1VQMP

The structure of the transition state analogue "dan" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
total genus 46
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1vqmP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1vqmP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1vqmP02
3CCVP 1KC8Q 3CMEP 3I56P 1KD1Q 2OTJP 3CCJP 1JJ2O 1N8RQ 3CCRP 1S72P 1VQKP 2OTLP 1VQPP 3CC7P 1Q7YQ 1VQMP 3G6EP 1QVGO 1YJ9P 3CCEP 1K9MQ 1QVFO 1YJNP 3CXCO 1VQOP 3CCLP 1K73Q 1M90Q 2QEXP 3CPWO 1VQ5P 1W2BO 1VQLP 1YIJP 3CCQP 1VQ7P 1VQNP 3G4SP 1YI2P 3CCUP 1VQ9P 1KQSO 3CCSP 1Q82Q 1VQ4P 1VQ8P 1YJWP 3CC2P 3CC4P 1Q86Q 3G71P 3OW2O 1Q81Q 3CMAP 1YHQP 1YITP 1NJIQ 1K8AQ 1VQ6P 3CD6P 3I55P 1M1KQ 3CCMP 2QA4P
chains in the Genus database with same CATH superfamily
5CJ4A 1R8EA 2WVRA 1JM0A 1ZMBA 4H13B 1MKMA 2GUSA 4BPGA 3MP7B 1KILB 1GU5A 3WMM0 2M3BA 3L74D 3KXDA 3P8CD 1IK7A 1HGZA 3AEBC 2A45H 1Z56A 2LKMA 1S9KE 4YPCA 3GF3A 3BCCG 2G3AA 1EZVG 1FC2C 2G8YA 1KYOE 4QKOA 5KP8B 2QJKB 2GZGA 4RKUJ 1GPJA 4NEOA 4DT0A 4GR6A 2IYPA 1BE3G 1GXGA 2D2CD 1NWQA 1BCCG 3L74E 2XZRA 3P8CE 3DPHA 1HJBA 2O3JA 3L72D 1SQVG 3WUVA 2MR7A 4GIFA 1SQBG 4D6TD 3RGUA 5KKZB 1JNMA 3CC2P 2AFEA 1YTZI 3M9BA 2MR8A 3CXHH 5HGLA 2LOLA 1JMBA 3CE7A 1N8RQ 2E5YA 4U0CA 2PEJA 3RL0D 5EJDA 4PJ0H 2KLVA 2R44A 1J1EB 3H4EA 3USSA 3VMZA 2ZXXA 4NPEA 2N9BA 1H8AA 1NTKG 4M3LA 1NKZB 3K5BA 1N86A 2J5UA 1N2DC 2NO8A 1XTGB 3ZDMA 2Y0DA 3L71J 1USEA 2XV5A 1QVFO 3AE2C 1RF1C 2HR3A 3BVHA 4ASVA 1JY3O 3GG2A 1T3UA 4XE5B 2GM4A 1Y9BA 2PNGA 2I1JA 2XV6A 1M1JA 5AW3B 4XFXA 2PGDA 4UB6H 5M1BA 4COCA 4PXHB 5CMZA 5TISH 1Y8AA 3E1IA 3EWKA 3FXEA 3LW5H 2OARA 1YJNP 1KB9E 5BS1A 3KPEA 2JDIH 1ZRTD 2MY5A 3M9QA 2M8LA 1NTZJ 2KZJA 5KLVK 1BSHA 1X79B 2EHTA 2V7QH 2GDYA 2Y0EA 2CPSA 1IFMA 1GK6A 4MRTC 2P7JA 1HVVA 2VSQA 1NTMJ 1SP4A 1M1JB 1VQ9P 2ZFCA 1T2KD 1DD3A 2E43A 5AW9B 3VMXA 1X8YA 3H47A 4WBAA 1ZRTE 1DX7A 1GL2D 2A45I 1NU1K 1L0LG 3GHGA 3WUUA 4N6JA 1QL2A 2N6YA 1AA0A 1PGPA 1SQQG 3RK3B 2Q3IA 1VQ4P 2FYUJ 3H1KG 3L75J 3H1JD 2WMMA 1Q90D 4U0BA 1FR2A 3II6A 3AEDC 4IFMA 4PV1B 5B66H 2DNWA 1S1CX 1EC5A 1GZLA 2WITA 2ZXEB 4HJGH 3L70J 4GOFA 3G4SP 3HD7A 4K3AA 1MV8A 4BWNA 5KLIC 5JPAA 3MUDC 1SQPG 4L75A 4TLFA 3LIDA 3TGUJ 5APTA 3M0AA 3MIWA 3CXHI 3H1JE 1OXZA 1VQPP 3N4XA 2OYOA 3BCCJ 3R2PA 2X2BA 1QEXA 4HB1A 3H1LE 3A0HH 2P9XA 3L37A 1PP9D 2Z45A 4ZMDA 1JY3P 2K88A 2KUBA 1KV4A 1JY3N 3CX5H 4IZ6A 1JY2O 1BE3J 5EFWB 1M8OB 4ZNCA 2QM8A 1BCCJ 1HF9A 3CXCO 2JYLA 4H0LD 3HD7B 2KLUA 4COPA 1SFCB 2Q1KA 3AE8C 1PEMA 2QNWA 1MUUA 4CPGA 2FFDC 1EDIA 2BCCG 1PP9E 2GYKA 2O1JA 2XNDH 1HTLC 4U3FD 2PFXA 1T3JA 1LWUC 1VQNP 3L74J 5AW8B 1P84H 2E75D 2RN0A 3D6ZA 3G29A 1Y47A 1YBKA 2K1AA 3CWBG 2AF8A 1FZCB 1LT9C 3NY7B 3E1RA 1VDFA 4BPHA 3L73D 1SQVK 2BUOA 2PEIA 1SQBK 2GDWA 2FHSC 1NJIQ 4L73A 4RJTA 1VHNA 3H1ID 1UIIA 1H88A 3RBXA 1KZUB 3L72J 5AVZB 1JCDA 4JBZA 1L4AB 4H44B 1FZGA 5HVCA 2RKLA 1L0NG 1NYHA 3RK2C 1RF1A 4D6TJ 2V7QJ 2UWJE 3AEAC 3JCUE 1NQ4A 3U1AA 1Q81Q 3WBHA 5KLVD 2FQ2A 1JCCA 1NTKK 1OW8A 4OVNF 1HBWA 3VP9A 2E74D 1IFIA 4IPYA 1KILD 2A06D 4WY4C 1OZHA 2KOOA 1URQC 2LKIA 1N7SC 1NU1D 1QVGO 1JY2P 1L0LJ 5KLVE 4H2YC 4OGQC 3M0DC 1S5LH 1JY2N 1OVRA 2FXOA 1T6AA 2W6BA 3C8VA 2IBZD 3H1IG 2ZYAA 1J1DB 1RE3C 2FKWB 1WT6A 2GZIA 5CCGC 2C9NY 1SS1A 3G21A 3CX5I 3GW6A 1JTHA 1YQ4C 1AQTA 5H2FH 2FYZA 1KQSO 4LLHA 1NU1E 1LNQA 1CSBA 1R5LA 4U0FA 2YKOA 3RK2D 1T8ZA 2JP3A 5APVA 4BXLA 2CQ8A 2O1KA 1RHZB 2MJZA 1FBMA 1PGQA 4U0DA 3A7OA 1PPJG 1SQQK 2M8NA 3FWNA 1AUMA 2R32A 4R0MA 2ZYDA 1G1IA 1AQ5A 3MUDA 1EDLA 5TJHA 5F2NA 3FWLA 5I4TG 3KDPB 3G1IA 3O8ZA 2KSEA 3AEGC 2OGUA 1K9MQ 1GU4A 2M5AA 5B5EH 2VLOA 3H1JJ 2AVAA 4OGQD 2JU2A 5BVZA 3E2DA 3CPWO 1SQPK 1ZP0C 2M5RA 2FYUE 3L75E 5CCGD 2N1TC 1IUQA 2FQ0A 2K94A 3BCCD 2N5HA 1EZVD 5HGNA 3SFDC 3E7KA 2XZ0D 2KGAA 2ZJSE 3U59A 3D71A 3I55P 1M1KQ 2WSFH 2C0WA 2LXBA 2YO3A 1L2PA 2FFDA 2KOPA 4EDFA 3L70E 5AVRB 3HTKA 1OMIA 3EQ2A 2NZ2A 5AVXB 1BCCD 5CCHD 5CZDB 2QE7H 3OA7A 3OAKA 1LWUA 1HH0A 4XFZA 5AVVB 1SQVD 2FYNC 4C7NA 2ZT9D 1SQBD 1EXJA 4IOIH 3BCCE 5EW5E 2O01J 4BRYA 1NH4A 3I5CA 1LT9A 1FS0E 1ZLLA 3RL0C 2L4BA 2WPVB 4R4MA 2FXPA 3B8EB 2I8DA 1H0TA 1CI6A 1BE3E 3O6QB 3PTZA 3B5NC 3FX0A 1JB0J 1BCCE 4KT0J 1YITP 3IAOA 3HTKB 3VTPC 2FQ1A 5F2KA 3CXHE 2OQQA 4WVZA 4U3FJ 1NTKD 2L9FA 2H7HA 2KB7P 1L0HA 1OFCX 2E76C 4PJ0E 1ZW0A 4C7NB 3FXDA 3B71A 2N1TD 2LMLA 1VF5D 1FZEA 1LT9B 1GW3A 2B87A 2K5XA 2Y9YA 2K2QA 1GTWA 4DJGA 2OTJP 3CLQA 1DNYA 2N5IA 1H0TB 4UB8H 1ACPA 2M0BA 2C9LY 3AECC 3L73J 1NVOA 2K3RA 1L0NK 3LMOA 3Q5PA 1E0HA 1SQXK 1NAFA 4WWIA 4W7ZA 5E79H 1HWTC 3V6IA 4WY4A 3H1IJ 3DS3A 2JO1A 4UB6E 1URQA 2QJPC 1N7SA 4H2XC 5TISE 2CK3H 2HYNA 3VMYA 1LP1A 1T2KC 1M90Q 1YIJP 4YXWH 3M0DA 2L5GB 2XKMA 2NPSC 2FACA 2MVVA 1HJ0A 2B87B 1GL2C 1M7LA 2KXPB 3L72E 5KLVJ 2YXRB 1RE3A 1SFCD 5CCGA 4D6TE 2W6AA 3B5ND 3PH0A 1FJKA 2KG8A 2AFDA 2IBZI 1RY3A 1K73Q 1L0LD 1OWAA 2LTEA 1RE4C 2L0QA 1SQQD 1EDKA 4PH1A 2E1MA 2E76D 2QM7A 3RL0g 2KG6A 1EXIA 4WB4A 5AW7B 1N7SB 3H1KD 2IZ1A 1NU1J 3SSUA 1LP1B 3QH9A 1HQBA 4DG9A 1OR5A 2KIKA 2PRRA 2VRSA 3SWYA 1PFIA 1L0LE 3BATA 1ZV8A 1SQPD 5KJ7D 3V2PA 2KWLA 3AE3C 5B66E 3HUSC 2WSEH 2L6EA 1FZFA 3H1KE 4DCKA 2WSCH 2OYIC 2WSFJ 4H44D 1PGJA 2N9YB 1DEEG 1R5SA 1G2CA 3CX5D 5BS2A 3ABVC 1W2EA 2NPSD 1VKUA 4H0LC 2K92A 2JKVA 1SVFA 3H32A 1FOSE 2KOQA 2MF4A 1VQMP 4PD4D 2N1TA 1M74A 5CJ0A 1LTTC 2JJLA 5CBOA 4Y99B 3G71P 3OW2O 2C0XA 2PEKA 2QJYB 3C9IA 3HZQA 2I1KA 3AE4C 1EZVI 5KAFH 4RESB 4GT1A 3CX5E 3VN0A 3AE5C 3SFEC 3TDKA 3HE4A 2WPTA 2E75C 1P84D 2FY8A 5DJUB 2BCCD 1ZN5A 2W6JH 1QRJA 3GZLA 1G2CB 2JAZA 2Q5UA 2KOSA 1IMQA 2IDBA 3V4QA 3DS1A 5C39A 1AF8A 3G26A 3GHGB 3AE7C 1CW5A 1AVOA 3CWBD 1HY8A 2R5DA 3TNUA 1IK9A 2IYOA 3CCEP 1MZ8A 2XZ1C 2MKVA 3SWKA 1A02J 1FE6A 2BEZF 2D2CB 3KZIH 3AEEC 2EG5A 2YIUC 3D6YA 2XXMA 2KG9A 4JYCA 3AE9C 1GMJA 3B5NA 4IL6H 4PH0A 4XA4A 1OW7A 2JYGA 4C7RA 3WU2H 3NFQA 4R4LA 1N7LA 1USDA 2L22A 4PD4H 4I7ZB 1SQVJ 2MD9A 1M56D 1IFDA 1L0ND 1UJZA 1SQBJ 1PL5A 1N73C 2KZIA 1BXIA 3RL0B 4UHPB 4YTPC 2P58A 2R5BA 2W27A 1CEIA 2XNXA 1FZAA 1PEUA 2E74C 4H13C 1EDJA 5GTIH 1KILC 3H1LG 1ZXGA 1BDDA 3DTJA 4NPDA 1IC2A 1FDMA 5AW6B 4Z1MH 5APQA 1NTKJ 3NMDA 1KFMA 1ZMEC 2R3CA 7CEIA 2P1JA 2PAJA 2E5TA 2NPSA 1YI2P 5KAIH 1ZR4A 3G9RA 4U3FE 1GL2A 1FDIA 1KTMA 4C46A 3LW5J 4L76A 3CCMP 2H8PD 5APSA 3EJEA 2W8ZA 1CZQA 2YKPA 3KHUA 1QL1A 2FBWC 1AYIA 1KN7A 1SQXG 1F80D 2Y9ZA 1RE4A 2WQYC 1S5LE 3V4WA 3NTNA 2AEJA 1LJ2A 3A0BH 4TT3H 3CMAP 1H89A 1AVYA 4U0AA 3L73E 4EYYQ 4ZKPA 1ZR2A 2N6ZA 2QJPB 2WSEJ 5KP6B 4GOEA 1JJ2O 2WSCJ 1FJPA 2VLNA 2B9BA 3H1IE 1GL2B 4I6MC 1GD2E 4H13D 5H2FE 1PPJD 3NTEA 1E79H 1S72P 2QIWA 2LF4A 3IN6A 5BU8B 1WMKA 1RF1B 3HUSA 2RH0A 1HUCA 3A3YB 2BEQD 4EOTA 1SQQJ 5AVSB 1NOHA 3HE5A 4HYTB 2OYIA 3DS2A 3M9HA 2OTKE 2Z44A 2CGQA 4RO0A 3H1KJ 1EQ7A 2K0DX 3H25A 2WPRA 3TF5A 3H1HD 2XU6A 1KILE 2A06E 4DZOA 1VQ5P 2JGPA 2YXQB 1YJWP 5B5EE 1YHQP 4KHXA 4PD4I 4M0IA 2JQ4A 4L74A 1YTZT 3M91A 2O01N 1KC8Q 1SQPJ 5CCHC 1OX3A 1GXHA 3HUSB 2IBZE 1RQVA 1VQOP 4N78D 2QEXP 2AEFA 3HE5B 2OYIB 1AJYA 2ZT9C 2BASA 4U7JA 1PIXA 3CCUP 1EMVA 2P2UA 2ZAEB 3L71G 4H0LB 1P84I 5AVYB 3CCJP 3MGEA 1RQUA 1JTHB 2JU1A 4JYBA 3RK3C 2KS1A 1KLPA 2AXCA 3AE6C 3H1HG 1T8KA 3GZMA 2Q9IA 4PV1C 1UIXA 2IFNA 2E75B 3G6EP 1NTZG 1KQLA 2BCCJ 3RG6C 2WWWA 4DOJA 5DJTB 1VF5C 5KLIB 1OVVA 2QG4A 2YMYA 2JO0A 1U57A 3B5IA 5DCKA 1D7MA 2KW2A 1N73A 1ZNVA 3CWBJ 2IZ0A 1NTMG 4A7PA 2ITAA 3Q5SA 2M5AB 5L8RJ 1KQFB 2B88A 3HRNA 1UNKA 3M06A 1KILA 1SLQA 1A43A 4XROA 2AXTH 1AFOA 1EZVE 2KOGA 1KD1Q 3ITKA 2QVAA 1MZ9A 5AVUB 3M1MA 2KNCA 3VRLC 1RH5B 2AEMA 2OYHC 3L75G 4UB8E 4H2WC 3G0VA 2FVEA 1SFCC 3V2NA 1L0NJ 3RK3D 2H88C 3S4RA 1SQXJ 3C1LA 2FFDB 2KYVA 5E79E 2A45G 1SQVE 1KQGB 2KGEA 3L70G 2E74B 1GW4A 1SQBE 2LIUA 2Z5IA 2PEMA 1LWUB 4N3YB 4PV1D 3T97A 1MFTA 1X3OA 5GTHH 3TGUG 2M3EA 1U7MA 3R4YA 3G3ZA 2WT7A 1BGYG 4BRYB 2DW3A 1VQKP 2JWDA 1FZCC 2KNCB 2Q6QA 3RK3E 3BASA 2M8RA 1QGKB 3CCLP 4EIJA 1CI6B 3TK1A 2WTYA 3A2AA 1NTKE 2Y0CA 4ASWA 2FAEA 2WZ7A 4Y28J 5KJ7C 3VOPA 3MD0A 3CCVP 1WRGA 1L4AC 3RK2B 4H44C 3T97B 3V2RA 2K37A 1YQ3C 1RO0A 2POHA 3BRVB 2WT7B 1LTGC 2GDXA 4I2LC 3HD7D 3L4FA 4QMAA 1OIPA 1S4XA 1BAJA 4JF7A 1IJDB 2K0XA 1KYOH 2H89C 4IFDK 1IO4A 3L74G 1A8OA 2W90A 3U43A 4HH2A 2KODA 4JQ0D 4BPFA 5AW4B 1E6JP 3D70A 2ZVNB 2YO2A 1LTSC 1QX8A 4XFJA 4WY4B 3VYIA 3GKLC 1KB9D 1YYCA 2J59M 1K05A 4GDOA 1URQB 1G1JA 5CCHA 3OJAB 5APYA 1AV1A 4OGQB 3EJBA 2KR5A 1NHLA 1KORA 5HV8A 4JPZB 4WYMA 3DS0A 3SWFA 1J1DC 3L72G 5K5GB 3VP8A 1SQQE 2WPQA 3H1HJ 4D6TG 5KAFE 2KI7B 3IF4A 3MTUE 3P32A 2YKQA 1IFJA 3CCQP 3NXSA 2PEOA 2J58A 1OW6A 1L4AD 2PY8A 3IFMA 5HGMA 3MHVA 1VQ6P 1L0IA 2PENA 3CL3D 1LTIC 1DIPA 1FDOA 1RO2A 1HGVA 2Z46A 3P7KA 2P10A 1J2JB 4OH8B 2DGYA 3TSIA 2ZT9B 1W2BO 3MZWB 1RF0C 1NO4A 1SQPE 4O9BA 3PLNA 2CPBA 2EIAA 3AEFC 3A0HE 3KZIE 3S1KA 1K8AQ 2ROQA 4LC1A 1OVUA 3P05A 1KB9H 4IL6E 1VPCA 3CCRP 1XTCC 3GLMA 1YJ9P 2QRXA 3PHLA 4OWFA 1NTZK 2P67A 2PEQA 1VQLP 3G28A 2EHSA 1IFPA 3WU2E 2YMKA 3KQGA 4PD4E 2FXMA 1PEOA 4YXDC 2IPPA 1FU1A 3H1LD 3FGAD 3H32B 4IL6X 3EJDA 3DS4A 2N1TB 2OYHA 1NTMK 1LTJC 1DD4A 1VF5B 1W5CE 2CG5B 2L91A 3PP5A 3VMAA 1SFCA 5GTIE 4XRQA 2ONTA 3B4QA 1GDTA 1P84E 2BCCE 2JWAA 1S3JA 5CBNA 1BGYJ 2KGCA 4KJMA 3DS5A 3HE4B 2GZFA 1KYOI 3H6PA 1JOCA 5APUA 2FYUK 2JEEA 2FYNB 3V5BA 3CWBE 2NRGA 3GF7A 1NKNA 2BQ1E 1M6NA 5KAIE 1PEQA 1SQXD 3TNUB 1FZCA 1GK4A 5APXA 2OYHB 2KSJA 4K35A 4B86A 1K30A 4EI2A 3H1JG 2K93A 1VQ7P 3WUTA 3Q5RA 2FADA 2W83C 2ERHA 3N7NA 3B5NB 5AVTB 1Q86Q 2WPSA 2V4HA 5KJ7A 1BSNA 2LL8A 2JB0A 3A0BE 1NGMB 2GUVA 4NPFX 1L0NE 2HODA 2E76B 1L4AA 1SQXE 3IR9A 3CI9A 2QJKC 2IFMA 3EFFK 3CCSP 1KMIZ 2PP6A 1DV5A 3RBZA 2ZVOB 3MGNA 5APWA 2IX7C 2KORA 2XDJA 1A02F 4QNBA 2LIWA 5AVQB 1PP9G 2CNRA 4MN4C 1LTAC 3Q2YA 1X22A 1FZBA 2K9JA 2LR2A 5KKZC 3AE1C 2HPCA 2KK7A 1S2EA 3S9OA 2HODB 2EFJA 4AUWA 2O01H 2KGDA 1KB9I 1IMPA 2NPSB 5BU5A 5KP7B 1U7JA 1J1EC 1EIAA 1KFNA 1S5LX 1LGHB 1VQ8P 5F2OA 2QSIA 4U3FG 3BRTB 2M8PA 4U0EA 2SPZA 3GMAA 3CC7P 3L71D 1JEKA 1M6EX 3Q3DA 1RNIA 3HYBA 1JMMA 4AQRD 3F5HA 2K9JB 4IFFA 2HPCB 3LRYA 2VLPA 3CD6P 3H0DA 1EOQA 3L73G 2GZJA 2Q7CA 2JBGA 4CA3A 2B89A 2R3SA 2CWOA 2LXCB 1PPJE 4GODA 5CHXA 4AYCA 3JCUH 2N98A 4W80A 1RF0A 1NTZD 3L71E 1BDCA 3GJNA 2LPKA 1IFNA 4I1LA 2HLOA 2XT1A 2WSSH 3UIAA 4PWVB 2OTLP 2HFED 4HKZH 1M57D 3W68A 1NTMD 4GKGA 3RG2A 4HKGA 5KLVG 2E42A 1Q82Q 3H1HE 1M1JC 1NAYA 3L36A 1ZOYC 5AW5B 3KYQA 2VLQA 4ZKUA 2QA4P 3CMEP 3I56P 1NTZE 1X9VA 2N50A 1L0LK 2K9YA 1K04A 1DEBA 1LTBC 3LIEA 5AVWB 2Z4EA 3P8MC 1LTJA 2ZYGA 3PJSK 2A06G 2FVAA 3W67A 2FYUD 3CC4P 3L75D 1Z6MA 4Y99C 1NU1G 2Q3EA 4N78E 1NTME 2BHVA 2QJYC 2AXTE 1LT1A 3Q20A 4WY4D 1Q7YQ 2K0YA 3B4SA 3F89A 1URQD 2IBZG 2Z5HA 1N7SD 1JO5A 3Q1MA 1Q2NA 3L70D 4W7YA 2FVFA 1TU3F 1PGOA 3QWOC 3TGUD 2HG5D 3H1LJ 5HGOA 3JSVC 3GHGC 4F37A 3JC22 2KP8A 5AW1B 1BGYD 4XFYA 1LTJB 3L35A 1FOSF 1MFZA 1FAVA 1E5WA 2KS1B 2YIUB 2D2CC 3U1CA 2GA1A 3G1GA 1JUNA 1QLED 5AW2B 4GR2A 2JR8A 1VL2A 5GTHE 3O6QA 2GZEA 1D1DA 1DH3A 2RMZA 1X0TA 5AW0B 4LGDE 1IZNB 3PRJA 1BE3D 2H43A 1PZQA 3TGUE 2FYUG 3HD7C 1S9KD 1PP9J 3CXHD 1BGYE 2YNYA 4I7ZC 3EFGA 1PV3A 1N73B 1KYOD 3V2QA 2MVUA 3A5TA 5KTBA 3TYYA
chains in the Genus database with same CATH topology
3DS3A 3CMEP 3I56P 3NTEA 2EFJA 1S72P 2LF4A 3G21A 3DS5A 1VQMP 3G6EP 1ZMBA 1QVFO 3CCLP 1PEUA 1M90Q 1M74A 3RG6C 1YIJP 3CCQP 2BUOA 3G4SP 2PEOA 4XFZA 2PEIA 1EIAA 1KQSO 1VQ8P 3DS2A 2PY8A 5F2OA 5JPAA 3CC4P 2JO0A 4U0FA 2XV6A 3G71P 3B5IA 3OW2O 5HGMA 1M6NA 5DCKA 4XFXA 1NJIQ 3DTJA 1VQ6P 2Z44A 1PEQA 2PENA 4COCA 2PEKA 2M8PA 3HZQA 4U0EA 1RO2A 3CCVP 2BHVA 2Z46A 3Q20A 1VQPP 3CC7P 1K30A 1Q7YQ 2OARA 2DGYA 1YJNP 5BS1A 1K73Q 1M6EX 1RNIA 3HYBA 4U0DA 1VQ5P 1W2BO 1VQ7P 1QRJA 2M8NA 1RO0A 2M8LA 1AUMA 2P9XA 1YI2P 1A43A 2Z45A 4PH1A 4XROA 1YJWP 2E1MA 1Q86Q 2EIAA 1Q81Q 3LRYA 4GR6A 1YHQP 3WBHA 1YITP 3DS1A 1K8AQ 4M0IA 5F2NA 3CD6P 3G26A 3CCMP 5HGOA 5I4TG 3H0DA 3G1IA 1EOQA 5F2KA 1KC8Q 1KD1Q 1BAJA 3P05A 3DPHA 3CCRP 4XFYA 3M1MA 3VRLC 2CWOA 1YJ9P 1A8OA 1K9MQ 3CCEP 3CXCO 2JYLA 1VQOP 2KODA 2QEXP 1E6JP 2PEQA 3G28A 1VQLP 4COPA 3G0VA 3CCUP 1VQ9P 2EG5A 3CCSP 4IPYA 3G1GA 2XXMA 3CC2P 4GR2A 1PEMA 3CMAP 1PEOA 3H47A 4U0AA 1D1DA 5HGLA 4PH0A 3E2DA 3CPWO 2XT1A 2OTJP 3CCJP 1JJ2O 4QNBA 1N8RQ 2OTLP 2JYGA 3MGEA 4U0CA 1QVGO 3DS4A 2PEJA 1IUQA 2PEMA 2L6EA 5HGNA 3H4EA 1VQNP 2BQ1E 1Q82Q 1VQ4P 3G29A 4XRQA 4WYMA 2ONTA 5BS2A 4U0BA 3DS0A 3I55P 1M1KQ 1VQKP 2QA4P
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCV P;  1KC8 Q;  3CME P;  3I56 P;  1KD1 Q;  2OTJ P;  3CCJ P;  1JJ2 O;  1N8R Q;  3CCR P;  1S72 P;  1VQK P;  2OTL P;  1VQP P;  3CC7 P;  1Q7Y Q;  1VQM P;  3G6E P;  1QVG O;  1YJ9 P;  3CCE P;  1K9M Q;  1QVF O;  1YJN P;  3CXC O;  1VQO P;  3CCL P;  1K73 Q;  1M90 Q;  2QEX P;  3CPW O;  1VQ5 P;  1W2B O;  1VQL P;  1YIJ P;  3CCQ P;  1VQ7 P;  1VQN P;  3G4S P;  1YI2 P;  3CCU P;  1VQ9 P;  1KQS O;  3CCS P;  1Q82 Q;  1VQ4 P;  1VQ8 P;  1YJW P;  3CC2 P;  3CC4 P;  1Q86 Q;  3G71 P;  3OW2 O;  1Q81 Q;  3CMA P;  1YHQ P;  1YIT P;  1NJI Q;  1K8A Q;  1VQ6 P;  3CD6 P;  3I55 P;  1M1K Q;  3CCM P;  2QA4 P; 
#chains in the Genus database with same CATH topology
 5CJ4 A;  1R8E A;  2WVR A;  1JM0 A;  1ZMB A;  4H13 B;  1MKM A;  2GUS A;  4BPG A;  3MP7 B;  1KIL B;  1GU5 A;  3WMM 0;  2M3B A;  3L74 D;  3KXD A;  3P8C D;  1IK7 A;  1HGZ A;  3AEB C;  2A45 H;  1Z56 A;  2LKM A;  1S9K E;  4YPC A;  3GF3 A;  3BCC G;  2G3A A;  1EZV G;  1FC2 C;  2G8Y A;  1KYO E;  4QKO A;  5KP8 B;  2QJK B;  2GZG A;  4RKU J;  1GPJ A;  4NEO A;  4DT0 A;  4GR6 A;  2IYP A;  1BE3 G;  1GXG A;  2D2C D;  1NWQ A;  1BCC G;  3L74 E;  2XZR A;  3P8C E;  3DPH A;  1HJB A;  2O3J A;  3L72 D;  1SQV G;  3WUV A;  2MR7 A;  4GIF A;  1SQB G;  4D6T D;  3RGU A;  5KKZ B;  1JNM A;  3CC2 P;  2AFE A;  1YTZ I;  3M9B A;  2MR8 A;  3CXH H;  5HGL A;  2LOL A;  1JMB A;  3CE7 A;  1N8R Q;  2E5Y A;  4U0C A;  2PEJ A;  3RL0 D;  5EJD A;  4PJ0 H;  2KLV A;  2R44 A;  1J1E B;  3H4E A;  3USS A;  3VMZ A;  2ZXX A;  4NPE A;  2N9B A;  1H8A A;  1NTK G;  4M3L A;  1NKZ B;  3K5B A;  1N86 A;  2J5U A;  1N2D C;  2NO8 A;  1XTG B;  3ZDM A;  2Y0D A;  3L71 J;  1USE A;  2XV5 A;  1QVF O;  3AE2 C;  1RF1 C;  2HR3 A;  3BVH A;  4ASV A;  1JY3 O;  3GG2 A;  1T3U A;  4XE5 B;  2GM4 A;  1Y9B A;  2PNG A;  2I1J A;  2XV6 A;  1M1J A;  5AW3 B;  4XFX A;  2PGD A;  4UB6 H;  5M1B A;  4COC A;  4PXH B;  5CMZ A;  5TIS H;  1Y8A A;  3E1I A;  3EWK A;  3FXE A;  3LW5 H;  2OAR A;  1YJN P;  1KB9 E;  5BS1 A;  3KPE A;  2JDI H;  1ZRT D;  2MY5 A;  3M9Q A;  2M8L A;  1NTZ J;  2KZJ A;  5KLV K;  1BSH A;  1X79 B;  2EHT A;  2V7Q H;  2GDY A;  2Y0E A;  2CPS A;  1IFM A;  1GK6 A;  4MRT C;  2P7J A;  1HVV A;  2VSQ A;  1NTM J;  1SP4 A;  1M1J B;  1VQ9 P;  2ZFC A;  1T2K D;  1DD3 A;  2E43 A;  5AW9 B;  3VMX A;  1X8Y A;  3H47 A;  4WBA A;  1ZRT E;  1DX7 A;  1GL2 D;  2A45 I;  1NU1 K;  1L0L G;  3GHG A;  3WUU A;  4N6J A;  1QL2 A;  2N6Y A;  1AA0 A;  1PGP A;  1SQQ G;  3RK3 B;  2Q3I A;  1VQ4 P;  2FYU J;  3H1K G;  3L75 J;  3H1J D;  2WMM A;  1Q90 D;  4U0B A;  1FR2 A;  3II6 A;  3AED C;  4IFM A;  4PV1 B;  5B66 H;  2DNW A;  1S1C X;  1EC5 A;  1GZL A;  2WIT A;  2ZXE B;  4HJG H;  3L70 J;  4GOF A;  3G4S P;  3HD7 A;  4K3A A;  1MV8 A;  4BWN A;  5KLI C;  5JPA A;  3MUD C;  1SQP G;  4L75 A;  4TLF A;  3LID A;  3TGU J;  5APT A;  3M0A A;  3MIW A;  3CXH I;  3H1J E;  1OXZ A;  1VQP P;  3N4X A;  2OYO A;  3BCC J;  3R2P A;  2X2B A;  1QEX A;  4HB1 A;  3H1L E;  3A0H H;  2P9X A;  3L37 A;  1PP9 D;  2Z45 A;  4ZMD A;  1JY3 P;  2K88 A;  2KUB A;  1KV4 A;  1JY3 N;  3CX5 H;  4IZ6 A;  1JY2 O;  1BE3 J;  5EFW B;  1M8O B;  4ZNC A;  2QM8 A;  1BCC J;  1HF9 A;  3CXC O;  2JYL A;  4H0L D;  3HD7 B;  2KLU A;  4COP A;  1SFC B;  2Q1K A;  3AE8 C;  1PEM A;  2QNW A;  1MUU A;  4CPG A;  2FFD C;  1EDI A;  2BCC G;  1PP9 E;  2GYK A;  2O1J A;  2XND H;  1HTL C;  4U3F D;  2PFX A;  1T3J A;  1LWU C;  1VQN P;  3L74 J;  5AW8 B;  1P84 H;  2E75 D;  2RN0 A;  3D6Z A;  3G29 A;  1Y47 A;  1YBK A;  2K1A A;  3CWB G;  2AF8 A;  1FZC B;  1LT9 C;  3NY7 B;  3E1R A;  1VDF A;  4BPH A;  3L73 D;  1SQV K;  2BUO A;  2PEI A;  1SQB K;  2GDW A;  2FHS C;  1NJI Q;  4L73 A;  4RJT A;  1VHN A;  3H1I D;  1UII A;  1H88 A;  3RBX A;  1KZU B;  3L72 J;  5AVZ B;  1JCD A;  4JBZ A;  1L4A B;  4H44 B;  1FZG A;  5HVC A;  2RKL A;  1L0N G;  1NYH A;  3RK2 C;  1RF1 A;  4D6T J;  2V7Q J;  2UWJ E;  3AEA C;  3JCU E;  1NQ4 A;  3U1A A;  1Q81 Q;  3WBH A;  5KLV D;  2FQ2 A;  1JCC A;  1NTK K;  1OW8 A;  4OVN F;  1HBW A;  3VP9 A;  2E74 D;  1IFI A;  4IPY A;  1KIL D;  2A06 D;  4WY4 C;  1OZH A;  2KOO A;  1URQ C;  2LKI A;  1N7S C;  1NU1 D;  1QVG O;  1JY2 P;  1L0L J;  5KLV E;  4H2Y C;  4OGQ C;  3M0D C;  1S5L H;  1JY2 N;  1OVR A;  2FXO A;  1T6A A;  2W6B A;  3C8V A;  2IBZ D;  3H1I G;  2ZYA A;  1J1D B;  1RE3 C;  2FKW B;  1WT6 A;  2GZI A;  5CCG C;  2C9N Y;  1SS1 A;  3G21 A;  3CX5 I;  3GW6 A;  1JTH A;  1YQ4 C;  1AQT A;  5H2F H;  2FYZ A;  1KQS O;  4LLH A;  1NU1 E;  1LNQ A;  1CSB A;  1R5L A;  4U0F A;  2YKO A;  3RK2 D;  1T8Z A;  2JP3 A;  5APV A;  4BXL A;  2CQ8 A;  2O1K A;  1RHZ B;  2MJZ A;  1FBM A;  1PGQ A;  4U0D A;  3A7O A;  1PPJ G;  1SQQ K;  2M8N A;  3FWN A;  1AUM A;  2R32 A;  4R0M A;  2ZYD A;  1G1I A;  1AQ5 A;  3MUD A;  1EDL A;  5TJH A;  5F2N A;  3FWL A;  5I4T G;  3KDP B;  3G1I A;  3O8Z A;  2KSE A;  3AEG C;  2OGU A;  1K9M Q;  1GU4 A;  2M5A A;  5B5E H;  2VLO A;  3H1J J;  2AVA A;  4OGQ D;  2JU2 A;  5BVZ A;  3E2D A;  3CPW O;  1SQP K;  1ZP0 C;  2M5R A;  2FYU E;  3L75 E;  5CCG D;  2N1T C;  1IUQ A;  2FQ0 A;  2K94 A;  3BCC D;  2N5H A;  1EZV D;  5HGN A;  3SFD C;  3E7K A;  2XZ0 D;  2KGA A;  2ZJS E;  3U59 A;  3D71 A;  3I55 P;  1M1K Q;  2WSF H;  2C0W A;  2LXB A;  2YO3 A;  1L2P A;  2FFD A;  2KOP A;  4EDF A;  3L70 E;  5AVR B;  3HTK A;  1OMI A;  3EQ2 A;  2NZ2 A;  5AVX B;  1BCC D;  5CCH D;  5CZD B;  2QE7 H;  3OA7 A;  3OAK A;  1LWU A;  1HH0 A;  4XFZ A;  5AVV B;  1SQV D;  2FYN C;  4C7N A;  2ZT9 D;  1SQB D;  1EXJ A;  4IOI H;  3BCC E;  5EW5 E;  2O01 J;  4BRY A;  1NH4 A;  3I5C A;  1LT9 A;  1FS0 E;  1ZLL A;  3RL0 C;  2L4B A;  2WPV B;  4R4M A;  2FXP A;  3B8E B;  2I8D A;  1H0T A;  1CI6 A;  1BE3 E;  3O6Q B;  3PTZ A;  3B5N C;  3FX0 A;  1JB0 J;  1BCC E;  4KT0 J;  1YIT P;  3IAO A;  3HTK B;  3VTP C;  2FQ1 A;  5F2K A;  3CXH E;  2OQQ A;  4WVZ A;  4U3F J;  1NTK D;  2L9F A;  2H7H A;  2KB7 P;  1L0H A;  1OFC X;  2E76 C;  4PJ0 E;  1ZW0 A;  4C7N B;  3FXD A;  3B71 A;  2N1T D;  2LML A;  1VF5 D;  1FZE A;  1LT9 B;  1GW3 A;  2B87 A;  2K5X A;  2Y9Y A;  2K2Q A;  1GTW A;  4DJG A;  2OTJ P;  3CLQ A;  1DNY A;  2N5I A;  1H0T B;  4UB8 H;  1ACP A;  2M0B A;  2C9L Y;  3AEC C;  3L73 J;  1NVO A;  2K3R A;  1L0N K;  3LMO A;  3Q5P A;  1E0H A;  1SQX K;  1NAF A;  4WWI A;  4W7Z A;  5E79 H;  1HWT C;  3V6I A;  4WY4 A;  3H1I J;  3DS3 A;  2JO1 A;  4UB6 E;  1URQ A;  2QJP C;  1N7S A;  4H2X C;  5TIS E;  2CK3 H;  2HYN A;  3VMY A;  1LP1 A;  1T2K C;  1M90 Q;  1YIJ P;  4YXW H;  3M0D A;  2L5G B;  2XKM A;  2NPS C;  2FAC A;  2MVV A;  1HJ0 A;  2B87 B;  1GL2 C;  1M7L A;  2KXP B;  3L72 E;  5KLV J;  2YXR B;  1RE3 A;  1SFC D;  5CCG A;  4D6T E;  2W6A A;  3B5N D;  3PH0 A;  1FJK A;  2KG8 A;  2AFD A;  2IBZ I;  1RY3 A;  1K73 Q;  1L0L D;  1OWA A;  2LTE A;  1RE4 C;  2L0Q A;  1SQQ D;  1EDK A;  4PH1 A;  2E1M A;  2E76 D;  2QM7 A;  3RL0 g;  2KG6 A;  1EXI A;  4WB4 A;  5AW7 B;  1N7S B;  3H1K D;  2IZ1 A;  1NU1 J;  3SSU A;  1LP1 B;  3QH9 A;  1HQB A;  4DG9 A;  1OR5 A;  2KIK A;  2PRR A;  2VRS A;  3SWY A;  1PFI A;  1L0L E;  3BAT A;  1ZV8 A;  1SQP D;  5KJ7 D;  3V2P A;  2KWL A;  3AE3 C;  5B66 E;  3HUS C;  2WSE H;  2L6E A;  1FZF A;  3H1K E;  4DCK A;  2WSC H;  2OYI C;  2WSF J;  4H44 D;  1PGJ A;  2N9Y B;  1DEE G;  1R5S A;  1G2C A;  3CX5 D;  5BS2 A;  3ABV C;  1W2E A;  2NPS D;  1VKU A;  4H0L C;  2K92 A;  2JKV A;  1SVF A;  3H32 A;  1FOS E;  2KOQ A;  2MF4 A;  1VQM P;  4PD4 D;  2N1T A;  1M74 A;  5CJ0 A;  1LTT C;  2JJL A;  5CBO A;  4Y99 B;  3G71 P;  3OW2 O;  2C0X A;  2PEK A;  2QJY B;  3C9I A;  3HZQ A;  2I1K A;  3AE4 C;  1EZV I;  5KAF H;  4RES B;  4GT1 A;  3CX5 E;  3VN0 A;  3AE5 C;  3SFE C;  3TDK A;  3HE4 A;  2WPT A;  2E75 C;  1P84 D;  2FY8 A;  5DJU B;  2BCC D;  1ZN5 A;  2W6J H;  1QRJ A;  3GZL A;  1G2C B;  2JAZ A;  2Q5U A;  2KOS A;  1IMQ A;  2IDB A;  3V4Q A;  3DS1 A;  5C39 A;  1AF8 A;  3G26 A;  3GHG B;  3AE7 C;  1CW5 A;  1AVO A;  3CWB D;  1HY8 A;  2R5D A;  3TNU A;  1IK9 A;  2IYO A;  3CCE P;  1MZ8 A;  2XZ1 C;  2MKV A;  3SWK A;  1A02 J;  1FE6 A;  2BEZ F;  2D2C B;  3KZI H;  3AEE C;  2EG5 A;  2YIU C;  3D6Y A;  2XXM A;  2KG9 A;  4JYC A;  3AE9 C;  1GMJ A;  3B5N A;  4IL6 H;  4PH0 A;  4XA4 A;  1OW7 A;  2JYG A;  4C7R A;  3WU2 H;  3NFQ A;  4R4L A;  1N7L A;  1USD A;  2L22 A;  4PD4 H;  4I7Z B;  1SQV J;  2MD9 A;  1M56 D;  1IFD A;  1L0N D;  1UJZ A;  1SQB J;  1PL5 A;  1N73 C;  2KZI A;  1BXI A;  3RL0 B;  4UHP B;  4YTP C;  2P58 A;  2R5B A;  2W27 A;  1CEI A;  2XNX A;  1FZA A;  1PEU A;  2E74 C;  4H13 C;  1EDJ A;  5GTI H;  1KIL C;  3H1L G;  1ZXG A;  1BDD A;  3DTJ A;  4NPD A;  1IC2 A;  1FDM A;  5AW6 B;  4Z1M H;  5APQ A;  1NTK J;  3NMD A;  1KFM A;  1ZME C;  2R3C A;  7CEI A;  2P1J A;  2PAJ A;  2E5T A;  2NPS A;  1YI2 P;  5KAI H;  1ZR4 A;  3G9R A;  4U3F E;  1GL2 A;  1FDI A;  1KTM A;  4C46 A;  3LW5 J;  4L76 A;  3CCM P;  2H8P D;  5APS A;  3EJE A;  2W8Z A;  1CZQ A;  2YKP A;  3KHU A;  1QL1 A;  2FBW C;  1AYI A;  1KN7 A;  1SQX G;  1F80 D;  2Y9Z A;  1RE4 A;  2WQY C;  1S5L E;  3V4W A;  3NTN A;  2AEJ A;  1LJ2 A;  3A0B H;  4TT3 H;  3CMA P;  1H89 A;  1AVY A;  4U0A A;  3L73 E;  4EYY Q;  4ZKP A;  1ZR2 A;  2N6Z A;  2QJP B;  2WSE J;  5KP6 B;  4GOE A;  1JJ2 O;  2WSC J;  1FJP A;  2VLN A;  2B9B A;  3H1I E;  1GL2 B;  4I6M C;  1GD2 E;  4H13 D;  5H2F E;  1PPJ D;  3NTE A;  1E79 H;  1S72 P;  2QIW A;  2LF4 A;  3IN6 A;  5BU8 B;  1WMK A;  1RF1 B;  3HUS A;  2RH0 A;  1HUC A;  3A3Y B;  2BEQ D;  4EOT A;  1SQQ J;  5AVS B;  1NOH A;  3HE5 A;  4HYT B;  2OYI A;  3DS2 A;  3M9H A;  2OTK E;  2Z44 A;  2CGQ A;  4RO0 A;  3H1K J;  1EQ7 A;  2K0D X;  3H25 A;  2WPR A;  3TF5 A;  3H1H D;  2XU6 A;  1KIL E;  2A06 E;  4DZO A;  1VQ5 P;  2JGP A;  2YXQ B;  1YJW P;  5B5E E;  1YHQ P;  4KHX A;  4PD4 I;  4M0I A;  2JQ4 A;  4L74 A;  1YTZ T;  3M91 A;  2O01 N;  1KC8 Q;  1SQP J;  5CCH C;  1OX3 A;  1GXH A;  3HUS B;  2IBZ E;  1RQV A;  1VQO P;  4N78 D;  2QEX P;  2AEF A;  3HE5 B;  2OYI B;  1AJY A;  2ZT9 C;  2BAS A;  4U7J A;  1PIX A;  3CCU P;  1EMV A;  2P2U A;  2ZAE B;  3L71 G;  4H0L B;  1P84 I;  5AVY B;  3CCJ P;  3MGE A;  1RQU A;  1JTH B;  2JU1 A;  4JYB A;  3RK3 C;  2KS1 A;  1KLP A;  2AXC A;  3AE6 C;  3H1H G;  1T8K A;  3GZM A;  2Q9I A;  4PV1 C;  1UIX A;  2IFN A;  2E75 B;  3G6E P;  1NTZ G;  1KQL A;  2BCC J;  3RG6 C;  2WWW A;  4DOJ A;  5DJT B;  1VF5 C;  5KLI B;  1OVV A;  2QG4 A;  2YMY A;  2JO0 A;  1U57 A;  3B5I A;  5DCK A;  1D7M A;  2KW2 A;  1N73 A;  1ZNV A;  3CWB J;  2IZ0 A;  1NTM G;  4A7P A;  2ITA A;  3Q5S A;  2M5A B;  5L8R J;  1KQF B;  2B88 A;  3HRN A;  1UNK A;  3M06 A;  1KIL A;  1SLQ A;  1A43 A;  4XRO A;  2AXT H;  1AFO A;  1EZV E;  2KOG A;  1KD1 Q;  3ITK A;  2QVA A;  1MZ9 A;  5AVU B;  3M1M A;  2KNC A;  3VRL C;  1RH5 B;  2AEM A;  2OYH C;  3L75 G;  4UB8 E;  4H2W C;  3G0V A;  2FVE A;  1SFC C;  3V2N A;  1L0N J;  3RK3 D;  2H88 C;  3S4R A;  1SQX J;  3C1L A;  2FFD B;  2KYV A;  5E79 E;  2A45 G;  1SQV E;  1KQG B;  2KGE A;  3L70 G;  2E74 B;  1GW4 A;  1SQB E;  2LIU A;  2Z5I A;  2PEM A;  1LWU B;  4N3Y B;  4PV1 D;  3T97 A;  1MFT A;  1X3O A;  5GTH H;  3TGU G;  2M3E A;  1U7M A;  3R4Y A;  3G3Z A;  2WT7 A;  1BGY G;  4BRY B;  2DW3 A;  1VQK P;  2JWD A;  1FZC C;  2KNC B;  2Q6Q A;  3RK3 E;  3BAS A;  2M8R A;  1QGK B;  3CCL P;  4EIJ A;  1CI6 B;  3TK1 A;  2WTY A;  3A2A A;  1NTK E;  2Y0C A;  4ASW A;  2FAE A;  2WZ7 A;  4Y28 J;  5KJ7 C;  3VOP A;  3MD0 A;  3CCV P;  1WRG A;  1L4A C;  3RK2 B;  4H44 C;  3T97 B;  3V2R A;  2K37 A;  1YQ3 C;  1RO0 A;  2POH A;  3BRV B;  2WT7 B;  1LTG C;  2GDX A;  4I2L C;  3HD7 D;  3L4F A;  4QMA A;  1OIP A;  1S4X A;  1BAJ A;  4JF7 A;  1IJD B;  2K0X A;  1KYO H;  2H89 C;  4IFD K;  1IO4 A;  3L74 G;  1A8O A;  2W90 A;  3U43 A;  4HH2 A;  2KOD A;  4JQ0 D;  4BPF A;  5AW4 B;  1E6J P;  3D70 A;  2ZVN B;  2YO2 A;  1LTS C;  1QX8 A;  4XFJ A;  4WY4 B;  3VYI A;  3GKL C;  1KB9 D;  1YYC A;  2J59 M;  1K05 A;  4GDO A;  1URQ B;  1G1J A;  5CCH A;  3OJA B;  5APY A;  1AV1 A;  4OGQ B;  3EJB A;  2KR5 A;  1NHL A;  1KOR A;  5HV8 A;  4JPZ B;  4WYM A;  3DS0 A;  3SWF A;  1J1D C;  3L72 G;  5K5G B;  3VP8 A;  1SQQ E;  2WPQ A;  3H1H J;  4D6T G;  5KAF E;  2KI7 B;  3IF4 A;  3MTU E;  3P32 A;  2YKQ A;  1IFJ A;  3CCQ P;  3NXS A;  2PEO A;  2J58 A;  1OW6 A;  1L4A D;  2PY8 A;  3IFM A;  5HGM A;  3MHV A;  1VQ6 P;  1L0I A;  2PEN A;  3CL3 D;  1LTI C;  1DIP A;  1FDO A;  1RO2 A;  1HGV A;  2Z46 A;  3P7K A;  2P10 A;  1J2J B;  4OH8 B;  2DGY A;  3TSI A;  2ZT9 B;  1W2B O;  3MZW B;  1RF0 C;  1NO4 A;  1SQP E;  4O9B A;  3PLN A;  2CPB A;  2EIA A;  3AEF C;  3A0H E;  3KZI E;  3S1K A;  1K8A Q;  2ROQ A;  4LC1 A;  1OVU A;  3P05 A;  1KB9 H;  4IL6 E;  1VPC A;  3CCR P;  1XTC C;  3GLM A;  1YJ9 P;  2QRX A;  3PHL A;  4OWF A;  1NTZ K;  2P67 A;  2PEQ A;  1VQL P;  3G28 A;  2EHS A;  1IFP A;  3WU2 E;  2YMK A;  3KQG A;  4PD4 E;  2FXM A;  1PEO A;  4YXD C;  2IPP A;  1FU1 A;  3H1L D;  3FGA D;  3H32 B;  4IL6 X;  3EJD A;  3DS4 A;  2N1T B;  2OYH A;  1NTM K;  1LTJ C;  1DD4 A;  1VF5 B;  1W5C E;  2CG5 B;  2L91 A;  3PP5 A;  3VMA A;  1SFC A;  5GTI E;  4XRQ A;  2ONT A;  3B4Q A;  1GDT A;  1P84 E;  2BCC E;  2JWA A;  1S3J A;  5CBN A;  1BGY J;  2KGC A;  4KJM A;  3DS5 A;  3HE4 B;  2GZF A;  1KYO I;  3H6P A;  1JOC A;  5APU A;  2FYU K;  2JEE A;  2FYN B;  3V5B A;  3CWB E;  2NRG A;  3GF7 A;  1NKN A;  2BQ1 E;  1M6N A;  5KAI E;  1PEQ A;  1SQX D;  3TNU B;  1FZC A;  1GK4 A;  5APX A;  2OYH B;  2KSJ A;  4K35 A;  4B86 A;  1K30 A;  4EI2 A;  3H1J G;  2K93 A;  1VQ7 P;  3WUT A;  3Q5R A;  2FAD A;  2W83 C;  2ERH A;  3N7N A;  3B5N B;  5AVT B;  1Q86 Q;  2WPS A;  2V4H A;  5KJ7 A;  1BSN A;  2LL8 A;  2JB0 A;  3A0B E;  1NGM B;  2GUV A;  4NPF X;  1L0N E;  2HOD A;  2E76 B;  1L4A A;  1SQX E;  3IR9 A;  3CI9 A;  2QJK C;  2IFM A;  3EFF K;  3CCS P;  1KMI Z;  2PP6 A;  1DV5 A;  3RBZ A;  2ZVO B;  3MGN A;  5APW A;  2IX7 C;  2KOR A;  2XDJ A;  1A02 F;  4QNB A;  2LIW A;  5AVQ B;  1PP9 G;  2CNR A;  4MN4 C;  1LTA C;  3Q2Y A;  1X22 A;  1FZB A;  2K9J A;  2LR2 A;  5KKZ C;  3AE1 C;  2HPC A;  2KK7 A;  1S2E A;  3S9O A;  2HOD B;  2EFJ A;  4AUW A;  2O01 H;  2KGD A;  1KB9 I;  1IMP A;  2NPS B;  5BU5 A;  5KP7 B;  1U7J A;  1J1E C;  1EIA A;  1KFN A;  1S5L X;  1LGH B;  1VQ8 P;  5F2O A;  2QSI A;  4U3F G;  3BRT B;  2M8P A;  4U0E A;  2SPZ A;  3GMA A;  3CC7 P;  3L71 D;  1JEK A;  1M6E X;  3Q3D A;  1RNI A;  3HYB A;  1JMM A;  4AQR D;  3F5H A;  2K9J B;  4IFF A;  2HPC B;  3LRY A;  2VLP A;  3CD6 P;  3H0D A;  1EOQ A;  3L73 G;  2GZJ A;  2Q7C A;  2JBG A;  4CA3 A;  2B89 A;  2R3S A;  2CWO A;  2LXC B;  1PPJ E;  4GOD A;  5CHX A;  4AYC A;  3JCU H;  2N98 A;  4W80 A;  1RF0 A;  1NTZ D;  3L71 E;  1BDC A;  3GJN A;  2LPK A;  1IFN A;  4I1L A;  2HLO A;  2XT1 A;  2WSS H;  3UIA A;  4PWV B;  2OTL P;  2HFE D;  4HKZ H;  1M57 D;  3W68 A;  1NTM D;  4GKG A;  3RG2 A;  4HKG A;  5KLV G;  2E42 A;  1Q82 Q;  3H1H E;  1M1J C;  1NAY A;  3L36 A;  1ZOY C;  5AW5 B;  3KYQ A;  2VLQ A;  4ZKU A;  2QA4 P;  3CME P;  3I56 P;  1NTZ E;  1X9V A;  2N50 A;  1L0L K;  2K9Y A;  1K04 A;  1DEB A;  1LTB C;  3LIE A;  5AVW B;  2Z4E A;  3P8M C;  1LTJ A;  2ZYG A;  3PJS K;  2A06 G;  2FVA A;  3W67 A;  2FYU D;  3CC4 P;  3L75 D;  1Z6M A;  4Y99 C;  1NU1 G;  2Q3E A;  4N78 E;  1NTM E;  2BHV A;  2QJY C;  2AXT E;  1LT1 A;  3Q20 A;  4WY4 D;  1Q7Y Q;  2K0Y A;  3B4S A;  3F89 A;  1URQ D;  2IBZ G;  2Z5H A;  1N7S D;  1JO5 A;  3Q1M A;  1Q2N A;  3L70 D;  4W7Y A;  2FVF A;  1TU3 F;  1PGO A;  3QWO C;  3TGU D;  2HG5 D;  3H1L J;  5HGO A;  3JSV C;  3GHG C;  4F37 A;  3JC2 2;  2KP8 A;  5AW1 B;  1BGY D;  4XFY A;  1LTJ B;  3L35 A;  1FOS F;  1MFZ A;  1FAV A;  1E5W A;  2KS1 B;  2YIU B;  2D2C C;  3U1C A;  2GA1 A;  3G1G A;  1JUN A;  1QLE D;  5AW2 B;  4GR2 A;  2JR8 A;  1VL2 A;  5GTH E;  3O6Q A;  2GZE A;  1D1D A;  1DH3 A;  2RMZ A;  1X0T A;  5AW0 B;  4LGD E;  1IZN B;  3PRJ A;  1BE3 D;  2H43 A;  1PZQ A;  3TGU E;  2FYU G;  3HD7 C;  1S9K D;  1PP9 J;  3CXH D;  1BGY E;  2YNY A;  4I7Z C;  3EFG A;  1PV3 A;  1N73 B;  1KYO D;  3V2Q A;  2MVU A;  3A5T A;  5KTB A;  3TYY A; 
#chains in the Genus database with same CATH homology
 3DS3 A;  3CME P;  3I56 P;  3NTE A;  2EFJ A;  1S72 P;  2LF4 A;  3G21 A;  3DS5 A;  1VQM P;  3G6E P;  1ZMB A;  1QVF O;  3CCL P;  1PEU A;  1M90 Q;  1M74 A;  3RG6 C;  1YIJ P;  3CCQ P;  2BUO A;  3G4S P;  2PEO A;  4XFZ A;  2PEI A;  1EIA A;  1KQS O;  1VQ8 P;  3DS2 A;  2PY8 A;  5F2O A;  5JPA A;  3CC4 P;  2JO0 A;  4U0F A;  2XV6 A;  3G71 P;  3B5I A;  3OW2 O;  5HGM A;  1M6N A;  5DCK A;  4XFX A;  1NJI Q;  3DTJ A;  1VQ6 P;  2Z44 A;  1PEQ A;  2PEN A;  4COC A;  2PEK A;  2M8P A;  3HZQ A;  4U0E A;  1RO2 A;  3CCV P;  2BHV A;  2Z46 A;  3Q20 A;  1VQP P;  3CC7 P;  1K30 A;  1Q7Y Q;  2OAR A;  2DGY A;  1YJN P;  5BS1 A;  1K73 Q;  1M6E X;  1RNI A;  3HYB A;  4U0D A;  1VQ5 P;  1W2B O;  1VQ7 P;  1QRJ A;  2M8N A;  1RO0 A;  2M8L A;  1AUM A;  2P9X A;  1YI2 P;  1A43 A;  2Z45 A;  4PH1 A;  4XRO A;  1YJW P;  2E1M A;  1Q86 Q;  2EIA A;  1Q81 Q;  3LRY A;  4GR6 A;  1YHQ P;  3WBH A;  1YIT P;  3DS1 A;  1K8A Q;  4M0I A;  5F2N A;  3CD6 P;  3G26 A;  3CCM P;  5HGO A;  5I4T G;  3H0D A;  3G1I A;  1EOQ A;  5F2K A;  1KC8 Q;  1KD1 Q;  1BAJ A;  3P05 A;  3DPH A;  3CCR P;  4XFY A;  3M1M A;  3VRL C;  2CWO A;  1YJ9 P;  1A8O A;  1K9M Q;  3CCE P;  3CXC O;  2JYL A;  1VQO P;  2KOD A;  2QEX P;  1E6J P;  2PEQ A;  3G28 A;  1VQL P;  4COP A;  3G0V A;  3CCU P;  1VQ9 P;  2EG5 A;  3CCS P;  4IPY A;  3G1G A;  2XXM A;  3CC2 P;  4GR2 A;  1PEM A;  3CMA P;  1PEO A;  3H47 A;  4U0A A;  1D1D A;  5HGL A;  4PH0 A;  3E2D A;  3CPW O;  2XT1 A;  2OTJ P;  3CCJ P;  1JJ2 O;  4QNB A;  1N8R Q;  2OTL P;  2JYG A;  3MGE A;  4U0C A;  1QVG O;  3DS4 A;  2PEJ A;  1IUQ A;  2PEM A;  2L6E A;  5HGN A;  3H4E A;  1VQN P;  2BQ1 E;  1Q82 Q;  1VQ4 P;  3G29 A;  4XRQ A;  4WYM A;  2ONT A;  5BS2 A;  4U0B A;  3DS0 A;  3I55 P;  1M1K Q;  1VQK P;  2QA4 P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...