1VQMP

The structure of the transition state analogue "dan" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 46
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1vqmP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1vqmP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1vqmP02
1W2BO 1M90Q 1K8AQ 3CPWO 1VQ5P 1QVFO 1YI2P 3CD6P 2OTJP 1VQ8P 3CC4P 1K9MQ 1JJ2O 3CCUP 3CCVP 1VQ7P 1VQ9P 1VQ4P 1KD1Q 3CCMP 3G6EP 1N8RQ 3CC2P 3G71P 1YIJP 3I56P 3I55P 3G4SP 3CMEP 3CCLP 3CMAP 1K73Q 1YITP 1QVGO 1VQNP 2QA4P 2OTLP 1NJIQ 1VQLP 3CCQP 1YJNP 1Q7YQ 3CCEP 1YHQP 1YJ9P 3CCJP 1YJWP 1Q81Q 3CCRP 3OW2O 1VQPP 1Q86Q 1KQSO 1VQMP 1S72P 2QEXP 1VQKP 1VQ6P 3CCSP 1M1KQ 1VQOP 1KC8Q 3CXCO 1Q82Q 3CC7P
chains in the Genus database with same CATH superfamily
1PP9G 2WPSA 3L36A 1TU3F 3B5NB 4TLFA 1KFNA 2QJKB 4IZ6A 1GZLA 4PXHB 2D2CD 1DH3A 3A0HH 1VQ6P 1RQVA 2WZ7A 2JWAA 1LT9B 2FVEA 1AVOA 1S9KD 2QJYB 4H2WC 1QEXA 3G6EP 1GXHA 3L71G 1J1EB 4MN4C 1K30A 3A2AA 3V2PA 2OYIC 1EXIA 1X0TA 5AVSB 1L4AD 3L70G 1Z6MA 3KYQA 3WU2E 4H44D 5AVRB 3P7KA 1KN7A 2DGYA 1NTMD 3TNUA 4NPDA 2I1JA 1SQXK 4GDOA 5BVZA 1K9MQ 3V4WA 1EDKA 2KNCB 1G1IA 1AQ5A 1VF5C 1NTZD 1E5WA 3SWYA 5JPAA 1U57A 5AW6B 4HYTB 2FYUD 2MVUA 2L0QA 1ZLLA 1UIXA 2FQ2A 1L0LK 1RF1C 1JEKA 2L91A 2GZEA 1L0ND 2QM8A 3RL0C 2J58A 5KAIH 5HGLA 4HB1A 1ZP0C 2FKWB 1S2EA 3RK3B 2KS1A 1A02J 2E75B 3H1IE 1GL2A 5AVXB 1ZXGA 2GYKA 1HWTC 2PEKA 3HE5A 4IOIH 1L0NE 2E1MA 4XE5B 2W83C 2VLOA 5EW5E 1YTZI 3L75D 3H1HD 1JY3N 1G2CB 1FDIA 3FXDA 3H1JJ 3B5NA 2LTEA 2FFDA 1SFCB 1KILC 3CCQP 1P84I 1NKNA 2N1TC 4U3FG 2KGDA 1LT9A 3GG2A 2W6AA 2KOOA 2J5UA 4UB8H 2JGPA 3AEDC 3H1HE 4U0EA 2IZ1A 1H89A 1KB9H 3HUSC 1RE3C 3L74D 1K05A 5CCHC 4PJ0E 3HD7C 3UIAA 1OIPA 2ZXXA 3WUVA 1NH4A 3AE3C 2IPPA 4L76A 4I2LC 1IZNB 5EJDA 3GF7A 2KNCA 2XV5A 3L74E 2JYLA 5F2NA 2K9JA 2H89C 2GUVA 5AW7B 3B8EB 2JBGA 1Q81Q 1PL5A 2WITA 3FXEA 3PH0A 1HH0A 4H0LC 3JSVC 5AVQB 5BU8B 3H1LG 2Z5HA 5B66E 2LPKA 2VSQA 1N7SB 1URQB 1FJPA 2LKMA 4AUWA 2SPZA 2KR5A 3H47A 1BDCA 2BUOA 3AE8C 4JQ0D 2EG5A 5KJ7D 1FDOA 3C1LA 1PEMA 3EJBA 3DS1A 1G2CA 4XROA 2OYHA 1SQVD 2K1AA 4BPGA 1P84H 4GODA 2Z44A 4GR6A 3G26A 4H13C 2WT7A 1IK7A 2B9BA 3OJAB 3A0BE 1BE3J 4RO0A 3OAKA 1KD1Q 2E75D 2FXOA 1X8YA 3CXHI 4D6TJ 4OGQD 4EIJA 1N73C 1SQVE 3V6IA 2XV6A 4WYMA 2W6BA 1YJNP 1Q7YQ 2RKLA 5TISE 1JY3P 3D6ZA 1AA0A 2KOPA 2OTKE 2GM4A 4KHXA 1U7MA 3W67A 2FBWC 2R3SA 2MD9A 1SFCD 3USSA 4IFFA 1G1JA 1EDJA 3U1AA 1RO2A 1LTAC 2AXTH 2JO1A 2D2CC 3MD0A 2FYZA 2ERHA 3MZWB 1PGQA 2E43A 1JY2O 1VQ7P 5K5GB 2Q1KA 5APQA 3AE9C 2IFMA 2M3EA 3C8VA 4I7ZC 1NU1K 2E74C 2CG5B 4WY4C 3H0DA 4XFJA 4PD4D 4YXWH 3GZMA 1FJKA 3RG2A 4H44C 1SQPD 5APUA 1FE6A 2FXPA 2PEMA 3OW2O 1JO5A 4AYCA 1N7SA 4XFZA 3EWKA 1URQA 1D1DA 1SQBG 1L0LJ 2PP6A 1AYIA 3WBHA 2UWJE 3E1IA 3H1JG 1VDFA 2MF4A 4Y28J 5KLVD 3V2QA 2KYVA 1SQPE 3M06A 3HE4B 1GPJA 1OVVA 1RNIA 1K8AQ 1HJBA 1EXJA 1KTMA 1DIPA 3HZQA 1J1DC 3IN6A 3H6PA 2K0YA 2QVAA 3CXHH 5KLVE 3FX0A 2LMLA 3DPHA 4HH2A 1AFOA 2A45I 1YITP 2PEJA 2GZFA 2KI7B 3TGUJ 1OXZA 2KIKA 3G1IA 1QL2A 1EDLA 5CHXA 3KZIH 2JEEA 4GOEA 3AE4C 1L0IA 1LTTC 3JCUH 1FOSF 1VQNP 1LTIC 3AEBC 3F89A 4R4MA 3NTNA 2CWOA 1RHZB 1VHNA 1GL2C 4GOFA 3VMXA 4ZMDA 4I1LA 2N50A 3BCCE 2HG5D 1S3JA 1PFIA 1KILD 2YO3A 1BXIA 1K04A 3H32B 1PZQA 2N1TD 4N78D 3B5NC 2FFDC 2K0XA 2QSIA 4M3LA 4HKGA 1CEIA 1Q90D 2QJKC 3DS0A 1FZCA 4K3AA 5DCKA 1BGYE 3D70A 2BEZF 1OFCX 4RJTA 1BCCJ 1KILE 1LT9C 3HD7D 2MR8A 1BE3G 4WY4B 1M57D 2QJYC 3HE4A 4N78E 2FXMA 3BATA 3CL3D 3CPWO 1J1EC 4UB6E 1NTMK 2VLNA 4D6TG 2V7QH 2ZYAA 5AW4B 1MFZA 3MIWA 2A45H 2V4HA 1FS0E 5CZDB 1NJIQ 1HQBA 5CCGD 1PV3A 2N5IA 4BWNA 2JQ4A 1KC8Q 2JAZA 2P58A 1VQ5P 2FYUK 3PLNA 1VQ9P 2KOGA 2BCCJ 4H0LD 2ITAA 2CPBA 2Y9ZA 1L0NK 4NEOA 3MGEA 2DNWA 1KYOE 3HTKA 1SQQD 3M9HA 1VQMP 5KKZB 2QEXP 2R32A 2IBZI 3CX5I 3OA7A 2KZJA 1EZVD 1LP1B 3RK3C 3U59A 1SP4A 3G29A 1SLQA 3EQ2A 3EFFK 5APVA 2B89A 5APWA 2RN0A 2A06G 1SQQE 5APTA 1L2PA 1KZUB 1YJ9P 1L0LG 4BPFA 3CLQA 1EZVE 2FYNB 5BS1A 2B87A 3R2PA 1M8OB 1X3OA 1PGJA 4ASVA 4HKZH 1SFCC 2CNRA 2AXCA 2KS1B 4U7JA 5TJHA 1NU1J 1QVGO 3PJSK 2HPCA 2WSEJ 3RL0g 1FOSE 2AF8A 1E79H 2JU1A 3AE6C 3EJDA 3NY7B 1RF0C 5KP6B 3H1KJ 3LIDA 2X2BA 1LT1A 2FFDB 4IPYA 1IFNA 3TGUG 1Y47A 2WSCH 3WU2H 3AE1C 4I6MC 5EFWB 1UJZA 2WSFJ 2GUSA 2Q3IA 1LJ2A 3AEAC 4R0MA 3BVHA 4DZOA 3MHVA 3EJEA 2PFXA 3L37A 2XDJA 4W7ZA 1RO0A 4C7RA 1SQBD 2E74D 3VMZA 1LNQA 4WY4D 1KQFB 2JKVA 1PPJG 5E79E 2C9LY 3CX5H 1W5CE 3RBXA 1BSHA 1EDIA 1S9KE 1QL1A 3M0AA 2P2UA 3KQGA 1VQ4P 1LP1A 4L75A 4IFDK 1OX3A 3FGAD 2W8ZA 1N7SC 1SQBE 4JF7A 1URQC 1LGHB 2K9JB 1PEQA 3A0HE 1NTME 4GT1A 3CCSP 1GW4A 3GMAA 1OZHA 1SQVK 2C0XA 2PAJA 4IL6H 1YQ3C 1NHLA 3E2DA 1NTZE 3G4SP 1JCDA 1BCCG 4WVZA 2FVAA 1RY3A 2W6JH 1NTKD 2FYUE 2MKVA 3AE7C 2KB7P 1A8OA 2L9FA 2JO0A 3PHLA 2WSCJ 2KK7A 1PIXA 5APXA 2G8YA 5L8RJ 2OYHB 3CCLP 2KWLA 1NTKE 4PJ0H 5AVTB 2WT7B 2C9NY 1FU1A 3HYBA 1VQOP 3CC7P 4W7YA 5I4TG 3MP7B 2NO8A 1QLED 1BAJA 3Q5SA 2BCCG 3CCVP 5KAIE 2N6ZA 2XZRA 3L75E 1NOHA 1GL2D 2W27A 2PEOA 1FZFA 2O01N 1NVOA 1ZW0A 2QE7H 2LXBA 1HBWA 1IFIA 1VPCA 2AFDA 1N86A 2EHSA 2JU2A 4TT3H 1Y8AA 1SQPK 3H1IJ 3B5ND 2QRXA 5CBNA 1JOCA 4N6JA 1GK4A 3A5TA 3FWLA 1KB9D 2L6EA 2WSSH 3T97B 1L0NJ 1FBMA 2Y0DA 5CCGC 1NWQA 5B66H 3H4EA 1OMIA 5KLVK 4D6TD 1FZCC 1IFPA 2ROQA 1T3UA 4UB8E 4C7NB 1WT6A 1M1JB 1NU1G 2ZT9B 5AVZB 1UNKA 1KB9E 4PWVB 2K88A 1OW8A 4H2YC 1ZV8A 4ASWA 3GKLC 1HVVA 5AW0B 2FQ0A 1GXGA 2NPSB 3GZLA 2O01J 2A45G 3H1HJ 3IFMA 4DOJA 3DS5A 4L74A 1SS1A 2WPTA 3Q20A 1KMIZ 2KG6A 3H1KG 3CCMP 1H8AA 5HVCA 5GTHE 2KXPB 2M8PA 2R5DA 2BASA 2KGCA 1SVFA 4OH8B 4OVNF 2XNDH 1OVUA 2E5YA 1KQLA 1QGKB 4KT0J 3GHGA 2ZJSE 2ZYGA 3RK3D 1AJYA 1N8RQ 4DG9A 2WPRA 1M7LA 2GDXA 1L0LD 5HGOA 4PV1B 3C9IA 3M1MA 3PTZA 4PH0A 1P84D 3CWBD 3MTUE 1MKMA 1DX7A 4ZKPA 2YIUB 2K37A 2Z46A 3L73D 3CI9A 4MRTC 3RK3E 1H0TB 5AW5B 2YKOA 2ZYDA 1P84E 3CWBE 1VQLP 1PP9D 3T97A 1JUNA 2XU6A 3AEGC 1FAVA 3BASA 1RQUA 3ABVC 3L73E 2N6YA 3NFQA 5M1BA 1M1KQ 4DCKA 2M5AB 4A7PA 1SQXJ 5KP8B 3Q1MA 1NAFA 4C7NA 1M1JA 1PP9E 1GW3A 4RKUJ 4CPGA 5B5EH 3VMAA 2JP3A 1AF8A 2M8LA 2NPSA 3L71D 2L5GB 2KODA 1M90Q 1SQVJ 1NQ4A 2B88A 2WTYA 1FZCB 2KP8A 3L70D 5CMZA 1PPJD 3AE5C 1EC5A 3PP5A 4KJMA 1FZGA 1IFDA 4PD4E 2AXTE 2YXRB 4YTPC 3TYYA 3BRTB 3L71E 2LIWA 3VTPC 2H7HA 2MVVA 1HUCA 3DS3A 1SQQK 1KORA 4NPFX 2YMKA 3L70E 2IBZG 4H2XC 4LLHA 1N7SD 5KKZC 1URQD 1X79B 2M0BA 3B5IA 1KYOI 3JC22 2QM7A 2E76B 1IC2A 3H1IG 2VLQA 3L72J 4C46A 5BU5A 1CZQA 1FZAA 3CC4P 2M8NA 3TDKA 3RGUA 1IMPA 2KLVA 3CXHD 1H0TA 1OR5A 3U1CA 2KSJA 1L0NG 1DEEG 1HGVA 1FZBA 2KG9A 3HTKB 2FYNC 3ITKA 2YKPA 1Q82Q 2O3JA 2IDBA 2IYPA 2GA1A 2M5AA 3G21A 3KHUA 1USEA 3P8CD 1SQPJ 3CXHE 2YKQA 1JY3O 4EOTA 1JMMA 4U3FD 1JCCA 1PGPA 5GTIH 1FR2A 2Z5IA 4QKOA 3HUSA 5KLVJ 1RE3A 2B87B 2OTJP 5CCHA 4U0CA 3Q5PA 2OYOA 3S1KA 4JBZA 3JCUE 4ZNCA 1K73Q 1IFJA 4U3FE 2HPCB 2N5HA 1A43A 5AW9B 2LF4A 3HRNA 1SQBK 4PH1A 1UIIA 3E1RA 1M74A 1IK9A 5CJ4A 4IFMA 3D71A 2WSEH 2K5XA 1YQ4C 3RK2B 1ZN5A 2WWWA 1IJDB 2EFJA 5AVUB 1Y9BA 1KYOH 2XNXA 3TSIA 2KZIA 1NTZK 4L73A 1L4AB 3BCCJ 1NU1D 3VYIA 2L22A 3H1LD 3SFEC 3WUTA 1VL2A 4JYBA 1HTLC 2WSFH 1ZRTD 3CMEP 3Q3DA 2PEQA 4GR2A 1AVYA 3LIEA 2IFNA 2KGEA 1MZ9A 1ZNVA 1XTCC 3H1KD 3QH9A 1LTJB 3A7OA 1BGYJ 1HF9A 3H1LE 1S5LH 1NTKK 1SQXG 2LR2A 2WPQA 3CCUP 4BRYB 1LTGC 1KQGB 3A3YB 1LWUB 2K94A 2O1JA 3CC2P 5KLIB 1ZRTE 2J59M 1NAYA 1MZ8A 2Y0CA 4LGDE 3MUDA 4AQRD 1SQVG 4O9BA 2Y9YA 1QVFO 2XT1A 1ACPA 1H88A 1KFMA 2OYHC 3VRLC 2QJPB 2XKMA 2Q7CA 2P9XA 3KXDA 2M3BA 3AECC 2JR8A 2VRSA 2GZIA 3CCJP 2EHTA 3SSUA 2EIAA 2PNGA 5H2FE 4K35A 1M6NA 2IZ0A 2WMMA 2FQ1A 3MGNA 2K2QA 2GDYA 2CK3H 1DV5A 2LXCB 3G28A 3SFDC 3B71A 2YMYA 3DTJA 3L72G 1CI6B 3DS4A 1L4AA 2IYOA 2PEIA 2FVFA 1JY2N 4DT0A 1MFTA 3VOPA 1SQQJ 1YIJP 3F5HA 3CMAP 1X22A 1WMKA 2H8PD 4Y99C 5KAFE 2KW2A 1ZMBA 5HGNA 1Q2NA 2FHSC 3AE2C 2R44A 3H1JD 1LTJA 1M1JC 1ZR4A 3RK2D 1SQPG 2ZT9C 3LMOA 1JJ2O 2KUBA 2JDIH 4BRYA 1LWUA 1KB9I 2NPSC 5HV8A 3VP9A 1ZOYC 3NXSA 5KLVG 1KQSO 2IBZD 3CX5D 3H1JE 1W2BO 4BXLA 3V4QA 2R3CA 2QG4A 3S4RA 3E7KA 2FACA 4ZKUA 3H1ID 1OW7A 2CPSA 2LL8A 2AFEA 1OWAA 2IBZE 3CX5E 2BEQD 2HYNA 1NO4A 3QWOC 5AVWB 2KLUA 1F80D 4PV1C 2R5BA 2O1KA 5KP7B 2Q6QA 3VMYA 4XRQA 2O01H 2K92A 2YIUC 2KORA 4OGQB 2MJZA 5AW8B 5AVYB 3BCCG 4IL6E 1SQBJ 3WUUA 3GHGB 1CI6A 1NTMJ 3O6QB 2JJLA 4EYYQ 3N7NA 1HGZA 4OWFA 1R8EA 3RG6C 2Q5UA 2PGDA 5CBOA 1BGYG 1GDTA 1NTZJ 1MV8A 2XZ0D 2PENA 3G9RA 2Z4EA 2HR3A 2FYUJ 2M5RA 5AW1B 1BE3D 2WVRA 1T8KA 3B4QA 1R5SA 1JY2P 4YXDC 4EDFA 3VN0A 4Y99B 3TK1A 1NTKJ 3GW6A 4XFYA 1M56D 4R4LA 3G71P 1QX8A 5GTHH 3PRJA 3I55P 1T2KC 1BE3E 2ZVNB 4M0IA 1HJ0A 4PD4I 5KJ7A 1Z56A 1RH5B 2DW3A 4U0DA 2PRRA 3L75J 3P05A 4D6TE 4Z1MH 2OYIB 4CA3A 2ONTA 3A0BH 5APSA 3CD6P 1DEBA 2JYGA 7CEIA 2JWDA 1RE4A 3IR9A 3SWFA 2E76C 1VF5B 1FZEA 1SQXD 3KPEA 5F2KA 5DJUB 5TISH 2L4BA 1T6AA 2N9YB 1MUUA 1FDMA 3M91A 1YI2P 2K3RA 1SQQG 3L74J 1RF1B 2A06D 1GU5A 3V2RA 1EZVG 4GIFA 3RL0B 3O6QA 1GMJA 5AW2B 3W68A 2QA4P 1SQXE 1SFCA 2AEMA 1NYHA 1AUMA 3CCEP 3IAOA 2Z45A 3M0DA 2FADA 5AW3B 2M8RA 2WQYC 3V2NA 3RBZA 5CJ0A 2A06E 2I1KA 3LW5H 2JB0A 4COCA 1L0LE 3MUDC 3S9OA 1GTWA 3Q2YA 1M6EX 3U43A 1NGMB 3GF3A 1RF0A 2IX7C 2MY5A 3B4SA 1KILB 1KV4A 3L35A 1VQ8P 2N1TB 3TGUD 1E6JP 2QNWA 2E5TA 4BPHA 3L72D 2KOQA 2OARA 4PD4H 3LRYA 2I8DA 3NMDA 3HUSB 2ZFCA 2OYIA 3HD7B 1YYCA 1LTSC 3RK2C 2NZ2A 1KLPA 4XA4A 2AVAA 3TGUE 4QMAA 1ZR2A 2YO2A 2PY8A 3L72E 1HY8A 3KDPB 5DJTB 1S5LX 1L4AC 3L4FA 3FWNA 1GK6A 1X9VA 1AQTA 3WMM0 4U0BA 3G1GA 1LTBC 3G0VA 4XFXA 3CWBJ 1NTMG 2ZT9D 1JNMA 2GDWA 2Q9IA 1PPJE 2MR7A 2P67A 2FY8A 1RF1A 3L73J 3Q5RA 2N98A 3P32A 4H0LB 1LTJC 2NPSD 1WRGA 5B5EE 1PEUA 2K0DX 1NTZG 3LW5J 1VQKP 1JTHB 1LWUC 5KLIC 2FYUG 2YXQB 1BCCD 1PP9J 4EI2A 5F2OA 3DS2A 2OGUA 1VF5D 1AV1A 3CE7A 3R4YA 5C39A 1YHQP 1D7MA 1VQPP 1IFMA 3IF4A 1KILA 1NTKG 2W90A 2QJPC 1BCCE 1T3JA 2CGQA 1ZMEC 1EZVI 3RL0D 4H13B 4PV1D 2QIWA 3AEEC 1EMVA 2N1TA 3BCCD 2NRGA 3I5CA 4N3YB 3I56P 3L71J 2LIUA 4W80A 2ZXEB 2AEFA 4WWIA 1PGOA 1OVRA 1USDA 2HODB 4F37A 1JM0A 1YBKA 3L75G 3H1HG 1N73B 2BCCD 3L70J 2LOLA 2GZGA 1BSNA 1N7LA 2KG8A 3EFGA 3ZDMA 1JB0J 3HD7A 3KZIE 2E42A 2CQ8A 3P8CE 4UB6H 1T8ZA 1BGYD 4WB4A 1GU4A 1PEOA 2BCCE 1J2JB 1A02F 4GKGA 1CW5A 2C0WA 3L74G 2D2CB 5CCGA 1NKZB 1IMQA 2HLOA 2H43A 1E0HA 1N2DC 4COPA 2N9BA 4RESB 1EIAA 4LC1A 5BS2A 2VLPA 4IL6X 3G3ZA 3M9BA 5GTIE 5CCHD 3AEFC 2P10A 4I7ZB 2YNYA 2E74B 4YPCA 1EQ7A 3CXCO 4H44B 1JTHA 1S1CX 3H25A 2K9YA 2XXMA 5HGMA 1XTGB 1YTZT 1OW6A 1T2KD 2KGAA 3II6A 3K5BA 1KYOD 2OQQA 3CCRP 1Q86Q 2BHVA 3N4XA 1JMBA 4JPZB 2HFED 3D6YA 1NU1E 3BRVB 2XZ1C 3TF5A 4U3FJ 1R5LA 1VKUA 1BDDA 2P7JA 2ZVOB 5KJ7C 4HJGH 5KTBA 2WPVB 1IO4A 2G3AA 1GD2E 5AVVB 2ZAEB 3M9QA 1J1DB 2E76D 3O8ZA 3GLMA 3TNUB 1YJWP 2HODA 4WBAA 3H1KE 4U0FA 2Q3EA 1N73A 1RE4C 5H2FH 1FC2C 3GJNA 1U7JA 2KOSA 2KSEA 2E75C 2POHA 2FAEA 2RMZA 2AEJA 4OGQC 1EOQA 4UHPB 4JYCA 3P8MC 2H88C 2OTLP 2GZJA 1W2EA 2BQ1E 3GHGC 3NTEA 1IUQA 3H32A 1S72P 3VP8A 4H13D 2LKIA 1S5LE 4B86A 3CWBG 1DD4A 1L0HA 3SWKA 4QNBA 3L73G 4NPEA 3M0DC 1QRJA 5APYA 1S4XA 1CSBA 1GL2B 4DJGA 3H1LJ 3V5BA 5KAFH 2RH0A 1DNYA 2Y0EA 2P1JA 2V7QJ 3HE5B 5E79H 2K93A 1DD3A 4WY4A 4U0AA
chains in the Genus database with same CATH topology
2PENA 3H47A 5BS1A 2E1MA 3WBHA 3G21A 1JJ2O 3CCUP 2BUOA 5F2OA 2XXMA 5HGMA 3DS0A 2EG5A 3DS2A 3CC2P 3E2DA 4COCA 5DCKA 1PEMA 3DS1A 3G4SP 4XROA 1M6EX 1QVGO 3CCQP 1YHQP 2Z44A 3CCRP 1VQPP 4GR6A 2BHVA 3G26A 1Q86Q 1KQSO 1VQ6P 1A8OA 2M8LA 3DS5A 2OTJP 2JO0A 2KODA 1W2BO 1RNIA 1K8AQ 3CPWO 2XT1A 4U0CA 1M90Q 1QVFO 1VQ8P 3HZQA 3Q20A 4XFYA 1KD1Q 3CCMP 1E6JP 3VRLC 3G6EP 3G71P 1K30A 4U0EA 3I56P 3I55P 3DPHA 2P9XA 3CCLP 2M8PA 4IPYA 1K73Q 4M0IA 2OARA 2PEJA 1YITP 2XV6A 4WYMA 3LRYA 1NJIQ 1YJNP 1Q7YQ 2DGYA 3CCJP 1YJWP 4U0DA 1A43A 2LF4A 3P05A 4U0FA 2EIAA 3G1IA 3HYBA 1VQOP 1KC8Q 4PH1A 3CC7P 1M6NA 1D1DA 5I4TG 2ONTA 1VQ5P 3CD6P 3DS3A 1BAJA 1K9MQ 1VQ9P 1M74A 3CCVP 2JYGA 1N8RQ 4XRQA 2PEOA 2PY8A 5HGOA 1RO0A 1EOQA 2EFJA 5JPAA 1VQNP 3M1MA 2OTLP 3MGEA 2JYLA 4PH0A 1PEOA 5F2NA 5F2KA 1RO2A 3B5IA 4U0BA 2BQ1E 3G1GA 1Q81Q 3NTEA 1IUQA 3G28A 1M1KQ 1VQMP 1S72P 2QEXP 3DTJA 2Z46A 3DS4A 2PEIA 2CWOA 3G0VA 1YI2P 4XFXA 3CC4P 2M8NA 1VQ7P 4QNBA 1VQ4P 3G29A 4COPA 5HGLA 1YIJP 1EIAA 3CMEP 1QRJA 2L6EA 2PEQA 3CMAP 5BS2A 3H0DA 2QA4P 4GR2A 1PEQA 1VQLP 1AUMA 3CCEP 3RG6C 1YJ9P 1ZMBA 3H4EA 2PEMA 2Z45A 1PEUA 3OW2O 5HGNA 1VQKP 4XFZA 3CCSP 2PEKA 4U0AA 3CXCO 1Q82Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W2B O;  1M90 Q;  1K8A Q;  3CPW O;  1VQ5 P;  1QVF O;  1YI2 P;  3CD6 P;  2OTJ P;  1VQ8 P;  3CC4 P;  1K9M Q;  1JJ2 O;  3CCU P;  3CCV P;  1VQ7 P;  1VQ9 P;  1VQ4 P;  1KD1 Q;  3CCM P;  3G6E P;  1N8R Q;  3CC2 P;  3G71 P;  1YIJ P;  3I56 P;  3I55 P;  3G4S P;  3CME P;  3CCL P;  3CMA P;  1K73 Q;  1YIT P;  1QVG O;  1VQN P;  2QA4 P;  2OTL P;  1NJI Q;  1VQL P;  3CCQ P;  1YJN P;  1Q7Y Q;  3CCE P;  1YHQ P;  1YJ9 P;  3CCJ P;  1YJW P;  1Q81 Q;  3CCR P;  3OW2 O;  1VQP P;  1Q86 Q;  1KQS O;  1VQM P;  1S72 P;  2QEX P;  1VQK P;  1VQ6 P;  3CCS P;  1M1K Q;  1VQO P;  1KC8 Q;  3CXC O;  1Q82 Q;  3CC7 P; 
#chains in the Genus database with same CATH topology
 1PP9 G;  2WPS A;  3L36 A;  1TU3 F;  3B5N B;  4TLF A;  1KFN A;  2QJK B;  4IZ6 A;  1GZL A;  4PXH B;  2D2C D;  1DH3 A;  3A0H H;  1VQ6 P;  1RQV A;  2WZ7 A;  2JWA A;  1LT9 B;  2FVE A;  1AVO A;  1S9K D;  2QJY B;  4H2W C;  1QEX A;  3G6E P;  1GXH A;  3L71 G;  1J1E B;  4MN4 C;  1K30 A;  3A2A A;  3V2P A;  2OYI C;  1EXI A;  1X0T A;  5AVS B;  1L4A D;  3L70 G;  1Z6M A;  3KYQ A;  3WU2 E;  4H44 D;  5AVR B;  3P7K A;  1KN7 A;  2DGY A;  1NTM D;  3TNU A;  4NPD A;  2I1J A;  1SQX K;  4GDO A;  5BVZ A;  1K9M Q;  3V4W A;  1EDK A;  2KNC B;  1G1I A;  1AQ5 A;  1VF5 C;  1NTZ D;  1E5W A;  3SWY A;  5JPA A;  1U57 A;  5AW6 B;  4HYT B;  2FYU D;  2MVU A;  2L0Q A;  1ZLL A;  1UIX A;  2FQ2 A;  1L0L K;  1RF1 C;  1JEK A;  2L91 A;  2GZE A;  1L0N D;  2QM8 A;  3RL0 C;  2J58 A;  5KAI H;  5HGL A;  4HB1 A;  1ZP0 C;  2FKW B;  1S2E A;  3RK3 B;  2KS1 A;  1A02 J;  2E75 B;  3H1I E;  1GL2 A;  5AVX B;  1ZXG A;  2GYK A;  1HWT C;  2PEK A;  3HE5 A;  4IOI H;  1L0N E;  2E1M A;  4XE5 B;  2W83 C;  2VLO A;  5EW5 E;  1YTZ I;  3L75 D;  3H1H D;  1JY3 N;  1G2C B;  1FDI A;  3FXD A;  3H1J J;  3B5N A;  2LTE A;  2FFD A;  1SFC B;  1KIL C;  3CCQ P;  1P84 I;  1NKN A;  2N1T C;  4U3F G;  2KGD A;  1LT9 A;  3GG2 A;  2W6A A;  2KOO A;  2J5U A;  4UB8 H;  2JGP A;  3AED C;  3H1H E;  4U0E A;  2IZ1 A;  1H89 A;  1KB9 H;  3HUS C;  1RE3 C;  3L74 D;  1K05 A;  5CCH C;  4PJ0 E;  3HD7 C;  3UIA A;  1OIP A;  2ZXX A;  3WUV A;  1NH4 A;  3AE3 C;  2IPP A;  4L76 A;  4I2L C;  1IZN B;  5EJD A;  3GF7 A;  2KNC A;  2XV5 A;  3L74 E;  2JYL A;  5F2N A;  2K9J A;  2H89 C;  2GUV A;  5AW7 B;  3B8E B;  2JBG A;  1Q81 Q;  1PL5 A;  2WIT A;  3FXE A;  3PH0 A;  1HH0 A;  4H0L C;  3JSV C;  5AVQ B;  5BU8 B;  3H1L G;  2Z5H A;  5B66 E;  2LPK A;  2VSQ A;  1N7S B;  1URQ B;  1FJP A;  2LKM A;  4AUW A;  2SPZ A;  2KR5 A;  3H47 A;  1BDC A;  2BUO A;  3AE8 C;  4JQ0 D;  2EG5 A;  5KJ7 D;  1FDO A;  3C1L A;  1PEM A;  3EJB A;  3DS1 A;  1G2C A;  4XRO A;  2OYH A;  1SQV D;  2K1A A;  4BPG A;  1P84 H;  4GOD A;  2Z44 A;  4GR6 A;  3G26 A;  4H13 C;  2WT7 A;  1IK7 A;  2B9B A;  3OJA B;  3A0B E;  1BE3 J;  4RO0 A;  3OAK A;  1KD1 Q;  2E75 D;  2FXO A;  1X8Y A;  3CXH I;  4D6T J;  4OGQ D;  4EIJ A;  1N73 C;  1SQV E;  3V6I A;  2XV6 A;  4WYM A;  2W6B A;  1YJN P;  1Q7Y Q;  2RKL A;  5TIS E;  1JY3 P;  3D6Z A;  1AA0 A;  2KOP A;  2OTK E;  2GM4 A;  4KHX A;  1U7M A;  3W67 A;  2FBW C;  2R3S A;  2MD9 A;  1SFC D;  3USS A;  4IFF A;  1G1J A;  1EDJ A;  3U1A A;  1RO2 A;  1LTA C;  2AXT H;  2JO1 A;  2D2C C;  3MD0 A;  2FYZ A;  2ERH A;  3MZW B;  1PGQ A;  2E43 A;  1JY2 O;  1VQ7 P;  5K5G B;  2Q1K A;  5APQ A;  3AE9 C;  2IFM A;  2M3E A;  3C8V A;  4I7Z C;  1NU1 K;  2E74 C;  2CG5 B;  4WY4 C;  3H0D A;  4XFJ A;  4PD4 D;  4YXW H;  3GZM A;  1FJK A;  3RG2 A;  4H44 C;  1SQP D;  5APU A;  1FE6 A;  2FXP A;  2PEM A;  3OW2 O;  1JO5 A;  4AYC A;  1N7S A;  4XFZ A;  3EWK A;  1URQ A;  1D1D A;  1SQB G;  1L0L J;  2PP6 A;  1AYI A;  3WBH A;  2UWJ E;  3E1I A;  3H1J G;  1VDF A;  2MF4 A;  4Y28 J;  5KLV D;  3V2Q A;  2KYV A;  1SQP E;  3M06 A;  3HE4 B;  1GPJ A;  1OVV A;  1RNI A;  1K8A Q;  1HJB A;  1EXJ A;  1KTM A;  1DIP A;  3HZQ A;  1J1D C;  3IN6 A;  3H6P A;  2K0Y A;  2QVA A;  3CXH H;  5KLV E;  3FX0 A;  2LML A;  3DPH A;  4HH2 A;  1AFO A;  2A45 I;  1YIT P;  2PEJ A;  2GZF A;  2KI7 B;  3TGU J;  1OXZ A;  2KIK A;  3G1I A;  1QL2 A;  1EDL A;  5CHX A;  3KZI H;  2JEE A;  4GOE A;  3AE4 C;  1L0I A;  1LTT C;  3JCU H;  1FOS F;  1VQN P;  1LTI C;  3AEB C;  3F89 A;  4R4M A;  3NTN A;  2CWO A;  1RHZ B;  1VHN A;  1GL2 C;  4GOF A;  3VMX A;  4ZMD A;  4I1L A;  2N50 A;  3BCC E;  2HG5 D;  1S3J A;  1PFI A;  1KIL D;  2YO3 A;  1BXI A;  1K04 A;  3H32 B;  1PZQ A;  2N1T D;  4N78 D;  3B5N C;  2FFD C;  2K0X A;  2QSI A;  4M3L A;  4HKG A;  1CEI A;  1Q90 D;  2QJK C;  3DS0 A;  1FZC A;  4K3A A;  5DCK A;  1BGY E;  3D70 A;  2BEZ F;  1OFC X;  4RJT A;  1BCC J;  1KIL E;  1LT9 C;  3HD7 D;  2MR8 A;  1BE3 G;  4WY4 B;  1M57 D;  2QJY C;  3HE4 A;  4N78 E;  2FXM A;  3BAT A;  3CL3 D;  3CPW O;  1J1E C;  4UB6 E;  1NTM K;  2VLN A;  4D6T G;  2V7Q H;  2ZYA A;  5AW4 B;  1MFZ A;  3MIW A;  2A45 H;  2V4H A;  1FS0 E;  5CZD B;  1NJI Q;  1HQB A;  5CCG D;  1PV3 A;  2N5I A;  4BWN A;  2JQ4 A;  1KC8 Q;  2JAZ A;  2P58 A;  1VQ5 P;  2FYU K;  3PLN A;  1VQ9 P;  2KOG A;  2BCC J;  4H0L D;  2ITA A;  2CPB A;  2Y9Z A;  1L0N K;  4NEO A;  3MGE A;  2DNW A;  1KYO E;  3HTK A;  1SQQ D;  3M9H A;  1VQM P;  5KKZ B;  2QEX P;  2R32 A;  2IBZ I;  3CX5 I;  3OA7 A;  2KZJ A;  1EZV D;  1LP1 B;  3RK3 C;  3U59 A;  1SP4 A;  3G29 A;  1SLQ A;  3EQ2 A;  3EFF K;  5APV A;  2B89 A;  5APW A;  2RN0 A;  2A06 G;  1SQQ E;  5APT A;  1L2P A;  1KZU B;  1YJ9 P;  1L0L G;  4BPF A;  3CLQ A;  1EZV E;  2FYN B;  5BS1 A;  2B87 A;  3R2P A;  1M8O B;  1X3O A;  1PGJ A;  4ASV A;  4HKZ H;  1SFC C;  2CNR A;  2AXC A;  2KS1 B;  4U7J A;  5TJH A;  1NU1 J;  1QVG O;  3PJS K;  2HPC A;  2WSE J;  3RL0 g;  1FOS E;  2AF8 A;  1E79 H;  2JU1 A;  3AE6 C;  3EJD A;  3NY7 B;  1RF0 C;  5KP6 B;  3H1K J;  3LID A;  2X2B A;  1LT1 A;  2FFD B;  4IPY A;  1IFN A;  3TGU G;  1Y47 A;  2WSC H;  3WU2 H;  3AE1 C;  4I6M C;  5EFW B;  1UJZ A;  2WSF J;  2GUS A;  2Q3I A;  1LJ2 A;  3AEA C;  4R0M A;  3BVH A;  4DZO A;  3MHV A;  3EJE A;  2PFX A;  3L37 A;  2XDJ A;  4W7Z A;  1RO0 A;  4C7R A;  1SQB D;  2E74 D;  3VMZ A;  1LNQ A;  4WY4 D;  1KQF B;  2JKV A;  1PPJ G;  5E79 E;  2C9L Y;  3CX5 H;  1W5C E;  3RBX A;  1BSH A;  1EDI A;  1S9K E;  1QL1 A;  3M0A A;  2P2U A;  3KQG A;  1VQ4 P;  1LP1 A;  4L75 A;  4IFD K;  1OX3 A;  3FGA D;  2W8Z A;  1N7S C;  1SQB E;  4JF7 A;  1URQ C;  1LGH B;  2K9J B;  1PEQ A;  3A0H E;  1NTM E;  4GT1 A;  3CCS P;  1GW4 A;  3GMA A;  1OZH A;  1SQV K;  2C0X A;  2PAJ A;  4IL6 H;  1YQ3 C;  1NHL A;  3E2D A;  1NTZ E;  3G4S P;  1JCD A;  1BCC G;  4WVZ A;  2FVA A;  1RY3 A;  2W6J H;  1NTK D;  2FYU E;  2MKV A;  3AE7 C;  2KB7 P;  1A8O A;  2L9F A;  2JO0 A;  3PHL A;  2WSC J;  2KK7 A;  1PIX A;  5APX A;  2G8Y A;  5L8R J;  2OYH B;  3CCL P;  2KWL A;  1NTK E;  4PJ0 H;  5AVT B;  2WT7 B;  2C9N Y;  1FU1 A;  3HYB A;  1VQO P;  3CC7 P;  4W7Y A;  5I4T G;  3MP7 B;  2NO8 A;  1QLE D;  1BAJ A;  3Q5S A;  2BCC G;  3CCV P;  5KAI E;  2N6Z A;  2XZR A;  3L75 E;  1NOH A;  1GL2 D;  2W27 A;  2PEO A;  1FZF A;  2O01 N;  1NVO A;  1ZW0 A;  2QE7 H;  2LXB A;  1HBW A;  1IFI A;  1VPC A;  2AFD A;  1N86 A;  2EHS A;  2JU2 A;  4TT3 H;  1Y8A A;  1SQP K;  3H1I J;  3B5N D;  2QRX A;  5CBN A;  1JOC A;  4N6J A;  1GK4 A;  3A5T A;  3FWL A;  1KB9 D;  2L6E A;  2WSS H;  3T97 B;  1L0N J;  1FBM A;  2Y0D A;  5CCG C;  1NWQ A;  5B66 H;  3H4E A;  1OMI A;  5KLV K;  4D6T D;  1FZC C;  1IFP A;  2ROQ A;  1T3U A;  4UB8 E;  4C7N B;  1WT6 A;  1M1J B;  1NU1 G;  2ZT9 B;  5AVZ B;  1UNK A;  1KB9 E;  4PWV B;  2K88 A;  1OW8 A;  4H2Y C;  1ZV8 A;  4ASW A;  3GKL C;  1HVV A;  5AW0 B;  2FQ0 A;  1GXG A;  2NPS B;  3GZL A;  2O01 J;  2A45 G;  3H1H J;  3IFM A;  4DOJ A;  3DS5 A;  4L74 A;  1SS1 A;  2WPT A;  3Q20 A;  1KMI Z;  2KG6 A;  3H1K G;  3CCM P;  1H8A A;  5HVC A;  5GTH E;  2KXP B;  2M8P A;  2R5D A;  2BAS A;  2KGC A;  1SVF A;  4OH8 B;  4OVN F;  2XND H;  1OVU A;  2E5Y A;  1KQL A;  1QGK B;  4KT0 J;  3GHG A;  2ZJS E;  2ZYG A;  3RK3 D;  1AJY A;  1N8R Q;  4DG9 A;  2WPR A;  1M7L A;  2GDX A;  1L0L D;  5HGO A;  4PV1 B;  3C9I A;  3M1M A;  3PTZ A;  4PH0 A;  1P84 D;  3CWB D;  3MTU E;  1MKM A;  1DX7 A;  4ZKP A;  2YIU B;  2K37 A;  2Z46 A;  3L73 D;  3CI9 A;  4MRT C;  3RK3 E;  1H0T B;  5AW5 B;  2YKO A;  2ZYD A;  1P84 E;  3CWB E;  1VQL P;  1PP9 D;  3T97 A;  1JUN A;  2XU6 A;  3AEG C;  1FAV A;  3BAS A;  1RQU A;  3ABV C;  3L73 E;  2N6Y A;  3NFQ A;  5M1B A;  1M1K Q;  4DCK A;  2M5A B;  4A7P A;  1SQX J;  5KP8 B;  3Q1M A;  1NAF A;  4C7N A;  1M1J A;  1PP9 E;  1GW3 A;  4RKU J;  4CPG A;  5B5E H;  3VMA A;  2JP3 A;  1AF8 A;  2M8L A;  2NPS A;  3L71 D;  2L5G B;  2KOD A;  1M90 Q;  1SQV J;  1NQ4 A;  2B88 A;  2WTY A;  1FZC B;  2KP8 A;  3L70 D;  5CMZ A;  1PPJ D;  3AE5 C;  1EC5 A;  3PP5 A;  4KJM A;  1FZG A;  1IFD A;  4PD4 E;  2AXT E;  2YXR B;  4YTP C;  3TYY A;  3BRT B;  3L71 E;  2LIW A;  3VTP C;  2H7H A;  2MVV A;  1HUC A;  3DS3 A;  1SQQ K;  1KOR A;  4NPF X;  2YMK A;  3L70 E;  2IBZ G;  4H2X C;  4LLH A;  1N7S D;  5KKZ C;  1URQ D;  1X79 B;  2M0B A;  3B5I A;  1KYO I;  3JC2 2;  2QM7 A;  2E76 B;  1IC2 A;  3H1I G;  2VLQ A;  3L72 J;  4C46 A;  5BU5 A;  1CZQ A;  1FZA A;  3CC4 P;  2M8N A;  3TDK A;  3RGU A;  1IMP A;  2KLV A;  3CXH D;  1H0T A;  1OR5 A;  3U1C A;  2KSJ A;  1L0N G;  1DEE G;  1HGV A;  1FZB A;  2KG9 A;  3HTK B;  2FYN C;  3ITK A;  2YKP A;  1Q82 Q;  2O3J A;  2IDB A;  2IYP A;  2GA1 A;  2M5A A;  3G21 A;  3KHU A;  1USE A;  3P8C D;  1SQP J;  3CXH E;  2YKQ A;  1JY3 O;  4EOT A;  1JMM A;  4U3F D;  1JCC A;  1PGP A;  5GTI H;  1FR2 A;  2Z5I A;  4QKO A;  3HUS A;  5KLV J;  1RE3 A;  2B87 B;  2OTJ P;  5CCH A;  4U0C A;  3Q5P A;  2OYO A;  3S1K A;  4JBZ A;  3JCU E;  4ZNC A;  1K73 Q;  1IFJ A;  4U3F E;  2HPC B;  2N5H A;  1A43 A;  5AW9 B;  2LF4 A;  3HRN A;  1SQB K;  4PH1 A;  1UII A;  3E1R A;  1M74 A;  1IK9 A;  5CJ4 A;  4IFM A;  3D71 A;  2WSE H;  2K5X A;  1YQ4 C;  3RK2 B;  1ZN5 A;  2WWW A;  1IJD B;  2EFJ A;  5AVU B;  1Y9B A;  1KYO H;  2XNX A;  3TSI A;  2KZI A;  1NTZ K;  4L73 A;  1L4A B;  3BCC J;  1NU1 D;  3VYI A;  2L22 A;  3H1L D;  3SFE C;  3WUT A;  1VL2 A;  4JYB A;  1HTL C;  2WSF H;  1ZRT D;  3CME P;  3Q3D A;  2PEQ A;  4GR2 A;  1AVY A;  3LIE A;  2IFN A;  2KGE A;  1MZ9 A;  1ZNV A;  1XTC C;  3H1K D;  3QH9 A;  1LTJ B;  3A7O A;  1BGY J;  1HF9 A;  3H1L E;  1S5L H;  1NTK K;  1SQX G;  2LR2 A;  2WPQ A;  3CCU P;  4BRY B;  1LTG C;  1KQG B;  3A3Y B;  1LWU B;  2K94 A;  2O1J A;  3CC2 P;  5KLI B;  1ZRT E;  2J59 M;  1NAY A;  1MZ8 A;  2Y0C A;  4LGD E;  3MUD A;  4AQR D;  1SQV G;  4O9B A;  2Y9Y A;  1QVF O;  2XT1 A;  1ACP A;  1H88 A;  1KFM A;  2OYH C;  3VRL C;  2QJP B;  2XKM A;  2Q7C A;  2P9X A;  3KXD A;  2M3B A;  3AEC C;  2JR8 A;  2VRS A;  2GZI A;  3CCJ P;  2EHT A;  3SSU A;  2EIA A;  2PNG A;  5H2F E;  4K35 A;  1M6N A;  2IZ0 A;  2WMM A;  2FQ1 A;  3MGN A;  2K2Q A;  2GDY A;  2CK3 H;  1DV5 A;  2LXC B;  3G28 A;  3SFD C;  3B71 A;  2YMY A;  3DTJ A;  3L72 G;  1CI6 B;  3DS4 A;  1L4A A;  2IYO A;  2PEI A;  2FVF A;  1JY2 N;  4DT0 A;  1MFT A;  3VOP A;  1SQQ J;  1YIJ P;  3F5H A;  3CMA P;  1X22 A;  1WMK A;  2H8P D;  4Y99 C;  5KAF E;  2KW2 A;  1ZMB A;  5HGN A;  1Q2N A;  2FHS C;  3AE2 C;  2R44 A;  3H1J D;  1LTJ A;  1M1J C;  1ZR4 A;  3RK2 D;  1SQP G;  2ZT9 C;  3LMO A;  1JJ2 O;  2KUB A;  2JDI H;  4BRY A;  1LWU A;  1KB9 I;  2NPS C;  5HV8 A;  3VP9 A;  1ZOY C;  3NXS A;  5KLV G;  1KQS O;  2IBZ D;  3CX5 D;  3H1J E;  1W2B O;  4BXL A;  3V4Q A;  2R3C A;  2QG4 A;  3S4R A;  3E7K A;  2FAC A;  4ZKU A;  3H1I D;  1OW7 A;  2CPS A;  2LL8 A;  2AFE A;  1OWA A;  2IBZ E;  3CX5 E;  2BEQ D;  2HYN A;  1NO4 A;  3QWO C;  5AVW B;  2KLU A;  1F80 D;  4PV1 C;  2R5B A;  2O1K A;  5KP7 B;  2Q6Q A;  3VMY A;  4XRQ A;  2O01 H;  2K92 A;  2YIU C;  2KOR A;  4OGQ B;  2MJZ A;  5AW8 B;  5AVY B;  3BCC G;  4IL6 E;  1SQB J;  3WUU A;  3GHG B;  1CI6 A;  1NTM J;  3O6Q B;  2JJL A;  4EYY Q;  3N7N A;  1HGZ A;  4OWF A;  1R8E A;  3RG6 C;  2Q5U A;  2PGD A;  5CBO A;  1BGY G;  1GDT A;  1NTZ J;  1MV8 A;  2XZ0 D;  2PEN A;  3G9R A;  2Z4E A;  2HR3 A;  2FYU J;  2M5R A;  5AW1 B;  1BE3 D;  2WVR A;  1T8K A;  3B4Q A;  1R5S A;  1JY2 P;  4YXD C;  4EDF A;  3VN0 A;  4Y99 B;  3TK1 A;  1NTK J;  3GW6 A;  4XFY A;  1M56 D;  4R4L A;  3G71 P;  1QX8 A;  5GTH H;  3PRJ A;  3I55 P;  1T2K C;  1BE3 E;  2ZVN B;  4M0I A;  1HJ0 A;  4PD4 I;  5KJ7 A;  1Z56 A;  1RH5 B;  2DW3 A;  4U0D A;  2PRR A;  3L75 J;  3P05 A;  4D6T E;  4Z1M H;  2OYI B;  4CA3 A;  2ONT A;  3A0B H;  5APS A;  3CD6 P;  1DEB A;  2JYG A;  7CEI A;  2JWD A;  1RE4 A;  3IR9 A;  3SWF A;  2E76 C;  1VF5 B;  1FZE A;  1SQX D;  3KPE A;  5F2K A;  5DJU B;  5TIS H;  2L4B A;  1T6A A;  2N9Y B;  1MUU A;  1FDM A;  3M91 A;  1YI2 P;  2K3R A;  1SQQ G;  3L74 J;  1RF1 B;  2A06 D;  1GU5 A;  3V2R A;  1EZV G;  4GIF A;  3RL0 B;  3O6Q A;  1GMJ A;  5AW2 B;  3W68 A;  2QA4 P;  1SQX E;  1SFC A;  2AEM A;  1NYH A;  1AUM A;  3CCE P;  3IAO A;  2Z45 A;  3M0D A;  2FAD A;  5AW3 B;  2M8R A;  2WQY C;  3V2N A;  3RBZ A;  5CJ0 A;  2A06 E;  2I1K A;  3LW5 H;  2JB0 A;  4COC A;  1L0L E;  3MUD C;  3S9O A;  1GTW A;  3Q2Y A;  1M6E X;  3U43 A;  1NGM B;  3GF3 A;  1RF0 A;  2IX7 C;  2MY5 A;  3B4S A;  1KIL B;  1KV4 A;  3L35 A;  1VQ8 P;  2N1T B;  3TGU D;  1E6J P;  2QNW A;  2E5T A;  4BPH A;  3L72 D;  2KOQ A;  2OAR A;  4PD4 H;  3LRY A;  2I8D A;  3NMD A;  3HUS B;  2ZFC A;  2OYI A;  3HD7 B;  1YYC A;  1LTS C;  3RK2 C;  2NZ2 A;  1KLP A;  4XA4 A;  2AVA A;  3TGU E;  4QMA A;  1ZR2 A;  2YO2 A;  2PY8 A;  3L72 E;  1HY8 A;  3KDP B;  5DJT B;  1S5L X;  1L4A C;  3L4F A;  3FWN A;  1GK6 A;  1X9V A;  1AQT A;  3WMM 0;  4U0B A;  3G1G A;  1LTB C;  3G0V A;  4XFX A;  3CWB J;  1NTM G;  2ZT9 D;  1JNM A;  2GDW A;  2Q9I A;  1PPJ E;  2MR7 A;  2P67 A;  2FY8 A;  1RF1 A;  3L73 J;  3Q5R A;  2N98 A;  3P32 A;  4H0L B;  1LTJ C;  2NPS D;  1WRG A;  5B5E E;  1PEU A;  2K0D X;  1NTZ G;  3LW5 J;  1VQK P;  1JTH B;  1LWU C;  5KLI C;  2FYU G;  2YXQ B;  1BCC D;  1PP9 J;  4EI2 A;  5F2O A;  3DS2 A;  2OGU A;  1VF5 D;  1AV1 A;  3CE7 A;  3R4Y A;  5C39 A;  1YHQ P;  1D7M A;  1VQP P;  1IFM A;  3IF4 A;  1KIL A;  1NTK G;  2W90 A;  2QJP C;  1BCC E;  1T3J A;  2CGQ A;  1ZME C;  1EZV I;  3RL0 D;  4H13 B;  4PV1 D;  2QIW A;  3AEE C;  1EMV A;  2N1T A;  3BCC D;  2NRG A;  3I5C A;  4N3Y B;  3I56 P;  3L71 J;  2LIU A;  4W80 A;  2ZXE B;  2AEF A;  4WWI A;  1PGO A;  1OVR A;  1USD A;  2HOD B;  4F37 A;  1JM0 A;  1YBK A;  3L75 G;  3H1H G;  1N73 B;  2BCC D;  3L70 J;  2LOL A;  2GZG A;  1BSN A;  1N7L A;  2KG8 A;  3EFG A;  3ZDM A;  1JB0 J;  3HD7 A;  3KZI E;  2E42 A;  2CQ8 A;  3P8C E;  4UB6 H;  1T8Z A;  1BGY D;  4WB4 A;  1GU4 A;  1PEO A;  2BCC E;  1J2J B;  1A02 F;  4GKG A;  1CW5 A;  2C0W A;  3L74 G;  2D2C B;  5CCG A;  1NKZ B;  1IMQ A;  2HLO A;  2H43 A;  1E0H A;  1N2D C;  4COP A;  2N9B A;  4RES B;  1EIA A;  4LC1 A;  5BS2 A;  2VLP A;  4IL6 X;  3G3Z A;  3M9B A;  5GTI E;  5CCH D;  3AEF C;  2P10 A;  4I7Z B;  2YNY A;  2E74 B;  4YPC A;  1EQ7 A;  3CXC O;  4H44 B;  1JTH A;  1S1C X;  3H25 A;  2K9Y A;  2XXM A;  5HGM A;  1XTG B;  1YTZ T;  1OW6 A;  1T2K D;  2KGA A;  3II6 A;  3K5B A;  1KYO D;  2OQQ A;  3CCR P;  1Q86 Q;  2BHV A;  3N4X A;  1JMB A;  4JPZ B;  2HFE D;  3D6Y A;  1NU1 E;  3BRV B;  2XZ1 C;  3TF5 A;  4U3F J;  1R5L A;  1VKU A;  1BDD A;  2P7J A;  2ZVO B;  5KJ7 C;  4HJG H;  5KTB A;  2WPV B;  1IO4 A;  2G3A A;  1GD2 E;  5AVV B;  2ZAE B;  3M9Q A;  1J1D B;  2E76 D;  3O8Z A;  3GLM A;  3TNU B;  1YJW P;  2HOD A;  4WBA A;  3H1K E;  4U0F A;  2Q3E A;  1N73 A;  1RE4 C;  5H2F H;  1FC2 C;  3GJN A;  1U7J A;  2KOS A;  2KSE A;  2E75 C;  2POH A;  2FAE A;  2RMZ A;  2AEJ A;  4OGQ C;  1EOQ A;  4UHP B;  4JYC A;  3P8M C;  2H88 C;  2OTL P;  2GZJ A;  1W2E A;  2BQ1 E;  3GHG C;  3NTE A;  1IUQ A;  3H32 A;  1S72 P;  3VP8 A;  4H13 D;  2LKI A;  1S5L E;  4B86 A;  3CWB G;  1DD4 A;  1L0H A;  3SWK A;  4QNB A;  3L73 G;  4NPE A;  3M0D C;  1QRJ A;  5APY A;  1S4X A;  1CSB A;  1GL2 B;  4DJG A;  3H1L J;  3V5B A;  5KAF H;  2RH0 A;  1DNY A;  2Y0E A;  2P1J A;  2V7Q J;  3HE5 B;  5E79 H;  2K93 A;  1DD3 A;  4WY4 A;  4U0A A; 
#chains in the Genus database with same CATH homology
 2PEN A;  3H47 A;  5BS1 A;  2E1M A;  3WBH A;  3G21 A;  1JJ2 O;  3CCU P;  2BUO A;  5F2O A;  2XXM A;  5HGM A;  3DS0 A;  2EG5 A;  3DS2 A;  3CC2 P;  3E2D A;  4COC A;  5DCK A;  1PEM A;  3DS1 A;  3G4S P;  4XRO A;  1M6E X;  1QVG O;  3CCQ P;  1YHQ P;  2Z44 A;  3CCR P;  1VQP P;  4GR6 A;  2BHV A;  3G26 A;  1Q86 Q;  1KQS O;  1VQ6 P;  1A8O A;  2M8L A;  3DS5 A;  2OTJ P;  2JO0 A;  2KOD A;  1W2B O;  1RNI A;  1K8A Q;  3CPW O;  2XT1 A;  4U0C A;  1M90 Q;  1QVF O;  1VQ8 P;  3HZQ A;  3Q20 A;  4XFY A;  1KD1 Q;  3CCM P;  1E6J P;  3VRL C;  3G6E P;  3G71 P;  1K30 A;  4U0E A;  3I56 P;  3I55 P;  3DPH A;  2P9X A;  3CCL P;  2M8P A;  4IPY A;  1K73 Q;  4M0I A;  2OAR A;  2PEJ A;  1YIT P;  2XV6 A;  4WYM A;  3LRY A;  1NJI Q;  1YJN P;  1Q7Y Q;  2DGY A;  3CCJ P;  1YJW P;  4U0D A;  1A43 A;  2LF4 A;  3P05 A;  4U0F A;  2EIA A;  3G1I A;  3HYB A;  1VQO P;  1KC8 Q;  4PH1 A;  3CC7 P;  1M6N A;  1D1D A;  5I4T G;  2ONT A;  1VQ5 P;  3CD6 P;  3DS3 A;  1BAJ A;  1K9M Q;  1VQ9 P;  1M74 A;  3CCV P;  2JYG A;  1N8R Q;  4XRQ A;  2PEO A;  2PY8 A;  5HGO A;  1RO0 A;  1EOQ A;  2EFJ A;  5JPA A;  1VQN P;  3M1M A;  2OTL P;  3MGE A;  2JYL A;  4PH0 A;  1PEO A;  5F2N A;  5F2K A;  1RO2 A;  3B5I A;  4U0B A;  2BQ1 E;  3G1G A;  1Q81 Q;  3NTE A;  1IUQ A;  3G28 A;  1M1K Q;  1VQM P;  1S72 P;  2QEX P;  3DTJ A;  2Z46 A;  3DS4 A;  2PEI A;  2CWO A;  3G0V A;  1YI2 P;  4XFX A;  3CC4 P;  2M8N A;  1VQ7 P;  4QNB A;  1VQ4 P;  3G29 A;  4COP A;  5HGL A;  1YIJ P;  1EIA A;  3CME P;  1QRJ A;  2L6E A;  2PEQ A;  3CMA P;  5BS2 A;  3H0D A;  2QA4 P;  4GR2 A;  1PEQ A;  1VQL P;  1AUM A;  3CCE P;  3RG6 C;  1YJ9 P;  1ZMB A;  3H4E A;  2PEM A;  2Z45 A;  1PEU A;  3OW2 O;  5HGN A;  1VQK P;  4XFZ A;  3CCS P;  2PEK A;  4U0A A;  3CXC O;  1Q82 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...