1AUMA 4QKOA 2N5HA 3H0DA 1GPJA 2MD9A 1L0HA 1CEIA 2GZEA 2Z44A 2BUOA 3EJDA 3G29A 5F2OA 3OW2O 3GJNA 1YJ9P 1K30A 1Q82Q 2LTEA 2N5IA 1AYIA 2M8NA 4IPYA 4NEOA 2LIWA 2L4BA 2KG8A 2NO8A 1HY8A 1YIJP 1VQMP 3LMOA 3CD6P 2FAEA 5F2KA 2MVUA 4CA3A 2KG9A 2GZJA 2JO0A 4XFZA 3EJEA 5BS1A 2P9XA 2GZGA 2X2BA 2KGDA 2GYKA 1Z6MA 1X3OA 4U0AA 5JPAA 3G6EP 1IMPA 2MVVA 1T8KA 4PH0A 3G71P 1VQOP 2LOLA 2JAZA 3H4EA 3CCSP 2EHTA 2AFEA 2KORA 1N8RQ 2FVEA 2PEOA 2CQ8A 1KD1Q 3DS3A 4XROA 1NJIQ 3LRYA 1VQ9P 2MR8A 1A43A 2FQ2A 1EOQA 1D1DA 3B5IA 5HV8A 2KG6A 3WBHA 1VHNA 1E0HA 2VLPA 1UJZA 3CCEP 2FVFA 4F37A 2CGQA 1Q86Q 4MRTC 4U0CA 4R0MA 1W2BO 3CCLP 3GZMA 3U43A 4UHPB 2LKIA 1EMVA 2PEQA 4HKGA 2JU2A 2M5RA 2L22A 3DPHA 3G0VA 2LPKA 5CZDB 2K2QA 2ROQA 3VRLC 2AVAA 2JYLA 3GKLC 1KC8Q 1K9MQ 2CG5B 3G1GA 2GDWA 4U0BA 1IUQA 2FACA 3CCUP 3CC4P 1Q7YQ 3G1IA 4U0FA 4U0EA 3DS2A 1VQLP 4GR2A 5HGNA 3CCJP 4XRQA 4WYMA 2EIAA 1VQPP 1DV5A 1GXHA 2L0QA 1S72P 1K73Q 1OR5A 3CXCO 2ONTA 2VSQA 2FHSC 2ERHA 4H2YC 3CCQP 1NQ4A 3I56P 2MY5A 4H2WC 2BHVA 1KLPA 2PNGA 2PEKA 2VLOA 5HGLA 1VQNP 1EIAA 3DS4A 2GDYA 3P05A 2Z45A 2KOOA 2JB0A 4GR6A 3GZLA 1YJWP 1K8AQ 3CPWO 1FR2A 1BAJA 2PY8A 2CWOA 1RO2A 2JQ4A 2KOQA 1M6EX 1BXIA 2FADA 2KGEA 2EG5A 2MF4A 1ZNVA 1VQ7P 4PWVB 2QA4P 2K94A 1RO0A 2PEMA 3CC2P 3E2DA 2XZ1C 4DG9A 2K0YA 3RG6C 5DCKA 1IMQA 5I4TG 4IZ6A 3NTEA 7CEIA 2QEXP 2FQ1A 3DS5A 1ACPA 2MR7A 2EHSA 2L6EA 1Q81Q 2GZIA 1VQKP 5HGOA 1VKUA 4QNBA 1JJ2O 1DNYA 2N6ZA 1AF8A 3B4QA 1A8OA 1VQ6P 4COCA 1E6JP 2LF4A 2GDXA 3EJBA 1L0IA 3DS1A 2WPTA 3G28A 3G4SP 2KR5A 4U0DA 2KGAA 1M1KQ 3DTJA 1RNIA 2E1MA 2OTLP 3G26A 2KOPA 2M8PA 2KOSA 3HYBA 1YI2P 1VQ5P 2FQ0A 2K92A 3CCRP 3H47A 3CCMP 5EW5E 3CMAP 4PXHB 2XXMA 4BPFA 2DNWA 2JYGA 2VLNA 2K0DX 4XFXA 2L9FA 5KP6B 4XFYA 2OTJP 2VLQA 1VQ8P 2M8LA 4PH1A 2PEIA 5HVCA 5F2NA 2K5XA 3CCVP 3DS0A 3Q20A 2KW2A 3G21A 2N6YA 2QNWA 2LIUA 2JGPA 3CE7A 1UNKA 2Z46A 3CMEP 1HQBA 1YJNP 1GXGA 2GZFA 5BS2A 2JU1A 2LL8A 1M6NA 2N50A 2AFDA 2LMLA 2AF8A 1YITP 1ZMBA 1QRJA 2KGCA 2XV6A 1YHQP 1M90Q 2JBGA 2DGYA 2PEJA 5KP8B 3I55P 2XZ0D 4COPA 1KQSO 1F80D 4H2XC 1MZ8A 2KODA 2EFJA 2XT1A 2K0XA 3MGEA 3M1MA 2OARA 2KWLA 4BPHA
chains in the Genus database with same CATH topology
1QVGO 1RNIA 3HZQA 2E1MA 2OTLP 3G26A 1KD1Q 2M8PA 2PEKA 3HYBA 3DS3A 1YI2P 4XROA 5HGLA 5HGMA 1VQ5P 1NJIQ 1M74A 3LRYA 1VQNP 1VQ9P 1EIAA 2PENA 3DS4A 3H47A 4M0IA 3CCRP 3CCMP 3CC7P 3P05A 2Z45A 3CMAP 1QVFO 4GR6A 1YJWP 1VQ4P 1A43A 2XXMA 1AUMA 2JYGA 1EOQA 1D1DA 3B5IA 3H0DA 4XFXA 1K8AQ 3WBHA 3CPWO 2Z44A 4XFYA 3CCEP 1BAJA 2BUOA 2OTJP 2PY8A 2CWOA 1RO2A 1VQ8P 1M6EX 3G29A 5F2OA 1Q86Q 4U0CA 3CCLP 3OW2O 2M8LA 1W2BO 4PH1A 2EG5A 2PEIA 5F2NA 3CCVP 1VQ7P 1YJ9P 2QA4P 1K30A 2PEQA 3DS0A 3Q20A 1Q82Q 1RO0A 2PEMA 3DPHA 3G0VA 3CC2P 3E2DA 3G21A 2M8NA 3VRLC 4IPYA 2JYLA 3RG6C 5DCKA 1KC8Q 5I4TG 1K9MQ 2Z46A 3CMEP 1YJNP 3NTEA 3G1GA 2QEXP 3DS5A 1YIJP 5BS2A 1VQMP 3CD6P 1M6NA 4U0BA 2L6EA 1Q81Q 5F2KA 1IUQA 3CCUP 3CC4P 1Q7YQ 1YITP 1ZMBA 1VQKP 5HGOA 2JO0A 4XFZA 1QRJA 2XV6A 1YHQP 1M90Q 4QNBA 5BS1A 3G1IA 2DGYA 4U0FA 1JJ2O 2PEJA 4U0EA 3I55P 3DS2A 1VQLP 4GR2A 5HGNA 3CCJP 2P9XA 4XRQA 1A8OA 2EIAA 4WYMA 4COPA 1VQ6P 1KQSO 1VQPP 4COCA 1E6JP 2LF4A 1S72P 1K73Q 4U0AA 5JPAA 3CXCO 2ONTA 3G6EP 4PH0A 2KODA 2EFJA 2XT1A 3G71P 1VQOP 3CCQP 3MGEA 3H4EA 3DS1A 3CCSP 3G28A 3M1MA 3I56P 3G4SP 2OARA 4U0DA 1N8RQ 1M1KQ 3DTJA 2PEOA 2BHVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DS2 A;  4XFY A;  1BAJ A;  2BUO A;  5HGN A;  5I4T G;  4XFZ A;  3G26 A;  4XRQ A;  2M8P A;  1A8O A;  2EIA A;  4WYM A;  4COP A;  3DS3 A;  3NTE A;  3G1G A;  3G29 A;  4XRO A;  3DS5 A;  5HGL A;  5HGM A;  4COC A;  1E6J P;  2LF4 A;  4U0C A;  3LRY A;  2M8L A;  1EIA A;  4M0I A;  3DS4 A;  3H47 A;  4PH1 A;  2L6E A;  4U0A A;  2ONT A;  4U0B A;  5JPA A;  3P05 A;  3MGE A;  4PH0 A;  2KOD A;  2XT1 A;  3DS0 A;  5HGO A;  2JO0 A;  1A43 A;  1QRJ A;  2XV6 A;  2XXM A;  3DPH A;  3DS1 A;  3G0V A;  1AUM A;  2JYG A;  3G28 A;  3H4E A;  1EOQ A;  1D1D A;  3G21 A;  4QNB A;  2M8N A;  4U0D A;  4XFX A;  3G1I A;  4U0F A;  3VRL C;  3DTJ A;  4IPY A;  2JYL A;  4U0E A;  5DCK A; 
#chains in the Genus database with same CATH topology
 1QVG O;  3HZQ A;  5EJD A;  2FVA A;  4BPG A;  5HGM A;  5KP7 B;  1M74 A;  2PEN A;  4M0I A;  3CC7 P;  2K93 A;  3RG2 A;  2CNR A;  3NY7 B;  1QVF O;  2N98 A;  1VQ4 P;  1AUM A;  4QKO A;  2N5H A;  3H0D A;  1GPJ A;  2MD9 A;  1L0H A;  1CEI A;  2GZE A;  2Z44 A;  2BUO A;  3EJD A;  3G29 A;  5F2O A;  3OW2 O;  3GJN A;  1YJ9 P;  1K30 A;  1Q82 Q;  2LTE A;  2N5I A;  1AYI A;  2M8N A;  4IPY A;  4NEO A;  2LIW A;  2L4B A;  2KG8 A;  2NO8 A;  1HY8 A;  1YIJ P;  1VQM P;  3LMO A;  3CD6 P;  2FAE A;  5F2K A;  2MVU A;  4CA3 A;  2KG9 A;  2GZJ A;  2JO0 A;  4XFZ A;  3EJE A;  5BS1 A;  2P9X A;  2GZG A;  2X2B A;  2KGD A;  2GYK A;  1Z6M A;  1X3O A;  4U0A A;  5JPA A;  3G6E P;  1IMP A;  2MVV A;  1T8K A;  4PH0 A;  3G71 P;  1VQO P;  2LOL A;  2JAZ A;  3H4E A;  3CCS P;  2EHT A;  2AFE A;  2KOR A;  1N8R Q;  2FVE A;  2PEO A;  2CQ8 A;  1KD1 Q;  3DS3 A;  4XRO A;  1NJI Q;  3LRY A;  1VQ9 P;  2MR8 A;  1A43 A;  2FQ2 A;  1EOQ A;  1D1D A;  3B5I A;  5HV8 A;  2KG6 A;  3WBH A;  1VHN A;  1E0H A;  2VLP A;  1UJZ A;  3CCE P;  2FVF A;  4F37 A;  2CGQ A;  1Q86 Q;  4MRT C;  4U0C A;  4R0M A;  1W2B O;  3CCL P;  3GZM A;  3U43 A;  4UHP B;  2LKI A;  1EMV A;  2PEQ A;  4HKG A;  2JU2 A;  2M5R A;  2L22 A;  3DPH A;  3G0V A;  2LPK A;  5CZD B;  2K2Q A;  2ROQ A;  3VRL C;  2AVA A;  2JYL A;  3GKL C;  1KC8 Q;  1K9M Q;  2CG5 B;  3G1G A;  2GDW A;  4U0B A;  1IUQ A;  2FAC A;  3CCU P;  3CC4 P;  1Q7Y Q;  3G1I A;  4U0F A;  4U0E A;  3DS2 A;  1VQL P;  4GR2 A;  5HGN A;  3CCJ P;  4XRQ A;  4WYM A;  2EIA A;  1VQP P;  1DV5 A;  1GXH A;  2L0Q A;  1S72 P;  1K73 Q;  1OR5 A;  3CXC O;  2ONT A;  2VSQ A;  2FHS C;  2ERH A;  4H2Y C;  3CCQ P;  1NQ4 A;  3I56 P;  2MY5 A;  4H2W C;  2BHV A;  1KLP A;  2PNG A;  2PEK A;  2VLO A;  5HGL A;  1VQN P;  1EIA A;  3DS4 A;  2GDY A;  3P05 A;  2Z45 A;  2KOO A;  2JB0 A;  4GR6 A;  3GZL A;  1YJW P;  1K8A Q;  3CPW O;  1FR2 A;  1BAJ A;  2PY8 A;  2CWO A;  1RO2 A;  2JQ4 A;  2KOQ A;  1M6E X;  1BXI A;  2FAD A;  2KGE A;  2EG5 A;  2MF4 A;  1ZNV A;  1VQ7 P;  4PWV B;  2QA4 P;  2K94 A;  1RO0 A;  2PEM A;  3CC2 P;  3E2D A;  2XZ1 C;  4DG9 A;  2K0Y A;  3RG6 C;  5DCK A;  1IMQ A;  5I4T G;  4IZ6 A;  3NTE A;  7CEI A;  2QEX P;  2FQ1 A;  3DS5 A;  1ACP A;  2MR7 A;  2EHS A;  2L6E A;  1Q81 Q;  2GZI A;  1VQK P;  5HGO A;  1VKU A;  4QNB A;  1JJ2 O;  1DNY A;  2N6Z A;  1AF8 A;  3B4Q A;  1A8O A;  1VQ6 P;  4COC A;  1E6J P;  2LF4 A;  2GDX A;  3EJB A;  1L0I A;  3DS1 A;  2WPT A;  3G28 A;  3G4S P;  2KR5 A;  4U0D A;  2KGA A;  1M1K Q;  3DTJ A;  1RNI A;  2E1M A;  2OTL P;  3G26 A;  2KOP A;  2M8P A;  2KOS A;  3HYB A;  1YI2 P;  1VQ5 P;  2FQ0 A;  2K92 A;  3CCR P;  3H47 A;  3CCM P;  5EW5 E;  3CMA P;  4PXH B;  2XXM A;  4BPF A;  2DNW A;  2JYG A;  2VLN A;  2K0D X;  4XFX A;  2L9F A;  5KP6 B;  4XFY A;  2OTJ P;  2VLQ A;  1VQ8 P;  2M8L A;  4PH1 A;  2PEI A;  5HVC A;  5F2N A;  2K5X A;  3CCV P;  3DS0 A;  3Q20 A;  2KW2 A;  3G21 A;  2N6Y A;  2QNW A;  2LIU A;  2JGP A;  3CE7 A;  1UNK A;  2Z46 A;  3CME P;  1HQB A;  1YJN P;  1GXG A;  2GZF A;  5BS2 A;  2JU1 A;  2LL8 A;  1M6N A;  2N50 A;  2AFD A;  2LML A;  2AF8 A;  1YIT P;  1ZMB A;  1QRJ A;  2KGC A;  2XV6 A;  1YHQ P;  1M90 Q;  2JBG A;  2DGY A;  2PEJ A;  5KP8 B;  3I55 P;  2XZ0 D;  4COP A;  1KQS O;  1F80 D;  4H2X C;  1MZ8 A;  2KOD A;  2EFJ A;  2XT1 A;  2K0X A;  3MGE A;  3M1M A;  2OAR A;  2KWL A;  4BPH A; 
#chains in the Genus database with same CATH homology
 1QVG O;  1RNI A;  3HZQ A;  2E1M A;  2OTL P;  3G26 A;  1KD1 Q;  2M8P A;  2PEK A;  3HYB A;  3DS3 A;  1YI2 P;  4XRO A;  5HGL A;  5HGM A;  1VQ5 P;  1NJI Q;  1M74 A;  3LRY A;  1VQN P;  1VQ9 P;  1EIA A;  2PEN A;  3DS4 A;  3H47 A;  4M0I A;  3CCR P;  3CCM P;  3CC7 P;  3P05 A;  2Z45 A;  3CMA P;  1QVF O;  4GR6 A;  1YJW P;  1VQ4 P;  1A43 A;  2XXM A;  1AUM A;  2JYG A;  1EOQ A;  1D1D A;  3B5I A;  3H0D A;  4XFX A;  1K8A Q;  3WBH A;  3CPW O;  2Z44 A;  4XFY A;  3CCE P;  1BAJ A;  2BUO A;  2OTJ P;  2PY8 A;  2CWO A;  1RO2 A;  1VQ8 P;  1M6E X;  3G29 A;  5F2O A;  1Q86 Q;  4U0C A;  3CCL P;  3OW2 O;  2M8L A;  1W2B O;  4PH1 A;  2EG5 A;  2PEI A;  5F2N A;  3CCV P;  1VQ7 P;  1YJ9 P;  2QA4 P;  1K30 A;  2PEQ A;  3DS0 A;  3Q20 A;  1Q82 Q;  1RO0 A;  2PEM A;  3DPH A;  3G0V A;  3CC2 P;  3E2D A;  3G21 A;  2M8N A;  3VRL C;  4IPY A;  2JYL A;  3RG6 C;  5DCK A;  1KC8 Q;  5I4T G;  1K9M Q;  2Z46 A;  3CME P;  1YJN P;  3NTE A;  3G1G A;  2QEX P;  3DS5 A;  1YIJ P;  5BS2 A;  1VQM P;  3CD6 P;  1M6N A;  4U0B A;  2L6E A;  1Q81 Q;  5F2K A;  1IUQ A;  3CCU P;  3CC4 P;  1Q7Y Q;  1YIT P;  1ZMB A;  1VQK P;  5HGO A;  2JO0 A;  4XFZ A;  1QRJ A;  2XV6 A;  1YHQ P;  1M90 Q;  4QNB A;  5BS1 A;  3G1I A;  2DGY A;  4U0F A;  1JJ2 O;  2PEJ A;  4U0E A;  3I55 P;  3DS2 A;  1VQL P;  4GR2 A;  5HGN A;  3CCJ P;  2P9X A;  4XRQ A;  1A8O A;  2EIA A;  4WYM A;  4COP A;  1VQ6 P;  1KQS O;  1VQP P;  4COC A;  1E6J P;  2LF4 A;  1S72 P;  1K73 Q;  4U0A A;  5JPA A;  3CXC O;  2ONT A;  3G6E P;  4PH0 A;  2KOD A;  2EFJ A;  2XT1 A;  3G71 P;  1VQO P;  3CCQ P;  3MGE A;  3H4E A;  3DS1 A;  3CCS P;  3G28 A;  3M1M A;  3I56 P;  3G4S P;  2OAR A;  4U0D A;  1N8R Q;  1M1K Q;  3DTJ A;  2PEO A;  2BHV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...