1VQMP

The structure of the transition state analogue "dan" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal rna
total genus 46
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1vqmP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1vqmP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1vqmP02
3CC2P 1YJWP 3CCQP 1VQ8P 1Q82Q 2OTJP 1KQSO 1VQLP 3G71P 1M90Q 3CCUP 1VQOP 1YITP 1YIJP 1KC8Q 1VQ7P 1VQ4P 1Q7YQ 1VQ6P 3CCJP 1VQNP 1Q81Q 1YJ9P 1VQKP 1N8RQ 3CC4P 3I56P 2OTLP 1S72P 1W2BO 1M1KQ 3CD6P 1YHQP 1NJIQ 3CCEP 3CXCO 1K8AQ 3CCRP 1YJNP 3CC7P 3CMAP 1QVGO 2QEXP 3CCVP 3OW2O 3CCLP 1VQ5P 1VQMP 3CMEP 1VQ9P 3G4SP 1JJ2O 2QA4P 3G6EP 1YI2P 1K9MQ 3CCSP 1KD1Q 1K73Q 3CCMP 3CPWO 1QVFO 3I55P 1VQPP 1Q86Q
chains in the Genus database with same CATH superfamily
2AEJA 2B87A 1K05A 2RMZA 5CHXA 1K04A 4NPFX 1VF5B 3V6IA 1E79H 4C46A 4ASVA 5AVYB 3BRVB 2KP8A 2J59M 1SQXG 2LIUA 2K1AA 3RGUA 2ZT9B 2OYIB 2ZVNB 1SFCB 2FKWB 5HV8A 4H13B 4D6TJ 4EIJA 2FYUK 3CWBE 5CCHD 2GZFA 4H2YC 1VL2A 1NTZE 2ZXXA 3CXHH 3EQ2A 2JKVA 5CJ4A 5JPAA 2PAJA 5AW2B 4HB1A 2N98A 3UIAA 1YITP 2O01N 2YO2A 1KILD 1Y8AA 1DNYA 2OQQA 4H13C 3DS5A 3BRTB 3H1IG 2C9NY 2Z45A 2W8ZA 4PV1B 3HZQA 2FBWC 1HQBA 3H1JE 1UNKA 3RL0B 4CPGA 2C0WA 3H1JG 2QJKC 3CXHD 2WZ7A 3AE4C 3C9IA 2WSSH 2FXPA 1G1JA 3TSIA 5TISE 4U0CA 2QJPC 1RF1A 1JMBA 1FE6A 2PEQA 4EDFA 4GT1A 1VQ5P 2L22A 3CCSP 1BGYG 2O3JA 1BE3G 1SQQD 2V7QJ 1SQBE 4EI2A 1N86A 3AE6C 4H44D 2FAEA 1GK6A 5AVVB 2HLOA 3F5HA 4XA4A 3L74D 3V5BA 3HD7A 1U57A 3H1HJ 2XNXA 1S5LE 4XFYA 4C7NB 1N73B 3BCCG 1SQVG 3RK3C 2P67A 1NU1E 3L74E 5CCGC 1N7SB 2OTJP 1BGYJ 2FYUE 5BS1A 1L0LK 2FYUG 2GUVA 1SFCA 2L4BA 2R32A 3KZIH 4U0DA 1EMVA 3CCEP 2GA1A 2LXBA 3G4SP 4QKOA 3N4XA 1H89A 5KAIE 1K73Q 2I1JA 3L71D 1HH0A 1FZCA 3GF7A 4XFJA 2BUOA 1N7SC 3WUTA 3BCCJ 2KODA 3D70A 2X2BA 3RG2A 1YYCA 2XT1A 2FYNC 3FX0A 2MVUA 1L0IA 1HY8A 3TGUE 2KOSA 4BPHA 1URQC 1HBWA 3AEBC 2K88A 3G6EP 2N50A 4JYCA 2YXQB 2ZT9D 2LL8A 2Y9ZA 1AV1A 1IO4A 2KWLA 2WPVB 3LRYA 4ZKUA 2GDYA 1RH5B 2IPPA 3B5NC 2OTLP 4RKUJ 2QEXP 3QH9A 3V2RA 1FOSF 1JJ2O 1LWUB 1YI2P 4W7ZA 1SP4A 3VMAA 4H44C 4KT0J 1SQPG 4PD4H 1FOSE 1JM0A 1DX7A 1NTKE 2IDBA 5AW5B 2FXOA 5APXA 1BDCA 4O9BA 1SFCC 1E6JP 2CPSA 4AYCA 4XROA 4JPZB 3VYIA 2JDIH 1NU1K 1TU3F 1LT9B 1SQVK 2W90A 3V2QA 1FZFA 2JEEA 2W83C 2AVAA 5APYA 2OGUA 3CWBJ 1M6NA 1BXIA 1AA0A 5AW7B 3CXCO 1X9VA 1GU5A 3M0DC 5KKZB 3H4EA 2GUSA 1KILC 4C7NA 1N73A 2NPSD 3L70E 2KZIA 2Z4EA 4H0LC 2IFNA 1ZLLA 2L6EA 1RHZB 2AF8A 1A02J 2CWOA 3P8MC 4H2WC 3JCUE 4I2LC 5AVXB 1RF1C 1W2BO 3DPHA 1J1DC 3N7NA 4GOFA 2KNCB 1BAJA 1FJKA 1PFIA 3CCQP 1KILB 1KQSO 1LTJA 1KYOD 4PV1C 3I56P 2A06E 3IF4A 2B89A 4GDOA 1GK4A 2M8RA 3L72G 3LW5J 3Q2YA 5AVZB 2N5IA 2Y0CA 2ZJSE 2GZIA 2QNWA 3H1IE 1JMMA 3H1JJ 4F37A 3A2AA 2FVEA 2E76C 2KOOA 1HUCA 2N1TA 2E42A 3CD6P 2KOQA 1NJIQ 1IFNA 3KQGA 1NTMJ 2W6JH 1IUQA 5M1BA 2N6ZA 3CMEP 3B8EB 3I5CA 1RF0C 4LC1A 4ZKPA 4N3YB 2KI7B 1VF5D 1RE4A 5AW1B 3VP9A 1T3JA 3AE8C 2M5AB 3MTUE 5E79H 3VP8A 3DS4A 3RL0g 3EFGA 2YIUC 2UWJE 4UB6E 4QNBA 2CG5B 1NO4A 3KPEA 2JBGA 4U3FE 4WY4A 3B4QA 3Q5SA 2IFMA 5KJ7C 4N78E 2RN0A 4OGQC 3H1HG 3HD7D 1J1EC 1JEKA 2KG8A 2XXMA 1P84H 4IFDK 1S4XA 1YQ4C 1VQ7P 2IZ0A 2HFED 2M8PA 2P1JA 2CQ8A 3H1KJ 3KHUA 3MZWB 3Q3DA 2KIKA 1KMIZ 2L91A 4GKGA 1DH3A 1FJPA 4WY4B 3CWBD 1JY2O 2DGYA 2N9YB 2A06G 1WRGA 2WSFJ 4N6JA 3P05A 1KB9I 2KSEA 2WMMA 3TDKA 2N6YA 4HH2A 1AQTA 1KN7A 1U7JA 3O8ZA 1KD1Q 3CPWO 1URQA 3RK3B 1YBKA 1LTBC 1SS1A 2BASA 1PIXA 1LTJB 2KGEA 1VQNP 1S3JA 2E74B 3SSUA 1ACPA 2QJKB 3AE9C 2IYPA 1LT9A 3P32A 1R5LA 2LOLA 3PH0A 3CX5E 3TK1A 1ZRTD 3VMZA 4I1LA 2HG5D 1K30A 2D2CD 1ZMEC 2E75B 2PEIA 2OARA 1RE3A 3DS2A 1KLPA 2GDWA 4WB4A 3GW6A 5EJDA 1KQGB 2AXTH 3GG2A 2K93A 4XRQA 1CI6B 1FR2A 1J2JB 4U0FA 2IZ1A 1FZBA 1BDDA 1T6AA 5B66H 3H1KD 1L4AA 2KW2A 4R4MA 2E5TA 2A45I 3H0DA 2A45G 2JU1A 2K92A 1LWUC 3KDPB 1GL2D 2QG4A 2ERHA 2KG6A 2L0QA 1SQVD 3FXEA 4AQRD 4I7ZB 1OVUA 4DG9A 2XDJA 2GDXA 4PD4D 2LR2A 2LF4A 2LKMA 2XV6A 3G3ZA 4PXHB 2JYGA 4BXLA 1KB9H 3VMYA 1P84I 2WSCH 1NWQA 3CX5H 2AFDA 1QL1A 2WVRA 2RH0A 2HPCB 1KFMA 1USDA 2ZYDA 3S4RA 2LXCB 1R5SA 3MUDC 2E1MA 4N78D 1ZR2A 1RQUA 5EW5E 3CCVP 5L8RJ 2HODB 2L5GB 2W27A 1OR5A 3TGUG 1KB9D 4L75A 2FQ0A 2XZ1C 4PJ0H 3LIEA 2IBZD 5APWA 5KLVD 1YJ9P 3DS1A 1JY3P 1SQQJ 1URQD 2VLQA 3MHVA 4L76A 3P8CD 1IK7A 1SQQK 4U7JA 2NRGA 2IX7C 5BU8B 4NPEA 4BPGA 3Q5RA 3C8VA 3H1HD 5KLVE 1RY3A 5HGOA 3G9RA 3BATA 5TJHA 5K5GB 4IL6H 1L2PA 1M74A 1SQPE 2KXPB 1KYOH 5F2KA 5KTBA 3RK2C 1KYOI 4H13D 2AEFA 2E43A 2KNCA 1L0LD 5E79E 2RKLA 1Z6MA 1KTMA 1IMPA 1NH4A 2PEJA 2H7HA 1AJYA 4COPA 3H1LD 5HGMA 4IZ6A 1GL2B 1LJ2A 3CC7P 2WSFH 2FHSC 1VQMP 3EFFK 5KAIH 4D6TE 3V4QA 2BEZF 1MKMA 4MRTC 1LTIC 2ZT9C 2WWWA 1PP9J 1M6EX 1XTGB 1GMJA 2LKIA 2O01J 1JCDA 2G8YA 1FC2C 3HE4B 5BS2A 1RE3C 2KZJA 1SVFA 1BE3E 1GW3A 1OX3A 4RO0A 3ZDMA 1VHNA 3L37A 1VQLP 3LIDA 1NU1J 3P7KA 4W80A 5GTIH 1G2CB 4GOEA 5AW0B 5GTIE 2N5HA 5APVA 2E75D 2PEOA 3OA7A 4WBAA 1KYOE 1S5LX 3M0AA 4DJGA 1NOHA 3GHGA 2PEKA 3G29A 1CZQA 3H6PA 3GZMA 2PY8A 2FYZA 2MY5A 3A0BE 1QRJA 1P84D 1NTKJ 2R5BA 4L74A 1NAFA 3VRLC 1IFIA 2EHSA 3CCJP 2R5DA 2K2QA 1SLQA 3CX5D 2PGDA 2YKOA 2E74D 1NTKK 1YHQP 3M06A 2NPSA 3VMXA 3CWBG 2OYIA 2VLOA 2JP3A 4TLFA 3GZLA 1VQPP 1KV4A 5APQA 1Q82Q 4XFZA 3DS3A 3PP5A 5AW8B 3GF3A 5AVWB 2KOPA 4IPYA 3RBZA 2PENA 2KS1B 2K37A 4WVZA 1LT9C 3NXSA 5KP6B 5TISH 2JWDA 2K9JB 2QVAA 1JO5A 2ONTA 1X22A 4YXWH 3H1IJ 1QLED 3CXHE 3AEDC 2OYOA 2W6BA 5H2FE 3A7OA 1EDIA 1AQ5A 1QGKB 1P84E 1GDTA 1VQOP 3AE3C 5HGLA 3T97B 3E2DA 1NTKD 4BPFA 1JOCA 1CI6A 4IFMA 3H1HE 2KORA 1ZXGA 2QM7A 5KAFH 4AUWA 5F2NA 1E5WA 2P2UA 3HD7B 1AVYA 1M1KQ 1PPJG 1G1IA 2W6AA 4HKZH 3H1LJ 3C1LA 2YKQA 4PD4E 4UB8E 3VN0A 3T97A 1RO2A 1A43A 3HTKB 2OYHC 2JWAA 5APTA 1L0NE 1SQBG 3LW5H 1A02F 3L71E 4QMAA 5APSA 4U0AA 3CCLP 1PEQA 3RL0C 1AUMA 2KLUA 4BWNA 4H2XC 2GM4A 5CCHA 1T2KC 1ZMBA 2MVVA 5B5EH 4HKGA 5B5EE 2FFDC 2WTYA 2CGQA 3ABVC 5CCHC 1YTZI 2KGDA 2KB7P 1AFOA 2O1KA 1NGMB 3CCMP 1LTJC 2ROQA 2QJYC 1W2EA 2LMLA 3CX5I 1Z56A 1M7LA 2XU6A 3A0HH 3WBHA 3WUUA 3L75D 1JNMA 1HVVA 4UHPB 5KLIB 1RNIA 1H88A 1LT1A 2BEQD 2N1TC 2VLPA 5AW4B 2J5UA 5KLVG 3E1IA 1NKZB 3SWKA 1OVRA 1FZAA 2P58A 1Q90D 2Q1KA 5CZDB 3VTPC 1KC8Q 1ZRTE 3G21A 3TF5A 3JCUH 4YXDC 3IFMA 1YJNP 1MV8A 2J58A 1WT6A 3FXDA 2SPZA 2KUBA 1GZLA 1PGJA 1X8YA 1NTZK 2O01H 1QVFO 3L74J 4WWIA 1QEXA 1L0LG 3U1AA 3PJSK 4GIFA 4JF7A 3M9BA 2B87B 1IFDA 3B5ND 2KOGA 5AW9B 3V2PA 1DD3A 4U3FJ 3W67A 3RBXA 4I7ZC 1IK9A 3S9OA 2KR5A 5H2FH 1VQ8P 1DEEG 1GL2A 2MKVA 2Q5UA 2HPCA 4M0IA 1GD2E 1BCCG 5KKZC 1R8EA 2EIAA 3U43A 1L0LJ 1UIXA 3A3YB 3KXDA 3GHGC 3I55P 1JY2P 1FS0E 3TGUD 2Q3IA 4OGQB 2POHA 1QL2A 1OMIA 5F2OA 4RJTA 2N1TD 2H43A 1IC2A 1G2CA 2IBZG 3NFQA 2VLNA 4KHXA 3USSA 4I6MC 3MIWA 3G0VA 5KLVK 2BCCE 1Q86Q 1KZUB 3L71G 1FDMA 3JC22 2JB0A 5CCGA 2KSJA 1SQPK 5KLVJ 3Q1MA 3L73E 2M3EA 3L73G 1OWAA 1Q7YQ 1VQ6P 2A45H 1EDJA 1K8AQ 1CSBA 1GTWA 5DCKA 3PTZA 3EJDA 4Z1MH 4RESB 5GTHH 4LLHA 2K0XA 2Z44A 4OGQD 2L9FA 3L75G 3BVHA 2JO1A 1S1CX 3FWLA 1X79B 3IN6A 3ITKA 3SWFA 2KGAA 3AE2C 3O6QA 1BGYE 1K9MQ 1BGYD 1VDFA 1NTMG 3CC2P 2ZVOB 1BCCJ 1NTME 1L4AB 1H0TA 2Z5IA 2BQ1E 3M9HA 4R0MA 4ZMDA 2Z5HA 1D1DA 3KZIE 1M1JB 4OWFA 1RE4C 1BCCD 1IFMA 2WPTA 1FDOA 3BCCD 2NO8A 3VOPA 3SFDC 2IBZE 2WPRA 2AEMA 1Y47A 1L0ND 4BRYA 1PPJD 2JGPA 3TNUB 1U7MA 2M8LA 1HF9A 3MP7B 1Y9BA 2Y0EA 2C9LY 2GZEA 2Q6QA 5GTHE 4PV1D 1S9KE 2FQ1A 1URQB 1PZQA 3L70J 3CI9A 2Z46A 1DD4A 3RL0D 5APUA 2WPSA 7CEIA 3G71P 4DOJA 2YNYA 2YKPA 1ZNVA 1BE3J 4ASWA 3L4FA 3TGUJ 2M8NA 3GMAA 2OYHA 5AVSB 3Q5PA 2E5YA 2WSCJ 2MR8A 2VSQA 3CL3D 1KILE 3A5TA 1YIJP 2KK7A 2K0DX 2WT7B 2FVAA 2D2CB 2KGCA 1LTAC 2DNWA 1FDIA 1NKNA 2YO3A 1M8OB 1KFNA 3V4WA 1NTMK 2KYVA 2QJYB 1LWUA 4DZOA 1DEBA 3MGEA 1PGOA 5AW6B 4HJGH 1QX8A 1NTMD 3H1ID 5B66E 1USEA 1WMKA 1AYIA 3H1KG 5AVQB 4JQ0D 3JSVC 4Y28J 4GR2A 1W5CE 1OIPA 3RG6C 2K9JA 3B4SA 2MD9A 2JR8A 3D71A 3FWNA 3H1LE 3II6A 1EOQA 3NY7B 1RO0A 4H0LB 2MJZA 2E76B 3GKLC 5KP7B 4U0BA 2N9BA 3AE7C 3B71A 3G1GA 1JTHB 2M5AA 3HUSA 3PLNA 1FZCB 2BCCJ 1KORA 2AXTE 1BE3D 1NHLA 1JUNA 4LGDE 1M56D 3HE5A 3L35A 4BRYB 4PH0A 4CA3A 3W68A 3MGNA 2BCCD 2E76D 1EQ7A 2HODA 1MZ9A 3WUVA 1NU1G 3L72J 4D6TD 2HYNA 2PP6A 2XZRA 2A06D 1NAYA 4YTPC 1SQXE 4OVNF 2R3SA 1JY2N 4OH8B 3L70D 5HGNA 1VQ9P 1EZVD 2JYLA 3SFEC 4GR6A 1AF8A 2V4HA 5EFWB 4XE5B 4WY4C 1LTSC 2JU2A 2JQ4A 3HE4A 5HVCA 4EYYQ 3RK3E 1M1JC 1EIAA 2GZJA 3GJNA 4TT3H 1EDLA 1Q81Q 4PJ0E 2WT7A 4IL6E 2D2CC 2WQYC 4C7RA 1H0TB 5AVRB 1KQLA 2FYUJ 1QVGO 1NTZD 1S2EA 1OXZA 2QA4P 3L72E 2IYOA 3AEEC 3NMDA 1LGHB 5CMZA 3AE1C 3H25A 1PEOA 1DIPA 2K94A 2FADA 3BASA 1EXJA 2O1JA 1PP9D 5KAFE 3PHLA 1FZEA 2OYHB 2B9BA 5AW3B 2M3BA 3GLMA 2AFEA 1X0TA 4PD4I 3L73J 1FAVA 1M90Q 2WPQA 3WMM0 4U3FG 4UB6H 1PEMA 3BCCE 4L73A 2FFDA 5AVTB 2JAZA 4ZNCA 1MFTA 2QJPB 5DJUB 3FGAD 1NTZJ 3G28A 2G3AA 4JBZA 2MF4A 2KLVA 3CXHI 2LIWA 5KJ7D 1KILA 3RK2B 4U0EA 4Y99C 2H88C 2QE7H 1L4AD 2AXCA 1RF0A 4NPDA 1OW7A 1FBMA 1LP1A 3TYYA 1VKUA 3A0BH 1J1DB 3L73D 2P10A 3B5IA 2P7JA 3PRJA 1NU1D 1HJBA 2BHVA 3D6YA 2HR3A 5CBOA 2DW3A 4Y99B 4W7YA 3M0DA 1VF5C 1BSNA 1J1EB 2Q7CA 3Q20A 1YJWP 1X3OA 4IOIH 2V7QH 3DTJA 2XNDH 1NVOA 2FQ2A 1JB0J 2ZXEB 4GODA 4UB8H 2FVFA 2WSEH 2Y9YA 2C0XA 1HGVA 1T8KA 3D6ZA 1MZ8A 1JY3N 2PEMA 3L72D 1L4AC 2EHTA 1XTCC 1T3UA 5KP8B 1PP9G 3P8CE 3F89A 3TNUA 1EZVI 3CCUP 5BVZA 1SQPJ 4COCA 2K9YA 1LTTC 1L0LE 4EOTA 1EC5A 1N8RQ 3DS0A 1JTHA 4D6TG 1JY3O 3SWYA 3M91A 2Y0DA 1HJ0A 2FACA 4PH1A 1IMQA 4IFFA 2E74C 2OTKE 4B86A 2GYKA 3EJEA 3E7KA 1OZHA 1PGQA 1OW8A 1BCCE 3OW2O 3G26A 2FFDB 1EZVG 1HGZA 1N7SD 4XFXA 2WSEJ 2I1KA 3HUSC 4U3FD 5CJ0A 2I8DA 4IL6X 1PPJE 1D7MA 1GL2C 3K5BA 1EDKA 1N7SA 2E75C 1IJDB 4H44B 1ZN5A 1SQVE 2YXRB 1DV5A 1A8OA 1FZCC 1ZP0C 3R2PA 1YQ3C 3L36A 4R4LA 1N2DC 2N1TB 1S9KD 2Q9IA 5AVUB 5CCGD 2YMKA 4A7PA 3M9QA 1GW4A 2QM8A 1VQKP 4MN4C 1GXHA 4WYMA 3AE5C 4YPCA 1ZV8A 1OVVA 3AEGC 3R4YA 2CNRA 3HD7C 1HTLC 1CW5A 5BU5A 3HRNA 3S1KA 1PL5A 3H32B 2BCCG 1ZOYC 2NZ2A 1GU4A 1Q2NA 5KJ7A 4DT0A 3CE7A 2CPBA 2CK3H 2K5XA 3L75J 1FU1A 1OW6A 1SQVJ 3AECC 2ITAA 3B5NB 3OAKA 2QSIA 2FYNB 1CEIA 1LNQA 1GXGA 2K3RA 2R3CA 2M5RA 2EFJA 3A0HE 2P9XA 4PWVB 3RK2D 1ZW0A 3H1LG 4M3LA 3CC4P 3MUDA 1S72P 3CLQA 1SQBK 1SQQE 3H32A 3WU2E 1MFZA 1S5LH 2FXMA 1SQQG 1SFCD 3U1CA 1SQBJ 1BSHA 5CBNA 4K3AA 4HYTB 1HWTC 1SQPD 2GZGA 1PP9E 3HE5B 3EJBA 3IR9A 3L74G 2LTEA 3AEAC 2JO0A 2B88A 2QIWA 5KLIC 1OFCX 3U59A 1MUUA 5C39A 2XZ0D 1L0HA 3MD0A 1PEUA 3HUSB 3H1JD 1M1JA 1EXIA 1KQFB 2QRXA 5I4TG 5DJTB 1L0NK 2KG9A 3KYQA 2ZYGA 3WU2H 1RQVA 1L0NJ 3L70G 2FY8A 2PFXA 1E0HA 2R44A 3O6QB 2OYIC 1EZVE 1F80D 2MR7A 1UIIA 1N73C 1UJZA 1T8ZA 1VQ4P 1SQXD 4K35A 2VRSA 1M57D 1LP1B 1SQXK 3AEFC 1NTZG 1FZGA 1VPCA 2XKMA 4NEOA 3NTNA 2PNGA 1RF1B 1SQXJ 3OJAB 1IFPA 2KS1A 3V2NA 3L71J 2FYUD 3H47A 3RK3D 4JYBA 2JJLA 2PRRA 1JCCA 3CCRP 3CMAP 2EG5A 1ZR4A 1KB9E 1IZNB 1NQ4A 2H89C 3GHGB 1T2KD 2NPSB 2IBZI 1AVOA 2K0YA 4DCKA 3L75E 3G1IA 2ZAEB 4WY4D 2XV5A 2ZFCA 1LTGC 1NTKG 3E1RA 2M0BA 2YIUB 1PGPA 2WITA 3HYBA 3NTEA 2H8PD 2Q3EA 2LPKA 1PV3A 2NPSC 3M1MA 3H1KE 1H8AA 1IFJA 4H0LD 3EWKA 1L0NG 4KJMA 3QWOC 3HTKA 3LMOA 1SQBD 1GPJA 2ZYAA 1NYHA 1N7LA 3B5NA 1YTZT 2YMYA 3IAOA
chains in the Genus database with same CATH topology
2Z46A 3G71P 1M90Q 3CCUP 1VQOP 1M6EX 1KC8Q 1VQ4P 1Q7YQ 1VQ6P 4PH0A 1VQNP 4COCA 5HGLA 3G21A 5BS2A 2E1MA 3E2DA 3CD6P 1NJIQ 1PEMA 1K8AQ 1YJNP 5DCKA 1E6JP 3CCVP 1IUQA 3CMEP 4XROA 5F2NA 2M8NA 2Z44A 4XFYA 1M1KQ 1QVFO 1N8RQ 3DS0A 2OTJP 1VQLP 2EFJA 3G28A 3DS4A 4PH1A 1RO2A 2P9XA 1A43A 1K30A 1YIJP 5BS1A 3H47A 2PEOA 1YJ9P 3DS1A 1M6NA 4QNBA 3CC4P 1S72P 4U0DA 2PEIA 2OARA 3CCEP 3CXCO 3CCRP 3CMAP 4U0EA 2EG5A 3OW2O 3G26A 5HGNA 1VQ9P 3G4SP 3DS2A 2JYLA 1K9MQ 4GR6A 4XFXA 1K73Q 3H4EA 4U0AA 3CCLP 3G29A 2PEKA 3CC2P 1PEQA 1VQ8P 5JPAA 4XRQA 1AUMA 2XXMA 2L6EA 2BUOA 2PY8A 4U0FA 3MGEA 1YITP 1EIAA 1QRJA 2CWOA 2KODA 3G1IA 2JO0A 4M0IA 5HGOA 1ZMBA 3VRLC 1VQ7P 3CCJP 3DS5A 3B5IA 2BQ1E 1M74A 2XT1A 1Q81Q 2EIAA 2M8PA 2Z45A 1W2BO 1D1DA 5F2KA 3DPHA 1YHQP 2BHVA 1QVGO 3H0DA 3HZQA 1A8OA 2QA4P 3HYBA 4GR2A 3G6EP 1PEUA 3CCMP 3RG6C 3I55P 1VQPP 3NTEA 1BAJA 3Q20A 1YJWP 3CCQP 1Q82Q 4XFZA 3DS3A 3M1MA 1EOQA 1KQSO 3DTJA 2DGYA 1RO0A 2PEJA 1PEOA 5F2OA 5I4TG 4U0BA 3WBHA 3P05A 2LF4A 4IPYA 2PENA 3LRYA 4COPA 1RNIA 5HGMA 4U0CA 2M8LA 1VQKP 3G1GA 3I56P 2OTLP 4WYMA 2PEMA 2ONTA 3CC7P 2PEQA 2XV6A 2QEXP 1VQ5P 2JYGA 1VQMP 3G0VA 1JJ2O 1YI2P 3CCSP 1KD1Q 3CPWO 1Q86Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CC2 P;  1YJW P;  3CCQ P;  1VQ8 P;  1Q82 Q;  2OTJ P;  1KQS O;  1VQL P;  3G71 P;  1M90 Q;  3CCU P;  1VQO P;  1YIT P;  1YIJ P;  1KC8 Q;  1VQ7 P;  1VQ4 P;  1Q7Y Q;  1VQ6 P;  3CCJ P;  1VQN P;  1Q81 Q;  1YJ9 P;  1VQK P;  1N8R Q;  3CC4 P;  3I56 P;  2OTL P;  1S72 P;  1W2B O;  1M1K Q;  3CD6 P;  1YHQ P;  1NJI Q;  3CCE P;  3CXC O;  1K8A Q;  3CCR P;  1YJN P;  3CC7 P;  3CMA P;  1QVG O;  2QEX P;  3CCV P;  3OW2 O;  3CCL P;  1VQ5 P;  1VQM P;  3CME P;  1VQ9 P;  3G4S P;  1JJ2 O;  2QA4 P;  3G6E P;  1YI2 P;  1K9M Q;  3CCS P;  1KD1 Q;  1K73 Q;  3CCM P;  3CPW O;  1QVF O;  3I55 P;  1VQP P;  1Q86 Q; 
#chains in the Genus database with same CATH topology
 2AEJ A;  2B87 A;  1K05 A;  2RMZ A;  5CHX A;  1K04 A;  4NPF X;  1VF5 B;  3V6I A;  1E79 H;  4C46 A;  4ASV A;  5AVY B;  3BRV B;  2KP8 A;  2J59 M;  1SQX G;  2LIU A;  2K1A A;  3RGU A;  2ZT9 B;  2OYI B;  2ZVN B;  1SFC B;  2FKW B;  5HV8 A;  4H13 B;  4D6T J;  4EIJ A;  2FYU K;  3CWB E;  5CCH D;  2GZF A;  4H2Y C;  1VL2 A;  1NTZ E;  2ZXX A;  3CXH H;  3EQ2 A;  2JKV A;  5CJ4 A;  5JPA A;  2PAJ A;  5AW2 B;  4HB1 A;  2N98 A;  3UIA A;  1YIT P;  2O01 N;  2YO2 A;  1KIL D;  1Y8A A;  1DNY A;  2OQQ A;  4H13 C;  3DS5 A;  3BRT B;  3H1I G;  2C9N Y;  2Z45 A;  2W8Z A;  4PV1 B;  3HZQ A;  2FBW C;  1HQB A;  3H1J E;  1UNK A;  3RL0 B;  4CPG A;  2C0W A;  3H1J G;  2QJK C;  3CXH D;  2WZ7 A;  3AE4 C;  3C9I A;  2WSS H;  2FXP A;  1G1J A;  3TSI A;  5TIS E;  4U0C A;  2QJP C;  1RF1 A;  1JMB A;  1FE6 A;  2PEQ A;  4EDF A;  4GT1 A;  1VQ5 P;  2L22 A;  3CCS P;  1BGY G;  2O3J A;  1BE3 G;  1SQQ D;  2V7Q J;  1SQB E;  4EI2 A;  1N86 A;  3AE6 C;  4H44 D;  2FAE A;  1GK6 A;  5AVV B;  2HLO A;  3F5H A;  4XA4 A;  3L74 D;  3V5B A;  3HD7 A;  1U57 A;  3H1H J;  2XNX A;  1S5L E;  4XFY A;  4C7N B;  1N73 B;  3BCC G;  1SQV G;  3RK3 C;  2P67 A;  1NU1 E;  3L74 E;  5CCG C;  1N7S B;  2OTJ P;  1BGY J;  2FYU E;  5BS1 A;  1L0L K;  2FYU G;  2GUV A;  1SFC A;  2L4B A;  2R32 A;  3KZI H;  4U0D A;  1EMV A;  3CCE P;  2GA1 A;  2LXB A;  3G4S P;  4QKO A;  3N4X A;  1H89 A;  5KAI E;  1K73 Q;  2I1J A;  3L71 D;  1HH0 A;  1FZC A;  3GF7 A;  4XFJ A;  2BUO A;  1N7S C;  3WUT A;  3BCC J;  2KOD A;  3D70 A;  2X2B A;  3RG2 A;  1YYC A;  2XT1 A;  2FYN C;  3FX0 A;  2MVU A;  1L0I A;  1HY8 A;  3TGU E;  2KOS A;  4BPH A;  1URQ C;  1HBW A;  3AEB C;  2K88 A;  3G6E P;  2N50 A;  4JYC A;  2YXQ B;  2ZT9 D;  2LL8 A;  2Y9Z A;  1AV1 A;  1IO4 A;  2KWL A;  2WPV B;  3LRY A;  4ZKU A;  2GDY A;  1RH5 B;  2IPP A;  3B5N C;  2OTL P;  4RKU J;  2QEX P;  3QH9 A;  3V2R A;  1FOS F;  1JJ2 O;  1LWU B;  1YI2 P;  4W7Z A;  1SP4 A;  3VMA A;  4H44 C;  4KT0 J;  1SQP G;  4PD4 H;  1FOS E;  1JM0 A;  1DX7 A;  1NTK E;  2IDB A;  5AW5 B;  2FXO A;  5APX A;  1BDC A;  4O9B A;  1SFC C;  1E6J P;  2CPS A;  4AYC A;  4XRO A;  4JPZ B;  3VYI A;  2JDI H;  1NU1 K;  1TU3 F;  1LT9 B;  1SQV K;  2W90 A;  3V2Q A;  1FZF A;  2JEE A;  2W83 C;  2AVA A;  5APY A;  2OGU A;  3CWB J;  1M6N A;  1BXI A;  1AA0 A;  5AW7 B;  3CXC O;  1X9V A;  1GU5 A;  3M0D C;  5KKZ B;  3H4E A;  2GUS A;  1KIL C;  4C7N A;  1N73 A;  2NPS D;  3L70 E;  2KZI A;  2Z4E A;  4H0L C;  2IFN A;  1ZLL A;  2L6E A;  1RHZ B;  2AF8 A;  1A02 J;  2CWO A;  3P8M C;  4H2W C;  3JCU E;  4I2L C;  5AVX B;  1RF1 C;  1W2B O;  3DPH A;  1J1D C;  3N7N A;  4GOF A;  2KNC B;  1BAJ A;  1FJK A;  1PFI A;  3CCQ P;  1KIL B;  1KQS O;  1LTJ A;  1KYO D;  4PV1 C;  3I56 P;  2A06 E;  3IF4 A;  2B89 A;  4GDO A;  1GK4 A;  2M8R A;  3L72 G;  3LW5 J;  3Q2Y A;  5AVZ B;  2N5I A;  2Y0C A;  2ZJS E;  2GZI A;  2QNW A;  3H1I E;  1JMM A;  3H1J J;  4F37 A;  3A2A A;  2FVE A;  2E76 C;  2KOO A;  1HUC A;  2N1T A;  2E42 A;  3CD6 P;  2KOQ A;  1NJI Q;  1IFN A;  3KQG A;  1NTM J;  2W6J H;  1IUQ A;  5M1B A;  2N6Z A;  3CME P;  3B8E B;  3I5C A;  1RF0 C;  4LC1 A;  4ZKP A;  4N3Y B;  2KI7 B;  1VF5 D;  1RE4 A;  5AW1 B;  3VP9 A;  1T3J A;  3AE8 C;  2M5A B;  3MTU E;  5E79 H;  3VP8 A;  3DS4 A;  3RL0 g;  3EFG A;  2YIU C;  2UWJ E;  4UB6 E;  4QNB A;  2CG5 B;  1NO4 A;  3KPE A;  2JBG A;  4U3F E;  4WY4 A;  3B4Q A;  3Q5S A;  2IFM A;  5KJ7 C;  4N78 E;  2RN0 A;  4OGQ C;  3H1H G;  3HD7 D;  1J1E C;  1JEK A;  2KG8 A;  2XXM A;  1P84 H;  4IFD K;  1S4X A;  1YQ4 C;  1VQ7 P;  2IZ0 A;  2HFE D;  2M8P A;  2P1J A;  2CQ8 A;  3H1K J;  3KHU A;  3MZW B;  3Q3D A;  2KIK A;  1KMI Z;  2L91 A;  4GKG A;  1DH3 A;  1FJP A;  4WY4 B;  3CWB D;  1JY2 O;  2DGY A;  2N9Y B;  2A06 G;  1WRG A;  2WSF J;  4N6J A;  3P05 A;  1KB9 I;  2KSE A;  2WMM A;  3TDK A;  2N6Y A;  4HH2 A;  1AQT A;  1KN7 A;  1U7J A;  3O8Z A;  1KD1 Q;  3CPW O;  1URQ A;  3RK3 B;  1YBK A;  1LTB C;  1SS1 A;  2BAS A;  1PIX A;  1LTJ B;  2KGE A;  1VQN P;  1S3J A;  2E74 B;  3SSU A;  1ACP A;  2QJK B;  3AE9 C;  2IYP A;  1LT9 A;  3P32 A;  1R5L A;  2LOL A;  3PH0 A;  3CX5 E;  3TK1 A;  1ZRT D;  3VMZ A;  4I1L A;  2HG5 D;  1K30 A;  2D2C D;  1ZME C;  2E75 B;  2PEI A;  2OAR A;  1RE3 A;  3DS2 A;  1KLP A;  2GDW A;  4WB4 A;  3GW6 A;  5EJD A;  1KQG B;  2AXT H;  3GG2 A;  2K93 A;  4XRQ A;  1CI6 B;  1FR2 A;  1J2J B;  4U0F A;  2IZ1 A;  1FZB A;  1BDD A;  1T6A A;  5B66 H;  3H1K D;  1L4A A;  2KW2 A;  4R4M A;  2E5T A;  2A45 I;  3H0D A;  2A45 G;  2JU1 A;  2K92 A;  1LWU C;  3KDP B;  1GL2 D;  2QG4 A;  2ERH A;  2KG6 A;  2L0Q A;  1SQV D;  3FXE A;  4AQR D;  4I7Z B;  1OVU A;  4DG9 A;  2XDJ A;  2GDX A;  4PD4 D;  2LR2 A;  2LF4 A;  2LKM A;  2XV6 A;  3G3Z A;  4PXH B;  2JYG A;  4BXL A;  1KB9 H;  3VMY A;  1P84 I;  2WSC H;  1NWQ A;  3CX5 H;  2AFD A;  1QL1 A;  2WVR A;  2RH0 A;  2HPC B;  1KFM A;  1USD A;  2ZYD A;  3S4R A;  2LXC B;  1R5S A;  3MUD C;  2E1M A;  4N78 D;  1ZR2 A;  1RQU A;  5EW5 E;  3CCV P;  5L8R J;  2HOD B;  2L5G B;  2W27 A;  1OR5 A;  3TGU G;  1KB9 D;  4L75 A;  2FQ0 A;  2XZ1 C;  4PJ0 H;  3LIE A;  2IBZ D;  5APW A;  5KLV D;  1YJ9 P;  3DS1 A;  1JY3 P;  1SQQ J;  1URQ D;  2VLQ A;  3MHV A;  4L76 A;  3P8C D;  1IK7 A;  1SQQ K;  4U7J A;  2NRG A;  2IX7 C;  5BU8 B;  4NPE A;  4BPG A;  3Q5R A;  3C8V A;  3H1H D;  5KLV E;  1RY3 A;  5HGO A;  3G9R A;  3BAT A;  5TJH A;  5K5G B;  4IL6 H;  1L2P A;  1M74 A;  1SQP E;  2KXP B;  1KYO H;  5F2K A;  5KTB A;  3RK2 C;  1KYO I;  4H13 D;  2AEF A;  2E43 A;  2KNC A;  1L0L D;  5E79 E;  2RKL A;  1Z6M A;  1KTM A;  1IMP A;  1NH4 A;  2PEJ A;  2H7H A;  1AJY A;  4COP A;  3H1L D;  5HGM A;  4IZ6 A;  1GL2 B;  1LJ2 A;  3CC7 P;  2WSF H;  2FHS C;  1VQM P;  3EFF K;  5KAI H;  4D6T E;  3V4Q A;  2BEZ F;  1MKM A;  4MRT C;  1LTI C;  2ZT9 C;  2WWW A;  1PP9 J;  1M6E X;  1XTG B;  1GMJ A;  2LKI A;  2O01 J;  1JCD A;  2G8Y A;  1FC2 C;  3HE4 B;  5BS2 A;  1RE3 C;  2KZJ A;  1SVF A;  1BE3 E;  1GW3 A;  1OX3 A;  4RO0 A;  3ZDM A;  1VHN A;  3L37 A;  1VQL P;  3LID A;  1NU1 J;  3P7K A;  4W80 A;  5GTI H;  1G2C B;  4GOE A;  5AW0 B;  5GTI E;  2N5H A;  5APV A;  2E75 D;  2PEO A;  3OA7 A;  4WBA A;  1KYO E;  1S5L X;  3M0A A;  4DJG A;  1NOH A;  3GHG A;  2PEK A;  3G29 A;  1CZQ A;  3H6P A;  3GZM A;  2PY8 A;  2FYZ A;  2MY5 A;  3A0B E;  1QRJ A;  1P84 D;  1NTK J;  2R5B A;  4L74 A;  1NAF A;  3VRL C;  1IFI A;  2EHS A;  3CCJ P;  2R5D A;  2K2Q A;  1SLQ A;  3CX5 D;  2PGD A;  2YKO A;  2E74 D;  1NTK K;  1YHQ P;  3M06 A;  2NPS A;  3VMX A;  3CWB G;  2OYI A;  2VLO A;  2JP3 A;  4TLF A;  3GZL A;  1VQP P;  1KV4 A;  5APQ A;  1Q82 Q;  4XFZ A;  3DS3 A;  3PP5 A;  5AW8 B;  3GF3 A;  5AVW B;  2KOP A;  4IPY A;  3RBZ A;  2PEN A;  2KS1 B;  2K37 A;  4WVZ A;  1LT9 C;  3NXS A;  5KP6 B;  5TIS H;  2JWD A;  2K9J B;  2QVA A;  1JO5 A;  2ONT A;  1X22 A;  4YXW H;  3H1I J;  1QLE D;  3CXH E;  3AED C;  2OYO A;  2W6B A;  5H2F E;  3A7O A;  1EDI A;  1AQ5 A;  1QGK B;  1P84 E;  1GDT A;  1VQO P;  3AE3 C;  5HGL A;  3T97 B;  3E2D A;  1NTK D;  4BPF A;  1JOC A;  1CI6 A;  4IFM A;  3H1H E;  2KOR A;  1ZXG A;  2QM7 A;  5KAF H;  4AUW A;  5F2N A;  1E5W A;  2P2U A;  3HD7 B;  1AVY A;  1M1K Q;  1PPJ G;  1G1I A;  2W6A A;  4HKZ H;  3H1L J;  3C1L A;  2YKQ A;  4PD4 E;  4UB8 E;  3VN0 A;  3T97 A;  1RO2 A;  1A43 A;  3HTK B;  2OYH C;  2JWA A;  5APT A;  1L0N E;  1SQB G;  3LW5 H;  1A02 F;  3L71 E;  4QMA A;  5APS A;  4U0A A;  3CCL P;  1PEQ A;  3RL0 C;  1AUM A;  2KLU A;  4BWN A;  4H2X C;  2GM4 A;  5CCH A;  1T2K C;  1ZMB A;  2MVV A;  5B5E H;  4HKG A;  5B5E E;  2FFD C;  2WTY A;  2CGQ A;  3ABV C;  5CCH C;  1YTZ I;  2KGD A;  2KB7 P;  1AFO A;  2O1K A;  1NGM B;  3CCM P;  1LTJ C;  2ROQ A;  2QJY C;  1W2E A;  2LML A;  3CX5 I;  1Z56 A;  1M7L A;  2XU6 A;  3A0H H;  3WBH A;  3WUU A;  3L75 D;  1JNM A;  1HVV A;  4UHP B;  5KLI B;  1RNI A;  1H88 A;  1LT1 A;  2BEQ D;  2N1T C;  2VLP A;  5AW4 B;  2J5U A;  5KLV G;  3E1I A;  1NKZ B;  3SWK A;  1OVR A;  1FZA A;  2P58 A;  1Q90 D;  2Q1K A;  5CZD B;  3VTP C;  1KC8 Q;  1ZRT E;  3G21 A;  3TF5 A;  3JCU H;  4YXD C;  3IFM A;  1YJN P;  1MV8 A;  2J58 A;  1WT6 A;  3FXD A;  2SPZ A;  2KUB A;  1GZL A;  1PGJ A;  1X8Y A;  1NTZ K;  2O01 H;  1QVF O;  3L74 J;  4WWI A;  1QEX A;  1L0L G;  3U1A A;  3PJS K;  4GIF A;  4JF7 A;  3M9B A;  2B87 B;  1IFD A;  3B5N D;  2KOG A;  5AW9 B;  3V2P A;  1DD3 A;  4U3F J;  3W67 A;  3RBX A;  4I7Z C;  1IK9 A;  3S9O A;  2KR5 A;  5H2F H;  1VQ8 P;  1DEE G;  1GL2 A;  2MKV A;  2Q5U A;  2HPC A;  4M0I A;  1GD2 E;  1BCC G;  5KKZ C;  1R8E A;  2EIA A;  3U43 A;  1L0L J;  1UIX A;  3A3Y B;  3KXD A;  3GHG C;  3I55 P;  1JY2 P;  1FS0 E;  3TGU D;  2Q3I A;  4OGQ B;  2POH A;  1QL2 A;  1OMI A;  5F2O A;  4RJT A;  2N1T D;  2H43 A;  1IC2 A;  1G2C A;  2IBZ G;  3NFQ A;  2VLN A;  4KHX A;  3USS A;  4I6M C;  3MIW A;  3G0V A;  5KLV K;  2BCC E;  1Q86 Q;  1KZU B;  3L71 G;  1FDM A;  3JC2 2;  2JB0 A;  5CCG A;  2KSJ A;  1SQP K;  5KLV J;  3Q1M A;  3L73 E;  2M3E A;  3L73 G;  1OWA A;  1Q7Y Q;  1VQ6 P;  2A45 H;  1EDJ A;  1K8A Q;  1CSB A;  1GTW A;  5DCK A;  3PTZ A;  3EJD A;  4Z1M H;  4RES B;  5GTH H;  4LLH A;  2K0X A;  2Z44 A;  4OGQ D;  2L9F A;  3L75 G;  3BVH A;  2JO1 A;  1S1C X;  3FWL A;  1X79 B;  3IN6 A;  3ITK A;  3SWF A;  2KGA A;  3AE2 C;  3O6Q A;  1BGY E;  1K9M Q;  1BGY D;  1VDF A;  1NTM G;  3CC2 P;  2ZVO B;  1BCC J;  1NTM E;  1L4A B;  1H0T A;  2Z5I A;  2BQ1 E;  3M9H A;  4R0M A;  4ZMD A;  2Z5H A;  1D1D A;  3KZI E;  1M1J B;  4OWF A;  1RE4 C;  1BCC D;  1IFM A;  2WPT A;  1FDO A;  3BCC D;  2NO8 A;  3VOP A;  3SFD C;  2IBZ E;  2WPR A;  2AEM A;  1Y47 A;  1L0N D;  4BRY A;  1PPJ D;  2JGP A;  3TNU B;  1U7M A;  2M8L A;  1HF9 A;  3MP7 B;  1Y9B A;  2Y0E A;  2C9L Y;  2GZE A;  2Q6Q A;  5GTH E;  4PV1 D;  1S9K E;  2FQ1 A;  1URQ B;  1PZQ A;  3L70 J;  3CI9 A;  2Z46 A;  1DD4 A;  3RL0 D;  5APU A;  2WPS A;  7CEI A;  3G71 P;  4DOJ A;  2YNY A;  2YKP A;  1ZNV A;  1BE3 J;  4ASW A;  3L4F A;  3TGU J;  2M8N A;  3GMA A;  2OYH A;  5AVS B;  3Q5P A;  2E5Y A;  2WSC J;  2MR8 A;  2VSQ A;  3CL3 D;  1KIL E;  3A5T A;  1YIJ P;  2KK7 A;  2K0D X;  2WT7 B;  2FVA A;  2D2C B;  2KGC A;  1LTA C;  2DNW A;  1FDI A;  1NKN A;  2YO3 A;  1M8O B;  1KFN A;  3V4W A;  1NTM K;  2KYV A;  2QJY B;  1LWU A;  4DZO A;  1DEB A;  3MGE A;  1PGO A;  5AW6 B;  4HJG H;  1QX8 A;  1NTM D;  3H1I D;  5B66 E;  1USE A;  1WMK A;  1AYI A;  3H1K G;  5AVQ B;  4JQ0 D;  3JSV C;  4Y28 J;  4GR2 A;  1W5C E;  1OIP A;  3RG6 C;  2K9J A;  3B4S A;  2MD9 A;  2JR8 A;  3D71 A;  3FWN A;  3H1L E;  3II6 A;  1EOQ A;  3NY7 B;  1RO0 A;  4H0L B;  2MJZ A;  2E76 B;  3GKL C;  5KP7 B;  4U0B A;  2N9B A;  3AE7 C;  3B71 A;  3G1G A;  1JTH B;  2M5A A;  3HUS A;  3PLN A;  1FZC B;  2BCC J;  1KOR A;  2AXT E;  1BE3 D;  1NHL A;  1JUN A;  4LGD E;  1M56 D;  3HE5 A;  3L35 A;  4BRY B;  4PH0 A;  4CA3 A;  3W68 A;  3MGN A;  2BCC D;  2E76 D;  1EQ7 A;  2HOD A;  1MZ9 A;  3WUV A;  1NU1 G;  3L72 J;  4D6T D;  2HYN A;  2PP6 A;  2XZR A;  2A06 D;  1NAY A;  4YTP C;  1SQX E;  4OVN F;  2R3S A;  1JY2 N;  4OH8 B;  3L70 D;  5HGN A;  1VQ9 P;  1EZV D;  2JYL A;  3SFE C;  4GR6 A;  1AF8 A;  2V4H A;  5EFW B;  4XE5 B;  4WY4 C;  1LTS C;  2JU2 A;  2JQ4 A;  3HE4 A;  5HVC A;  4EYY Q;  3RK3 E;  1M1J C;  1EIA A;  2GZJ A;  3GJN A;  4TT3 H;  1EDL A;  1Q81 Q;  4PJ0 E;  2WT7 A;  4IL6 E;  2D2C C;  2WQY C;  4C7R A;  1H0T B;  5AVR B;  1KQL A;  2FYU J;  1QVG O;  1NTZ D;  1S2E A;  1OXZ A;  2QA4 P;  3L72 E;  2IYO A;  3AEE C;  3NMD A;  1LGH B;  5CMZ A;  3AE1 C;  3H25 A;  1PEO A;  1DIP A;  2K94 A;  2FAD A;  3BAS A;  1EXJ A;  2O1J A;  1PP9 D;  5KAF E;  3PHL A;  1FZE A;  2OYH B;  2B9B A;  5AW3 B;  2M3B A;  3GLM A;  2AFE A;  1X0T A;  4PD4 I;  3L73 J;  1FAV A;  1M90 Q;  2WPQ A;  3WMM 0;  4U3F G;  4UB6 H;  1PEM A;  3BCC E;  4L73 A;  2FFD A;  5AVT B;  2JAZ A;  4ZNC A;  1MFT A;  2QJP B;  5DJU B;  3FGA D;  1NTZ J;  3G28 A;  2G3A A;  4JBZ A;  2MF4 A;  2KLV A;  3CXH I;  2LIW A;  5KJ7 D;  1KIL A;  3RK2 B;  4U0E A;  4Y99 C;  2H88 C;  2QE7 H;  1L4A D;  2AXC A;  1RF0 A;  4NPD A;  1OW7 A;  1FBM A;  1LP1 A;  3TYY A;  1VKU A;  3A0B H;  1J1D B;  3L73 D;  2P10 A;  3B5I A;  2P7J A;  3PRJ A;  1NU1 D;  1HJB A;  2BHV A;  3D6Y A;  2HR3 A;  5CBO A;  2DW3 A;  4Y99 B;  4W7Y A;  3M0D A;  1VF5 C;  1BSN A;  1J1E B;  2Q7C A;  3Q20 A;  1YJW P;  1X3O A;  4IOI H;  2V7Q H;  3DTJ A;  2XND H;  1NVO A;  2FQ2 A;  1JB0 J;  2ZXE B;  4GOD A;  4UB8 H;  2FVF A;  2WSE H;  2Y9Y A;  2C0X A;  1HGV A;  1T8K A;  3D6Z A;  1MZ8 A;  1JY3 N;  2PEM A;  3L72 D;  1L4A C;  2EHT A;  1XTC C;  1T3U A;  5KP8 B;  1PP9 G;  3P8C E;  3F89 A;  3TNU A;  1EZV I;  3CCU P;  5BVZ A;  1SQP J;  4COC A;  2K9Y A;  1LTT C;  1L0L E;  4EOT A;  1EC5 A;  1N8R Q;  3DS0 A;  1JTH A;  4D6T G;  1JY3 O;  3SWY A;  3M91 A;  2Y0D A;  1HJ0 A;  2FAC A;  4PH1 A;  1IMQ A;  4IFF A;  2E74 C;  2OTK E;  4B86 A;  2GYK A;  3EJE A;  3E7K A;  1OZH A;  1PGQ A;  1OW8 A;  1BCC E;  3OW2 O;  3G26 A;  2FFD B;  1EZV G;  1HGZ A;  1N7S D;  4XFX A;  2WSE J;  2I1K A;  3HUS C;  4U3F D;  5CJ0 A;  2I8D A;  4IL6 X;  1PPJ E;  1D7M A;  1GL2 C;  3K5B A;  1EDK A;  1N7S A;  2E75 C;  1IJD B;  4H44 B;  1ZN5 A;  1SQV E;  2YXR B;  1DV5 A;  1A8O A;  1FZC C;  1ZP0 C;  3R2P A;  1YQ3 C;  3L36 A;  4R4L A;  1N2D C;  2N1T B;  1S9K D;  2Q9I A;  5AVU B;  5CCG D;  2YMK A;  4A7P A;  3M9Q A;  1GW4 A;  2QM8 A;  1VQK P;  4MN4 C;  1GXH A;  4WYM A;  3AE5 C;  4YPC A;  1ZV8 A;  1OVV A;  3AEG C;  3R4Y A;  2CNR A;  3HD7 C;  1HTL C;  1CW5 A;  5BU5 A;  3HRN A;  3S1K A;  1PL5 A;  3H32 B;  2BCC G;  1ZOY C;  2NZ2 A;  1GU4 A;  1Q2N A;  5KJ7 A;  4DT0 A;  3CE7 A;  2CPB A;  2CK3 H;  2K5X A;  3L75 J;  1FU1 A;  1OW6 A;  1SQV J;  3AEC C;  2ITA A;  3B5N B;  3OAK A;  2QSI A;  2FYN B;  1CEI A;  1LNQ A;  1GXG A;  2K3R A;  2R3C A;  2M5R A;  2EFJ A;  3A0H E;  2P9X A;  4PWV B;  3RK2 D;  1ZW0 A;  3H1L G;  4M3L A;  3CC4 P;  3MUD A;  1S72 P;  3CLQ A;  1SQB K;  1SQQ E;  3H32 A;  3WU2 E;  1MFZ A;  1S5L H;  2FXM A;  1SQQ G;  1SFC D;  3U1C A;  1SQB J;  1BSH A;  5CBN A;  4K3A A;  4HYT B;  1HWT C;  1SQP D;  2GZG A;  1PP9 E;  3HE5 B;  3EJB A;  3IR9 A;  3L74 G;  2LTE A;  3AEA C;  2JO0 A;  2B88 A;  2QIW A;  5KLI C;  1OFC X;  3U59 A;  1MUU A;  5C39 A;  2XZ0 D;  1L0H A;  3MD0 A;  1PEU A;  3HUS B;  3H1J D;  1M1J A;  1EXI A;  1KQF B;  2QRX A;  5I4T G;  5DJT B;  1L0N K;  2KG9 A;  3KYQ A;  2ZYG A;  3WU2 H;  1RQV A;  1L0N J;  3L70 G;  2FY8 A;  2PFX A;  1E0H A;  2R44 A;  3O6Q B;  2OYI C;  1EZV E;  1F80 D;  2MR7 A;  1UII A;  1N73 C;  1UJZ A;  1T8Z A;  1VQ4 P;  1SQX D;  4K35 A;  2VRS A;  1M57 D;  1LP1 B;  1SQX K;  3AEF C;  1NTZ G;  1FZG A;  1VPC A;  2XKM A;  4NEO A;  3NTN A;  2PNG A;  1RF1 B;  1SQX J;  3OJA B;  1IFP A;  2KS1 A;  3V2N A;  3L71 J;  2FYU D;  3H47 A;  3RK3 D;  4JYB A;  2JJL A;  2PRR A;  1JCC A;  3CCR P;  3CMA P;  2EG5 A;  1ZR4 A;  1KB9 E;  1IZN B;  1NQ4 A;  2H89 C;  3GHG B;  1T2K D;  2NPS B;  2IBZ I;  1AVO A;  2K0Y A;  4DCK A;  3L75 E;  3G1I A;  2ZAE B;  4WY4 D;  2XV5 A;  2ZFC A;  1LTG C;  1NTK G;  3E1R A;  2M0B A;  2YIU B;  1PGP A;  2WIT A;  3HYB A;  3NTE A;  2H8P D;  2Q3E A;  2LPK A;  1PV3 A;  2NPS C;  3M1M A;  3H1K E;  1H8A A;  1IFJ A;  4H0L D;  3EWK A;  1L0N G;  4KJM A;  3QWO C;  3HTK A;  3LMO A;  1SQB D;  1GPJ A;  2ZYA A;  1NYH A;  1N7L A;  3B5N A;  1YTZ T;  2YMY A;  3IAO A; 
#chains in the Genus database with same CATH homology
 2Z46 A;  3G71 P;  1M90 Q;  3CCU P;  1VQO P;  1M6E X;  1KC8 Q;  1VQ4 P;  1Q7Y Q;  1VQ6 P;  4PH0 A;  1VQN P;  4COC A;  5HGL A;  3G21 A;  5BS2 A;  2E1M A;  3E2D A;  3CD6 P;  1NJI Q;  1PEM A;  1K8A Q;  1YJN P;  5DCK A;  1E6J P;  3CCV P;  1IUQ A;  3CME P;  4XRO A;  5F2N A;  2M8N A;  2Z44 A;  4XFY A;  1M1K Q;  1QVF O;  1N8R Q;  3DS0 A;  2OTJ P;  1VQL P;  2EFJ A;  3G28 A;  3DS4 A;  4PH1 A;  1RO2 A;  2P9X A;  1A43 A;  1K30 A;  1YIJ P;  5BS1 A;  3H47 A;  2PEO A;  1YJ9 P;  3DS1 A;  1M6N A;  4QNB A;  3CC4 P;  1S72 P;  4U0D A;  2PEI A;  2OAR A;  3CCE P;  3CXC O;  3CCR P;  3CMA P;  4U0E A;  2EG5 A;  3OW2 O;  3G26 A;  5HGN A;  1VQ9 P;  3G4S P;  3DS2 A;  2JYL A;  1K9M Q;  4GR6 A;  4XFX A;  1K73 Q;  3H4E A;  4U0A A;  3CCL P;  3G29 A;  2PEK A;  3CC2 P;  1PEQ A;  1VQ8 P;  5JPA A;  4XRQ A;  1AUM A;  2XXM A;  2L6E A;  2BUO A;  2PY8 A;  4U0F A;  3MGE A;  1YIT P;  1EIA A;  1QRJ A;  2CWO A;  2KOD A;  3G1I A;  2JO0 A;  4M0I A;  5HGO A;  1ZMB A;  3VRL C;  1VQ7 P;  3CCJ P;  3DS5 A;  3B5I A;  2BQ1 E;  1M74 A;  2XT1 A;  1Q81 Q;  2EIA A;  2M8P A;  2Z45 A;  1W2B O;  1D1D A;  5F2K A;  3DPH A;  1YHQ P;  2BHV A;  1QVG O;  3H0D A;  3HZQ A;  1A8O A;  2QA4 P;  3HYB A;  4GR2 A;  3G6E P;  1PEU A;  3CCM P;  3RG6 C;  3I55 P;  1VQP P;  3NTE A;  1BAJ A;  3Q20 A;  1YJW P;  3CCQ P;  1Q82 Q;  4XFZ A;  3DS3 A;  3M1M A;  1EOQ A;  1KQS O;  3DTJ A;  2DGY A;  1RO0 A;  2PEJ A;  1PEO A;  5F2O A;  5I4T G;  4U0B A;  3WBH A;  3P05 A;  2LF4 A;  4IPY A;  2PEN A;  3LRY A;  4COP A;  1RNI A;  5HGM A;  4U0C A;  2M8L A;  1VQK P;  3G1G A;  3I56 P;  2OTL P;  4WYM A;  2PEM A;  2ONT A;  3CC7 P;  2PEQ A;  2XV6 A;  2QEX P;  1VQ5 P;  2JYG A;  1VQM P;  3G0V A;  1JJ2 O;  1YI2 P;  3CCS P;  1KD1 Q;  3CPW O;  1Q86 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...