1VQMP

The structure of the transition state analogue "dan" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
143
structure length
143
Chain Sequence
b'TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 46
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1vqmP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1vqmP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1vqmP02
3CCJP 3CCRP 1W2BO 1K9MQ 1VQPP 1YJNP 1QVFO 3CMAP 1KQSO 3CCLP 3I55P 3I56P 1VQKP 2OTLP 2OTJP 1YJWP 3CPWO 1KD1Q 2QEXP 1M1KQ 1QVGO 2QA4P 1YIJP 3G6EP 3CXCO 1YHQP 3CMEP 3G71P 1YI2P 1M90Q 1N8RQ 1Q86Q 3CCUP 3CCSP 1JJ2O 1NJIQ 1VQ4P 1VQLP 1Q81Q 3CCQP 3CC2P 3CCEP 1VQMP 1K8AQ 3CCVP 3OW2O 1VQ5P 1VQ8P 1VQ6P 1VQNP 3CD6P 1Q82Q 3CCMP 1VQ7P 3CC4P 1K73Q 1S72P 1YJ9P 1KC8Q 1VQ9P 3G4SP 1Q7YQ 3CC7P 1YITP 1VQOP
chains in the Genus database with same CATH superfamily
2AF8A 3V2RA 2AXTH 2N1TC 4WY4A 3KPEA 3GLMA 2N6ZA 2N98A 2KS1A 2KGEA 2KOPA 1HBWA 3P05A 4DJGA 3H1HJ 2P7JA 4IL6E 3DPHA 1NTMG 1NTZJ 2VLOA 2L91A 4U3FE 1DIPA 1BCCD 3AE5C 2K1AA 3M0DC 2FADA 2L9FA 3G3ZA 2M8NA 3BVHA 3D70A 3CCMP 2IZ1A 2Q1KA 1PFIA 1KFMA 1LTTC 1H8AA 3V6IA 1PEMA 1KLPA 1LTJC 2OYOA 2N6YA 3LW5J 4WVZA 4ASWA 2LXBA 2JKVA 1GU5A 2N5IA 3RK2C 1HVVA 2ZXEB 2A45H 5GTHE 1JTHB 4Y28J 1VHNA 2K0DX 1SQVE 3LIDA 2KSEA 1NTKE 2GZIA 1VQ4P 2D2CD 1A43A 3CXHH 1BCCJ 5TJHA 1T2KC 1U7MA 1Y9BA 1FU1A 1RE4A 4N6JA 3RL0B 1IK7A 1H88A 1A02F 2YO2A 4H0LD 3ABVC 1UIIA 4PV1B 3CX5E 5KP8B 3AE3C 2E76C 1EDLA 3RK3E 2WPTA 4MN4C 2Y0EA 1Z6MA 5AVTB 4B86A 1NYHA 3MIWA 3S1KA 2GA1A 1NO4A 3K5BA 1ZP0C 3G4SP 1Q7YQ 2PENA 1UNKA 3A7OA 1JUNA 2QM8A 1QRJA 2ZYAA 1OVUA 1K04A 3L35A 3V4QA 2ZYGA 3CWBG 4NEOA 2QRXA 1QX8A 2E75D 1YJ9P 5K5GB 2OYHC 2IBZE 1X8YA 1LP1B 4LLHA 2E5TA 2GYKA 2WPSA 4QMAA 1BGYG 2KB7P 1Z56A 2H8PD 3L36A 5KKZC 2OYIB 1SP4A 2O01N 2UWJE 1H89A 1L0NE 1NU1E 5EW5E 1GTWA 2WPQA 1VQ9P 5AVZB 4BRYA 2Y9ZA 4WYMA 2QNWA 2WPVB 1G2CB 3BASA 1HQBA 2D2CB 5CCHA 1A02J 2GUSA 3TNUA 3BCCG 3M1MA 2KXPB 3EFGA 1DD3A 2XZ0D 2HPCA 4M0IA 3S9OA 1U57A 4M3LA 1IMPA 5B5EE 5KAIE 1L0LE 4H0LB 1RF1C 2WSCH 1GXGA 1RQVA 2FYUD 3CCLP 1J1EB 3QH9A 2A45I 5AVYB 1SQXK 4NPDA 1YJWP 5AVUB 1EZVD 4N78D 1JCCA 2W6BA 2L0QA 5AVVB 1AA0A 2A06E 1NWQA 1IFJA 2E76D 2JWAA 4C7NA 3CC4P 1ZOYC 3EFFK 1N7SD 1YQ4C 2O3JA 1FZEA 4O9BA 1LT9A 1GDTA 2LPKA 4U0DA 1FDIA 2LR2A 1IZNB 1M1JB 3HTKB 1L4AC 4F37A 1EZVI 3V2PA 2E75B 2FYUJ 3IF4A 2K9YA 2W90A 2WITA 4JBZA 2FKWB 1SQBG 5AW0B 3L75G 1M7LA 1E79H 1LWUC 1MZ9A 1AQ5A 2AEJA 2IYOA 1T8KA 2RN0A 2FXOA 3CCVP 1ZMBA 2GM4A 3G0VA 5APVA 2PAJA 2BHVA 5BS1A 1QL2A 1KILC 2R44A 2K94A 1IFDA 3JCUE 3V4WA 1OFCX 2BUOA 2QJYB 3WUTA 5CBOA 2VLPA 1PGQA 2HODA 3VMAA 3GHGA 3M0AA 2HFED 2POHA 2Q7CA 4U3FD 2PEQA 3H1HE 4UB6H 1CW5A 4KHXA 1FJKA 5F2KA 3A0BH 1NTZE 1WT6A 1IC2A 3L74G 2JU2A 2E76B 3OAKA 1M8OB 2W83C 3A5TA 4GOEA 1N7SB 4U0AA 4W7YA 2KWLA 3G26A 1SQQG 2Z5HA 2OTKE 4EI2A 4U3FJ 5KTBA 1J2JB 1EXJA 1URQA 4LGDE 2IFMA 5M1BA 4Y99C 1L4AD 1G1JA 5TISE 3L72G 2ZYDA 2FHSC 1BCCE 3CX5D 1MV8A 2IX7C 2K3RA 4XROA 1BDDA 1SQPG 3FWNA 5APQA 2JU1A 2GUVA 3OJAB 3GZMA 3B4SA 3VP8A 5KKZB 2AEMA 1KB9H 2WSSH 3OA7A 1OXZA 1LTBC 7CEIA 4ZKUA 3KYQA 3H32A 2K93A 2N9BA 2MKVA 4BPGA 2N9YB 1P84H 3G21A 1RE4C 1OW6A 3FXEA 4K3AA 2WQYC 3U1CA 2IBZD 3H1JG 2LF4A 3R4YA 2M5AB 1SFCD 3P8MC 3HE5B 5KLVD 1L0ND 2KI7B 1KQSO 4NPFX 5HVCA 4JPZB 2JDIH 1DD4A 3E1IA 2EG5A 5KP6B 3HUSB 3G29A 2ZXXA 1ZLLA 2LKMA 3D71A 3CWBD 2BEZF 1L0IA 4GDOA 5KLVJ 1L0LD 3H1LE 1L0NJ 1L4AB 3GMAA 3KHUA 1BE3G 1F80D 2K88A 2W6JH 5KLIB 1BGYD 3VRLC 2DNWA 4Z1MH 2DW3A 5AW7B 1RH5B 2BCCG 2VSQA 2NPSA 3B5NA 3RG2A 1IK9A 1AYIA 4ZNCA 3BRTB 5CCHC 1JMBA 1Q86Q 3CWBJ 1JM0A 1ZR4A 1VQ7P 1L0LJ 4TT3H 2R5DA 2K9JA 2KODA 2CWOA 3MD0A 4KJMA 1N73B 2LOLA 2IZ0A 2C0WA 2PEOA 1YJNP 3T97B 1BGYJ 2M3BA 4I7ZC 2FVEA 4D6TG 1OW7A 2LKIA 1ZXGA 1NH4A 1JOCA 2FXPA 5C39A 3C8VA 2WMMA 3G71P 1OWAA 2CK3H 1SFCB 2FYUE 1R5SA 2Y9YA 3TYYA 3WUUA 4H2WC 4C46A 1EZVE 4N78E 4HB1A 2Z45A 1PP9D 1PV3A 3UIAA 2ERHA 5L8RJ 3HZQA 2XT1A 3HRNA 1HGVA 4BPFA 3M91A 2LL8A 1GW3A 1KQLA 1YTZI 3L70G 2FFDA 3HD7C 3Q1MA 3B4QA 3MGEA 5E79E 5CHXA 3EQ2A 3B71A 4AQRD 1VDFA 3RBXA 2PNGA 2JAZA 1NTKK 5CCGA 1FZCB 1SQBD 1PP9J 3L75D 2J58A 4A7PA 1U7JA 1DEBA 2V7QH 2PP6A 5AW4B 4MRTC 5APTA 2KZIA 3NMDA 3U43A 2YIUC 2WT7A 1BXIA 1FZFA 2IPPA 2KR5A 2FYZA 3TF5A 2KZJA 2KGAA 1DH3A 2KYVA 1PEQA 2YKQA 3G9RA 4YXWH 3MUDC 2E74D 1SQBJ 1M6EX 3GHGC 4TLFA 1OIPA 1OMIA 3L75J 5DJUB 2MVUA 1DEEG 3DTJA 1IJDB 3ITKA 5H2FE 2XV6A 2WVRA 1QL1A 1SQVG 4AUWA 3NY7B 2QJKB 3AE9C 2PEMA 1CI6A 2K0XA 1T6AA 1GL2C 4WBAA 3L74D 5AW8B 4U0CA 3AEBC 2W27A 3L71G 5KLVK 3CL3D 1L0NK 2WPRA 5KJ7D 3Q5RA 1NU1K 2FYNB 1RHZB 1HJBA 5APSA 2XNXA 1URQC 2G8YA 3KZIH 4YXDC 3HD7D 1ZNVA 5APXA 4PH0A 3U1AA 4PJ0E 3AEFC 5HGLA 2C0XA 5AW9B 2V4HA 1S9KE 4UB8H 1NTME 2XU6A 2OTLP 3L74J 1WRGA 1AQTA 1HUCA 1BDCA 2ITAA 2KG8A 1GW4A 1LGHB 1KQGB 4H2YC 1L0LK 1WMKA 1AVYA 1KZUB 5DCKA 2JO0A 3KXDA 2M3EA 2J59M 2WSEJ 3H1KG 1KTMA 3HYBA 3WUVA 2EFJA 2SPZA 2JYLA 3D6ZA 2E74B 2N1TD 3AEGC 1VQ5P 1KFNA 3H1LD 1JTHA 3GJNA 4UB6E 2ROQA 5CZDB 1D1DA 3SWKA 2ZT9C 2MF4A 1RF0A 4JQ0D 5KLVE 4DCKA 2N50A 2B87B 3LRYA 2WWWA 1RNIA 2XNDH 2KG9A 1E5WA 1Q82Q 1J1DC 2KNCB 3N4XA 5AW3B 1VQLP 1JY3N 3C9IA 1L0HA 2JYGA 4JYBA 3GF7A 3W67A 1UIXA 3MHVA 3H1LJ 1KD1Q 2KORA 3CXHD 3RK2D 1USEA 3HD7B 2MR7A 3FGAD 1X22A 3CWBE 3Q2YA 2PEIA 3NFQA 1FZGA 1T2KD 2L4BA 4GR2A 1IUQA 3I56P 1BE3D 2MJZA 1BGYE 4IFDK 1GMJA 4XFJA 2FACA 3DS1A 1YIJP 1KORA 3B5NC 1Q2NA 1D7MA 4ZKPA 5CJ0A 3A3YB 3CXHI 1LP1A 2BCCD 1AV1A 3H6PA 1NQ4A 3WU2E 4IPYA 2JB0A 4OGQC 1JY2N 1NTZK 4PH1A 1YTZT 2YIUB 2OYIA 3A0HE 2B87A 1CSBA 1Y8AA 2N1TB 3PH0A 1ZRTE 3BCCE 1P84E 4WB4A 4HKGA 3VP9A 1NJIQ 2QSIA 1PZQA 1BE3J 1USDA 5BS2A 4D6TD 1G2CA 4PD4H 1KC8Q 1W2EA 3GG2A 1KYOH 5KJ7A 2L6EA 1OR5A 4PWVB 2BCCJ 2QJPC 3GZLA 3C1LA 3V2NA 3EJBA 1SQXG 2CG5B 5HGNA 1PP9E 4U7JA 1VF5C 3DS5A 4RESB 1PL5A 2FFDC 2WZ7A 1H0TB 1X3OA 3E7KA 1LTJB 1YYCA 4D6TJ 4H13C 4KT0J 1ZV8A 3RK2B 3CPWO 4DOJA 5CCGC 3NXSA 2YXRB 2I1JA 1RY3A 1SQBE 2E43A 2OGUA 2KUBA 3L75E 5AVWB 1M1JA 3RGUA 2L22A 3O6QB 3HTKA 3VMYA 5JPAA 1FBMA 2ONTA 2JP3A 2KOQA 4XRQA 3FX0A 3G6EP 2J5UA 4WY4C 1YI2P 1PGJA 2CPSA 2AEFA 1BCCG 4L73A 2GZEA 2Y0DA 3G1GA 1NKZB 3VN0A 3M0DA 2WSCJ 2Z4EA 1QVGO 1N8RQ 1YBKA 2HYNA 3IFMA 3H47A 1S9KD 2AXCA 4PD4D 5B66E 1NTMD 4L74A 1GK6A 2OYHB 2CQ8A 3G1IA 1W5CE 4K35A 1VKUA 2PGDA 4JYCA 1QGKB 2IYPA 3L74E 2FQ1A 5KAIH 3EWKA 4L75A 1PEOA 1PPJG 3CCUP 1M74A 1BSNA 2IFNA 1X0TA 4H44C 1X79B 4PD4I 1KYOI 2ZVOB 2KIKA 1A8OA 1SQQE 4CPGA 1NTMJ 3TDKA 1HTLC 1KILD 2P67A 3WBHA 3CXCO 3MGNA 1N7SA 5I4TG 2KLVA 2PEJA 2XZ1C 1K05A 4ZMDA 1VL2A 1AJYA 3L72E 2LTEA 3DS0A 3O8ZA 1FOSE 3CC7P 1NGMB 2BQ1E 1M57D 1RF1B 1SQPE 1FAVA 1PIXA 4XA4A 2I8DA 1ZW0A 5KAFH 3SFDC 1XTCC 4AYCA 2H43A 2FYUK 2RKLA 4R4MA 2AXTE 2GDYA 1X9VA 3H1KD 4GIFA 3P32A 2KGDA 5GTIH 2JJLA 3L73G 1LJ2A 3SSUA 4WWIA 1RF0C 2M8LA 4I1LA 2PEKA 1S72P 4L76A 4COPA 4LC1A 1PGOA 3RL0C 3GW6A 1KV4A 3H1KJ 1LWUB 1EXIA 4PV1C 3AE7C 3E2DA 1S5LH 5AVSB 1ACPA 1KB9D 2M5AA 4EOTA 1MUUA 3HE5A 2YMYA 2BEQD 3PHLA 3TGUG 4IOIH 3N7NA 3BATA 3H1IG 1ZRTD 3CXHE 3BCCD 3KZIE 3HE4B 3AEAC 5APUA 1P84D 1FDOA 1KILB 2WTYA 2L5GB 1NKNA 3CMAP 3ZDMA 2XV5A 3HUSA 1KB9I 3RG6C 1JY3P 3D6YA 3LW5H 1BE3E 1K73Q 1L2PA 1LTSC 1AF8A 2XDJA 2MVVA 2CPBA 5CMZA 1P84I 4COCA 1L4AA 1N2DC 2BCCE 2OYIC 4QNBA 4RKUJ 3BCCJ 3P8CD 1LT9C 2P10A 5HV8A 3NTEA 2R3SA 3H0DA 3FXDA 5HGMA 5AW2B 2KS1B 1LWUA 1R8EA 2WSFH 2OARA 3B8EB 5F2OA 2O01H 2KGCA 3CI9A 1ZN5A 4HKZH 2D2CC 1CEIA 2AVAA 4QKOA 4YTPC 4D6TE 1AFOA 1M90Q 2FXMA 2Q6QA 3CC2P 4HJGH 1VQ8P 1JY2P 4Y99B 3HE4A 1Q90D 2ZAEB 1N73A 4H0LC 3AE6C 3T97A 1NTMK 1SQXD 1J1EC 1LTGC 3JC22 4U3FG 3VTPC 2EIAA 2OTJP 1HF9A 2KOSA 1SFCA 1ZMEC 1S3JA 2GZFA 1EDIA 3Q5SA 3L70E 4EIJA 5CCHD 1XTGB 2FQ0A 2VLQA 3DS2A 5CBNA 2YNYA 1RE3A 1FZBA 1IFPA 1M1JC 4DZOA 1SQXJ 1NTKG 1QEXA 3U59A 3CMEP 2E75C 3VYIA 4HH2A 4PXHB 2M0BA 1OVRA 1FOSF 2YKPA 3LIEA 4R0MA 1FZCA 2KK7A 1UJZA 1QVFO 3II6A 1QLED 2R5BA 2KLUA 2H88C 1SQQD 1GU4A 1OX3A 1PGPA 1JCDA 1FJPA 2KOGA 3KQGA 4OH8B 2NO8A 2O1JA 5BU5A 2QJYC 4PD4E 2P2UA 1IFMA 1KYOE 4IL6X 1RO0A 3L72D 1IFNA 1MFTA 1EC5A 4NPEA 1SQPD 4JF7A 2MY5A 2IBZG 1MFZA 1KMIZ 2CNRA 1VQOP 1IFIA 1SQQJ 1MKMA 1W2BO 1PPJD 2WSFJ 4BRYB 3L71E 2O01J 2P58A 5APWA 5KLVG 1L0NG 4GODA 3IR9A 3TNUB 5EFWB 1NU1G 5BVZA 1N7SC 2Z44A 3L72J 3IAOA 1KILE 4OWFA 2HPCB 1M6NA 2GDWA 2V7QJ 1SQPJ 3BRVB 3CCRP 3SWFA 3PP5A 3H1JD 4CA3A 2K2QA 1TU3F 3L4FA 4I7ZB 5E79H 2QA4P 1YQ3C 1HJ0A 3MP7B 3A0BE 3GF3A 1RQUA 3Q5PA 2Q3EA 2JO1A 1EDJA 1VQNP 1L0LG 1T3JA 4C7NB 3R2PA 1GL2D 2M8RA 3AE8C 3H1KE 2LIWA 1ZR2A 1R5LA 2N5HA 1SS1A 1LT9B 3I5CA 1YHQP 2A06G 5CJ4A 3RL0g 3H1JJ 2BASA 3PLNA 4OVNF 3WMM0 3L73D 1URQD 1HWTC 1M1KQ 4DT0A 4UHPB 1JNMA 1BAJA 3VOPA 1SLQA 5EJDA 4IL6H 2NPSC 1NAFA 1SQBK 1N7LA 3PTZA 2NRGA 5H2FH 2PRRA 1JB0J 4W7ZA 3GKLC 2JBGA 1KB9E 2PFXA 5DJTB 2FVFA 1VQPP 3L73J 1KN7A 2B88A 1PP9G 3IN6A 2HG5D 3TGUD 3H1ID 1MZ8A 3AE4C 2LIUA 2KNCA 3AE1C 3HUSC 2FY8A 1OVVA 2HODB 2ZVNB 3GHGB 1GD2E 5GTHH 4GKGA 1CZQA 1JY3O 4EDFA 2NZ2A 1JO5A 2JWDA 3HD7A 2KG6A 2Q5UA 5KAFE 1JJ2O 4XFZA 4H2XC 5AW1B 3F5HA 4PJ0H 2ZT9D 5KLIC 3H1HG 3RK3C 1GL2B 1NHLA 3TK1A 3TGUJ 3P8CE 3H1IJ 3CX5H 4GR6A 4N3YB 2P1JA 1HGZA 2B89A 1NTZG 2I1KA 3L70D 4U0EA 2E5YA 3SFEC 1AUMA 5GTIE 2VLNA 2Q3IA 3V2QA 1URQB 1RO2A 2C9NY 2XZRA 2K0YA 4U0FA 1LTAC 1SQQK 4C7RA 3L37A 2M8PA 3DS4A 1N73C 3CCJP 5BU8B 2CGQA 1JY2O 2N1TA 4U0BA 1SVFA 3QWOC 2HR3A 3MUDA 1E6JP 1GK4A 2FQ2A 2Z5IA 1SQXE 1SFCC 4ASVA 3CLQA 1Q81Q 1S5LE 3L70J 3H4EA 4BWNA 2NPSD 3B5ND 1SQPK 2LMLA 1S1CX 2KP8A 1KQFB 2DGYA 2VRSA 1IMQA 4OGQD 3H32B 1RE3C 2QEXP 2KSJA 2X2BA 2MD9A 1GL2A 1JMMA 1VQMP 1H0TA 3P7KA 2GDXA 3USSA 1LTJA 1KYOD 2AFEA 2LXCB 5AW5B 1YITP 1DX7A 1SQVD 1NTKD 1Y47A 3RBZA 1EMVA 1K30A 3SWYA 1BSHA 3NTNA 1S5LX 4IFFA 3DS3A 2YXQB 1FZCC 3G28A 4DG9A 2ZT9B 5B5EH 4GOFA 1OW8A 1K8AQ 5F2NA 3L71D 1VPCA 1EQ7A 2ZFCA 5AW6B 2JEEA 1VF5D 1J1DB 3O6QA 1FZAA 2GZGA 1T8ZA 3RK3D 2MR8A 2Z46A 3MZWB 1SQVJ 1NTKJ 4W80A 1HH0A 3WU2H 3MTUE 2K92A 4BXLA 2RH0A 4H13D 2GZJA 1PEUA 2C9LY 2EHSA 3A0HH 5CCGD 2G3AA 2P9XA 2K37A 3CX5I 4RJTA 3EJDA 3L71J 2H89C 1VQKP 2YKOA 1FDMA 3H1LG 2PY8A 3Q3DA 2QJKC 1FC2C 2NPSB 3B5NB 1PPJE 3M06A 5APYA 2OYHA 2RMZA 3CD6P 2FVAA 4WY4D 2R3CA 3M9BA 2YMKA 3F89A 4OGQB 1FR2A 3AEEC 2K9JB 4IFMA 2XXMA 1GZLA 1NU1D 2KW2A 3VMZA 3E1RA 5AVXB 4BPHA 2FYNC 3CE7A 2A45G 4GT1A 2IBZI 4XFYA 4XE5B 4R4LA 3H1JE 3OW2O 3LMOA 2W8ZA 3JCUH 3AECC 1T3UA 2K5XA 2JQ4A 1K9MQ 3M9QA 1GPJA 1NOHA 2QJPB 2ZJSE 5AVQB 1LT1A 1NVOA 1M56D 2FYUG 3CCEP 1NU1J 4YPCA 3FWLA 1VF5B 5KP7B 3V5BA 1EZVG 1RF1A 1HY8A 2OQQA 1EDKA 3RK3B 2FFDB 2E1MA 2A06D 4H44D 3A2AA 3KDPB 2O1KA 4XFXA 2H7HA 2IDBA 1IO4A 3I55P 2JR8A 1EIAA 3JSVC 4H13B 2E74C 3L73E 1S4XA 4I2LC 4UB8E 5HGOA 2QM7A 2QIWA 1VQ6P 1NAYA 3B5IA 4IZ6A 2YO3A 1E0HA 4HYTB 1G1IA 1JEKA 2XKMA 2W6AA 1FE6A 4RO0A 3TSIA 2WT7B 5B66H 5TISH 2QVAA 2E42A 3PJSK 1S2EA 2HLOA 4WY4B 2R32A 2M5RA 1GXHA 2AFDA 2Q9IA 2KOOA 3M9HA 1OZHA 3AEDC 3TGUE 1LTIC 3H1IE 3EJEA 5KJ7C 2JGPA 3VMXA 2QE7H 5AVRB 3CCQP 1DNYA 3W68A 2QG4A 2WSEH 2FAEA 3AE2C 3H25A 4EYYQ 1EOQA 1KILA 1CI6B 1FS0E 4I6MC 3S4RA 3PRJA 1N86A 1DV5A 1SQVK 2EHTA 2B9BA 3RL0D 3H1HD 4PV1D 1AVOA 3CCSP 1NTZD 3Q20A 2Y0CA 1LNQA 4H44B 2FBWC
chains in the Genus database with same CATH topology
5HGLA 4GR2A 4XFXA 1IUQA 5JPAA 1QVFO 2Z46A 4U0DA 4COCA 4U0EA 3I55P 2ONTA 3I56P 2OTLP 1EIAA 4QNBA 4XRQA 1AUMA 1QRJA 3DS1A 1YIJP 3G6EP 1YHQP 1YI2P 1PEUA 3NTEA 3H0DA 5HGOA 1RO2A 5HGMA 1VQ6P 4U0FA 3P05A 3G1GA 5DCKA 1YJ9P 3B5IA 3VRLC 2P9XA 4IPYA 2JO0A 2M8PA 3DS4A 4XROA 2OARA 1M1KQ 3CCJP 5F2OA 3DPHA 4PH1A 3HYBA 4U0BA 2EFJA 1BAJA 1VQKP 2JYLA 1E6JP 1RO0A 2PY8A 1QVGO 1PEQA 1M90Q 1N8RQ 1Q86Q 1NJIQ 3CC2P 1Q81Q 3H47A 2M8NA 3H4EA 2M8LA 3CCVP 1VQ5P 1VQ8P 1ZMBA 5BS2A 3CD6P 3CCMP 1VQ7P 1M6EX 3G0VA 2PEKA 1S72P 2DGYA 2CWOA 2KODA 2BHVA 4COPA 1KC8Q 1VQ9P 1PEMA 5BS1A 4WYMA 1VQOP 2L6EA 3G1IA 3DTJA 1W2BO 2PEOA 1VQPP 1YJNP 3G21A 2XXMA 2XV6A 2BUOA 3E2DA 2EIAA 2OTJP 1D1DA 2QEXP 3M1MA 3G71P 1VQ4P 5HGNA 1PEOA 3CCUP 2LF4A 4XFYA 2PEMA 1A43A 1M74A 3LRYA 4PH0A 3CCQP 1RNIA 1VQMP 3DS5A 3OW2O 4M0IA 1Q82Q 2Z44A 1EOQA 2PEQA 1M6NA 1VQLP 3DS2A 4U0CA 1YITP 3CCRP 1A8OA 2Z45A 5F2KA 1K9MQ 2JYGA 1K30A 3CMAP 1KQSO 3DS3A 3CCLP 3G28A 3HZQA 1YJWP 2XT1A 3CPWO 1KD1Q 3WBHA 2QA4P 3CXCO 3CMEP 5I4TG 4XFZA 1JJ2O 3CCSP 2EG5A 3RG6C 3CCEP 1K8AQ 1VQNP 5F2NA 3Q20A 4U0AA 2PEJA 3MGEA 3CC4P 1K73Q 3G29A 3DS0A 2PEIA 3G26A 3G4SP 1Q7YQ 3CC7P 2PENA 2E1MA 4GR6A 2BQ1E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCJ P;  3CCR P;  1W2B O;  1K9M Q;  1VQP P;  1YJN P;  1QVF O;  3CMA P;  1KQS O;  3CCL P;  3I55 P;  3I56 P;  1VQK P;  2OTL P;  2OTJ P;  1YJW P;  3CPW O;  1KD1 Q;  2QEX P;  1M1K Q;  1QVG O;  2QA4 P;  1YIJ P;  3G6E P;  3CXC O;  1YHQ P;  3CME P;  3G71 P;  1YI2 P;  1M90 Q;  1N8R Q;  1Q86 Q;  3CCU P;  3CCS P;  1JJ2 O;  1NJI Q;  1VQ4 P;  1VQL P;  1Q81 Q;  3CCQ P;  3CC2 P;  3CCE P;  1VQM P;  1K8A Q;  3CCV P;  3OW2 O;  1VQ5 P;  1VQ8 P;  1VQ6 P;  1VQN P;  3CD6 P;  1Q82 Q;  3CCM P;  1VQ7 P;  3CC4 P;  1K73 Q;  1S72 P;  1YJ9 P;  1KC8 Q;  1VQ9 P;  3G4S P;  1Q7Y Q;  3CC7 P;  1YIT P;  1VQO P; 
#chains in the Genus database with same CATH topology
 2AF8 A;  3V2R A;  2AXT H;  2N1T C;  4WY4 A;  3KPE A;  3GLM A;  2N6Z A;  2N98 A;  2KS1 A;  2KGE A;  2KOP A;  1HBW A;  3P05 A;  4DJG A;  3H1H J;  2P7J A;  4IL6 E;  3DPH A;  1NTM G;  1NTZ J;  2VLO A;  2L91 A;  4U3F E;  1DIP A;  1BCC D;  3AE5 C;  2K1A A;  3M0D C;  2FAD A;  2L9F A;  3G3Z A;  2M8N A;  3BVH A;  3D70 A;  3CCM P;  2IZ1 A;  2Q1K A;  1PFI A;  1KFM A;  1LTT C;  1H8A A;  3V6I A;  1PEM A;  1KLP A;  1LTJ C;  2OYO A;  2N6Y A;  3LW5 J;  4WVZ A;  4ASW A;  2LXB A;  2JKV A;  1GU5 A;  2N5I A;  3RK2 C;  1HVV A;  2ZXE B;  2A45 H;  5GTH E;  1JTH B;  4Y28 J;  1VHN A;  2K0D X;  1SQV E;  3LID A;  2KSE A;  1NTK E;  2GZI A;  1VQ4 P;  2D2C D;  1A43 A;  3CXH H;  1BCC J;  5TJH A;  1T2K C;  1U7M A;  1Y9B A;  1FU1 A;  1RE4 A;  4N6J A;  3RL0 B;  1IK7 A;  1H88 A;  1A02 F;  2YO2 A;  4H0L D;  3ABV C;  1UII A;  4PV1 B;  3CX5 E;  5KP8 B;  3AE3 C;  2E76 C;  1EDL A;  3RK3 E;  2WPT A;  4MN4 C;  2Y0E A;  1Z6M A;  5AVT B;  4B86 A;  1NYH A;  3MIW A;  3S1K A;  2GA1 A;  1NO4 A;  3K5B A;  1ZP0 C;  3G4S P;  1Q7Y Q;  2PEN A;  1UNK A;  3A7O A;  1JUN A;  2QM8 A;  1QRJ A;  2ZYA A;  1OVU A;  1K04 A;  3L35 A;  3V4Q A;  2ZYG A;  3CWB G;  4NEO A;  2QRX A;  1QX8 A;  2E75 D;  1YJ9 P;  5K5G B;  2OYH C;  2IBZ E;  1X8Y A;  1LP1 B;  4LLH A;  2E5T A;  2GYK A;  2WPS A;  4QMA A;  1BGY G;  2KB7 P;  1Z56 A;  2H8P D;  3L36 A;  5KKZ C;  2OYI B;  1SP4 A;  2O01 N;  2UWJ E;  1H89 A;  1L0N E;  1NU1 E;  5EW5 E;  1GTW A;  2WPQ A;  1VQ9 P;  5AVZ B;  4BRY A;  2Y9Z A;  4WYM A;  2QNW A;  2WPV B;  1G2C B;  3BAS A;  1HQB A;  2D2C B;  5CCH A;  1A02 J;  2GUS A;  3TNU A;  3BCC G;  3M1M A;  2KXP B;  3EFG A;  1DD3 A;  2XZ0 D;  2HPC A;  4M0I A;  3S9O A;  1U57 A;  4M3L A;  1IMP A;  5B5E E;  5KAI E;  1L0L E;  4H0L B;  1RF1 C;  2WSC H;  1GXG A;  1RQV A;  2FYU D;  3CCL P;  1J1E B;  3QH9 A;  2A45 I;  5AVY B;  1SQX K;  4NPD A;  1YJW P;  5AVU B;  1EZV D;  4N78 D;  1JCC A;  2W6B A;  2L0Q A;  5AVV B;  1AA0 A;  2A06 E;  1NWQ A;  1IFJ A;  2E76 D;  2JWA A;  4C7N A;  3CC4 P;  1ZOY C;  3EFF K;  1N7S D;  1YQ4 C;  2O3J A;  1FZE A;  4O9B A;  1LT9 A;  1GDT A;  2LPK A;  4U0D A;  1FDI A;  2LR2 A;  1IZN B;  1M1J B;  3HTK B;  1L4A C;  4F37 A;  1EZV I;  3V2P A;  2E75 B;  2FYU J;  3IF4 A;  2K9Y A;  2W90 A;  2WIT A;  4JBZ A;  2FKW B;  1SQB G;  5AW0 B;  3L75 G;  1M7L A;  1E79 H;  1LWU C;  1MZ9 A;  1AQ5 A;  2AEJ A;  2IYO A;  1T8K A;  2RN0 A;  2FXO A;  3CCV P;  1ZMB A;  2GM4 A;  3G0V A;  5APV A;  2PAJ A;  2BHV A;  5BS1 A;  1QL2 A;  1KIL C;  2R44 A;  2K94 A;  1IFD A;  3JCU E;  3V4W A;  1OFC X;  2BUO A;  2QJY B;  3WUT A;  5CBO A;  2VLP A;  1PGQ A;  2HOD A;  3VMA A;  3GHG A;  3M0A A;  2HFE D;  2POH A;  2Q7C A;  4U3F D;  2PEQ A;  3H1H E;  4UB6 H;  1CW5 A;  4KHX A;  1FJK A;  5F2K A;  3A0B H;  1NTZ E;  1WT6 A;  1IC2 A;  3L74 G;  2JU2 A;  2E76 B;  3OAK A;  1M8O B;  2W83 C;  3A5T A;  4GOE A;  1N7S B;  4U0A A;  4W7Y A;  2KWL A;  3G26 A;  1SQQ G;  2Z5H A;  2OTK E;  4EI2 A;  4U3F J;  5KTB A;  1J2J B;  1EXJ A;  1URQ A;  4LGD E;  2IFM A;  5M1B A;  4Y99 C;  1L4A D;  1G1J A;  5TIS E;  3L72 G;  2ZYD A;  2FHS C;  1BCC E;  3CX5 D;  1MV8 A;  2IX7 C;  2K3R A;  4XRO A;  1BDD A;  1SQP G;  3FWN A;  5APQ A;  2JU1 A;  2GUV A;  3OJA B;  3GZM A;  3B4S A;  3VP8 A;  5KKZ B;  2AEM A;  1KB9 H;  2WSS H;  3OA7 A;  1OXZ A;  1LTB C;  7CEI A;  4ZKU A;  3KYQ A;  3H32 A;  2K93 A;  2N9B A;  2MKV A;  4BPG A;  2N9Y B;  1P84 H;  3G21 A;  1RE4 C;  1OW6 A;  3FXE A;  4K3A A;  2WQY C;  3U1C A;  2IBZ D;  3H1J G;  2LF4 A;  3R4Y A;  2M5A B;  1SFC D;  3P8M C;  3HE5 B;  5KLV D;  1L0N D;  2KI7 B;  1KQS O;  4NPF X;  5HVC A;  4JPZ B;  2JDI H;  1DD4 A;  3E1I A;  2EG5 A;  5KP6 B;  3HUS B;  3G29 A;  2ZXX A;  1ZLL A;  2LKM A;  3D71 A;  3CWB D;  2BEZ F;  1L0I A;  4GDO A;  5KLV J;  1L0L D;  3H1L E;  1L0N J;  1L4A B;  3GMA A;  3KHU A;  1BE3 G;  1F80 D;  2K88 A;  2W6J H;  5KLI B;  1BGY D;  3VRL C;  2DNW A;  4Z1M H;  2DW3 A;  5AW7 B;  1RH5 B;  2BCC G;  2VSQ A;  2NPS A;  3B5N A;  3RG2 A;  1IK9 A;  1AYI A;  4ZNC A;  3BRT B;  5CCH C;  1JMB A;  1Q86 Q;  3CWB J;  1JM0 A;  1ZR4 A;  1VQ7 P;  1L0L J;  4TT3 H;  2R5D A;  2K9J A;  2KOD A;  2CWO A;  3MD0 A;  4KJM A;  1N73 B;  2LOL A;  2IZ0 A;  2C0W A;  2PEO A;  1YJN P;  3T97 B;  1BGY J;  2M3B A;  4I7Z C;  2FVE A;  4D6T G;  1OW7 A;  2LKI A;  1ZXG A;  1NH4 A;  1JOC A;  2FXP A;  5C39 A;  3C8V A;  2WMM A;  3G71 P;  1OWA A;  2CK3 H;  1SFC B;  2FYU E;  1R5S A;  2Y9Y A;  3TYY A;  3WUU A;  4H2W C;  4C46 A;  1EZV E;  4N78 E;  4HB1 A;  2Z45 A;  1PP9 D;  1PV3 A;  3UIA A;  2ERH A;  5L8R J;  3HZQ A;  2XT1 A;  3HRN A;  1HGV A;  4BPF A;  3M91 A;  2LL8 A;  1GW3 A;  1KQL A;  1YTZ I;  3L70 G;  2FFD A;  3HD7 C;  3Q1M A;  3B4Q A;  3MGE A;  5E79 E;  5CHX A;  3EQ2 A;  3B71 A;  4AQR D;  1VDF A;  3RBX A;  2PNG A;  2JAZ A;  1NTK K;  5CCG A;  1FZC B;  1SQB D;  1PP9 J;  3L75 D;  2J58 A;  4A7P A;  1U7J A;  1DEB A;  2V7Q H;  2PP6 A;  5AW4 B;  4MRT C;  5APT A;  2KZI A;  3NMD A;  3U43 A;  2YIU C;  2WT7 A;  1BXI A;  1FZF A;  2IPP A;  2KR5 A;  2FYZ A;  3TF5 A;  2KZJ A;  2KGA A;  1DH3 A;  2KYV A;  1PEQ A;  2YKQ A;  3G9R A;  4YXW H;  3MUD C;  2E74 D;  1SQB J;  1M6E X;  3GHG C;  4TLF A;  1OIP A;  1OMI A;  3L75 J;  5DJU B;  2MVU A;  1DEE G;  3DTJ A;  1IJD B;  3ITK A;  5H2F E;  2XV6 A;  2WVR A;  1QL1 A;  1SQV G;  4AUW A;  3NY7 B;  2QJK B;  3AE9 C;  2PEM A;  1CI6 A;  2K0X A;  1T6A A;  1GL2 C;  4WBA A;  3L74 D;  5AW8 B;  4U0C A;  3AEB C;  2W27 A;  3L71 G;  5KLV K;  3CL3 D;  1L0N K;  2WPR A;  5KJ7 D;  3Q5R A;  1NU1 K;  2FYN B;  1RHZ B;  1HJB A;  5APS A;  2XNX A;  1URQ C;  2G8Y A;  3KZI H;  4YXD C;  3HD7 D;  1ZNV A;  5APX A;  4PH0 A;  3U1A A;  4PJ0 E;  3AEF C;  5HGL A;  2C0X A;  5AW9 B;  2V4H A;  1S9K E;  4UB8 H;  1NTM E;  2XU6 A;  2OTL P;  3L74 J;  1WRG A;  1AQT A;  1HUC A;  1BDC A;  2ITA A;  2KG8 A;  1GW4 A;  1LGH B;  1KQG B;  4H2Y C;  1L0L K;  1WMK A;  1AVY A;  1KZU B;  5DCK A;  2JO0 A;  3KXD A;  2M3E A;  2J59 M;  2WSE J;  3H1K G;  1KTM A;  3HYB A;  3WUV A;  2EFJ A;  2SPZ A;  2JYL A;  3D6Z A;  2E74 B;  2N1T D;  3AEG C;  1VQ5 P;  1KFN A;  3H1L D;  1JTH A;  3GJN A;  4UB6 E;  2ROQ A;  5CZD B;  1D1D A;  3SWK A;  2ZT9 C;  2MF4 A;  1RF0 A;  4JQ0 D;  5KLV E;  4DCK A;  2N50 A;  2B87 B;  3LRY A;  2WWW A;  1RNI A;  2XND H;  2KG9 A;  1E5W A;  1Q82 Q;  1J1D C;  2KNC B;  3N4X A;  5AW3 B;  1VQL P;  1JY3 N;  3C9I A;  1L0H A;  2JYG A;  4JYB A;  3GF7 A;  3W67 A;  1UIX A;  3MHV A;  3H1L J;  1KD1 Q;  2KOR A;  3CXH D;  3RK2 D;  1USE A;  3HD7 B;  2MR7 A;  3FGA D;  1X22 A;  3CWB E;  3Q2Y A;  2PEI A;  3NFQ A;  1FZG A;  1T2K D;  2L4B A;  4GR2 A;  1IUQ A;  3I56 P;  1BE3 D;  2MJZ A;  1BGY E;  4IFD K;  1GMJ A;  4XFJ A;  2FAC A;  3DS1 A;  1YIJ P;  1KOR A;  3B5N C;  1Q2N A;  1D7M A;  4ZKP A;  5CJ0 A;  3A3Y B;  3CXH I;  1LP1 A;  2BCC D;  1AV1 A;  3H6P A;  1NQ4 A;  3WU2 E;  4IPY A;  2JB0 A;  4OGQ C;  1JY2 N;  1NTZ K;  4PH1 A;  1YTZ T;  2YIU B;  2OYI A;  3A0H E;  2B87 A;  1CSB A;  1Y8A A;  2N1T B;  3PH0 A;  1ZRT E;  3BCC E;  1P84 E;  4WB4 A;  4HKG A;  3VP9 A;  1NJI Q;  2QSI A;  1PZQ A;  1BE3 J;  1USD A;  5BS2 A;  4D6T D;  1G2C A;  4PD4 H;  1KC8 Q;  1W2E A;  3GG2 A;  1KYO H;  5KJ7 A;  2L6E A;  1OR5 A;  4PWV B;  2BCC J;  2QJP C;  3GZL A;  3C1L A;  3V2N A;  3EJB A;  1SQX G;  2CG5 B;  5HGN A;  1PP9 E;  4U7J A;  1VF5 C;  3DS5 A;  4RES B;  1PL5 A;  2FFD C;  2WZ7 A;  1H0T B;  1X3O A;  3E7K A;  1LTJ B;  1YYC A;  4D6T J;  4H13 C;  4KT0 J;  1ZV8 A;  3RK2 B;  3CPW O;  4DOJ A;  5CCG C;  3NXS A;  2YXR B;  2I1J A;  1RY3 A;  1SQB E;  2E43 A;  2OGU A;  2KUB A;  3L75 E;  5AVW B;  1M1J A;  3RGU A;  2L22 A;  3O6Q B;  3HTK A;  3VMY A;  5JPA A;  1FBM A;  2ONT A;  2JP3 A;  2KOQ A;  4XRQ A;  3FX0 A;  3G6E P;  2J5U A;  4WY4 C;  1YI2 P;  1PGJ A;  2CPS A;  2AEF A;  1BCC G;  4L73 A;  2GZE A;  2Y0D A;  3G1G A;  1NKZ B;  3VN0 A;  3M0D A;  2WSC J;  2Z4E A;  1QVG O;  1N8R Q;  1YBK A;  2HYN A;  3IFM A;  3H47 A;  1S9K D;  2AXC A;  4PD4 D;  5B66 E;  1NTM D;  4L74 A;  1GK6 A;  2OYH B;  2CQ8 A;  3G1I A;  1W5C E;  4K35 A;  1VKU A;  2PGD A;  4JYC A;  1QGK B;  2IYP A;  3L74 E;  2FQ1 A;  5KAI H;  3EWK A;  4L75 A;  1PEO A;  1PPJ G;  3CCU P;  1M74 A;  1BSN A;  2IFN A;  1X0T A;  4H44 C;  1X79 B;  4PD4 I;  1KYO I;  2ZVO B;  2KIK A;  1A8O A;  1SQQ E;  4CPG A;  1NTM J;  3TDK A;  1HTL C;  1KIL D;  2P67 A;  3WBH A;  3CXC O;  3MGN A;  1N7S A;  5I4T G;  2KLV A;  2PEJ A;  2XZ1 C;  1K05 A;  4ZMD A;  1VL2 A;  1AJY A;  3L72 E;  2LTE A;  3DS0 A;  3O8Z A;  1FOS E;  3CC7 P;  1NGM B;  2BQ1 E;  1M57 D;  1RF1 B;  1SQP E;  1FAV A;  1PIX A;  4XA4 A;  2I8D A;  1ZW0 A;  5KAF H;  3SFD C;  1XTC C;  4AYC A;  2H43 A;  2FYU K;  2RKL A;  4R4M A;  2AXT E;  2GDY A;  1X9V A;  3H1K D;  4GIF A;  3P32 A;  2KGD A;  5GTI H;  2JJL A;  3L73 G;  1LJ2 A;  3SSU A;  4WWI A;  1RF0 C;  2M8L A;  4I1L A;  2PEK A;  1S72 P;  4L76 A;  4COP A;  4LC1 A;  1PGO A;  3RL0 C;  3GW6 A;  1KV4 A;  3H1K J;  1LWU B;  1EXI A;  4PV1 C;  3AE7 C;  3E2D A;  1S5L H;  5AVS B;  1ACP A;  1KB9 D;  2M5A A;  4EOT A;  1MUU A;  3HE5 A;  2YMY A;  2BEQ D;  3PHL A;  3TGU G;  4IOI H;  3N7N A;  3BAT A;  3H1I G;  1ZRT D;  3CXH E;  3BCC D;  3KZI E;  3HE4 B;  3AEA C;  5APU A;  1P84 D;  1FDO A;  1KIL B;  2WTY A;  2L5G B;  1NKN A;  3CMA P;  3ZDM A;  2XV5 A;  3HUS A;  1KB9 I;  3RG6 C;  1JY3 P;  3D6Y A;  3LW5 H;  1BE3 E;  1K73 Q;  1L2P A;  1LTS C;  1AF8 A;  2XDJ A;  2MVV A;  2CPB A;  5CMZ A;  1P84 I;  4COC A;  1L4A A;  1N2D C;  2BCC E;  2OYI C;  4QNB A;  4RKU J;  3BCC J;  3P8C D;  1LT9 C;  2P10 A;  5HV8 A;  3NTE A;  2R3S A;  3H0D A;  3FXD A;  5HGM A;  5AW2 B;  2KS1 B;  1LWU A;  1R8E A;  2WSF H;  2OAR A;  3B8E B;  5F2O A;  2O01 H;  2KGC A;  3CI9 A;  1ZN5 A;  4HKZ H;  2D2C C;  1CEI A;  2AVA A;  4QKO A;  4YTP C;  4D6T E;  1AFO A;  1M90 Q;  2FXM A;  2Q6Q A;  3CC2 P;  4HJG H;  1VQ8 P;  1JY2 P;  4Y99 B;  3HE4 A;  1Q90 D;  2ZAE B;  1N73 A;  4H0L C;  3AE6 C;  3T97 A;  1NTM K;  1SQX D;  1J1E C;  1LTG C;  3JC2 2;  4U3F G;  3VTP C;  2EIA A;  2OTJ P;  1HF9 A;  2KOS A;  1SFC A;  1ZME C;  1S3J A;  2GZF A;  1EDI A;  3Q5S A;  3L70 E;  4EIJ A;  5CCH D;  1XTG B;  2FQ0 A;  2VLQ A;  3DS2 A;  5CBN A;  2YNY A;  1RE3 A;  1FZB A;  1IFP A;  1M1J C;  4DZO A;  1SQX J;  1NTK G;  1QEX A;  3U59 A;  3CME P;  2E75 C;  3VYI A;  4HH2 A;  4PXH B;  2M0B A;  1OVR A;  1FOS F;  2YKP A;  3LIE A;  4R0M A;  1FZC A;  2KK7 A;  1UJZ A;  1QVF O;  3II6 A;  1QLE D;  2R5B A;  2KLU A;  2H88 C;  1SQQ D;  1GU4 A;  1OX3 A;  1PGP A;  1JCD A;  1FJP A;  2KOG A;  3KQG A;  4OH8 B;  2NO8 A;  2O1J A;  5BU5 A;  2QJY C;  4PD4 E;  2P2U A;  1IFM A;  1KYO E;  4IL6 X;  1RO0 A;  3L72 D;  1IFN A;  1MFT A;  1EC5 A;  4NPE A;  1SQP D;  4JF7 A;  2MY5 A;  2IBZ G;  1MFZ A;  1KMI Z;  2CNR A;  1VQO P;  1IFI A;  1SQQ J;  1MKM A;  1W2B O;  1PPJ D;  2WSF J;  4BRY B;  3L71 E;  2O01 J;  2P58 A;  5APW A;  5KLV G;  1L0N G;  4GOD A;  3IR9 A;  3TNU B;  5EFW B;  1NU1 G;  5BVZ A;  1N7S C;  2Z44 A;  3L72 J;  3IAO A;  1KIL E;  4OWF A;  2HPC B;  1M6N A;  2GDW A;  2V7Q J;  1SQP J;  3BRV B;  3CCR P;  3SWF A;  3PP5 A;  3H1J D;  4CA3 A;  2K2Q A;  1TU3 F;  3L4F A;  4I7Z B;  5E79 H;  2QA4 P;  1YQ3 C;  1HJ0 A;  3MP7 B;  3A0B E;  3GF3 A;  1RQU A;  3Q5P A;  2Q3E A;  2JO1 A;  1EDJ A;  1VQN P;  1L0L G;  1T3J A;  4C7N B;  3R2P A;  1GL2 D;  2M8R A;  3AE8 C;  3H1K E;  2LIW A;  1ZR2 A;  1R5L A;  2N5H A;  1SS1 A;  1LT9 B;  3I5C A;  1YHQ P;  2A06 G;  5CJ4 A;  3RL0 g;  3H1J J;  2BAS A;  3PLN A;  4OVN F;  3WMM 0;  3L73 D;  1URQ D;  1HWT C;  1M1K Q;  4DT0 A;  4UHP B;  1JNM A;  1BAJ A;  3VOP A;  1SLQ A;  5EJD A;  4IL6 H;  2NPS C;  1NAF A;  1SQB K;  1N7L A;  3PTZ A;  2NRG A;  5H2F H;  2PRR A;  1JB0 J;  4W7Z A;  3GKL C;  2JBG A;  1KB9 E;  2PFX A;  5DJT B;  2FVF A;  1VQP P;  3L73 J;  1KN7 A;  2B88 A;  1PP9 G;  3IN6 A;  2HG5 D;  3TGU D;  3H1I D;  1MZ8 A;  3AE4 C;  2LIU A;  2KNC A;  3AE1 C;  3HUS C;  2FY8 A;  1OVV A;  2HOD B;  2ZVN B;  3GHG B;  1GD2 E;  5GTH H;  4GKG A;  1CZQ A;  1JY3 O;  4EDF A;  2NZ2 A;  1JO5 A;  2JWD A;  3HD7 A;  2KG6 A;  2Q5U A;  5KAF E;  1JJ2 O;  4XFZ A;  4H2X C;  5AW1 B;  3F5H A;  4PJ0 H;  2ZT9 D;  5KLI C;  3H1H G;  3RK3 C;  1GL2 B;  1NHL A;  3TK1 A;  3TGU J;  3P8C E;  3H1I J;  3CX5 H;  4GR6 A;  4N3Y B;  2P1J A;  1HGZ A;  2B89 A;  1NTZ G;  2I1K A;  3L70 D;  4U0E A;  2E5Y A;  3SFE C;  1AUM A;  5GTI E;  2VLN A;  2Q3I A;  3V2Q A;  1URQ B;  1RO2 A;  2C9N Y;  2XZR A;  2K0Y A;  4U0F A;  1LTA C;  1SQQ K;  4C7R A;  3L37 A;  2M8P A;  3DS4 A;  1N73 C;  3CCJ P;  5BU8 B;  2CGQ A;  1JY2 O;  2N1T A;  4U0B A;  1SVF A;  3QWO C;  2HR3 A;  3MUD A;  1E6J P;  1GK4 A;  2FQ2 A;  2Z5I A;  1SQX E;  1SFC C;  4ASV A;  3CLQ A;  1Q81 Q;  1S5L E;  3L70 J;  3H4E A;  4BWN A;  2NPS D;  3B5N D;  1SQP K;  2LML A;  1S1C X;  2KP8 A;  1KQF B;  2DGY A;  2VRS A;  1IMQ A;  4OGQ D;  3H32 B;  1RE3 C;  2QEX P;  2KSJ A;  2X2B A;  2MD9 A;  1GL2 A;  1JMM A;  1VQM P;  1H0T A;  3P7K A;  2GDX A;  3USS A;  1LTJ A;  1KYO D;  2AFE A;  2LXC B;  5AW5 B;  1YIT P;  1DX7 A;  1SQV D;  1NTK D;  1Y47 A;  3RBZ A;  1EMV A;  1K30 A;  3SWY A;  1BSH A;  3NTN A;  1S5L X;  4IFF A;  3DS3 A;  2YXQ B;  1FZC C;  3G28 A;  4DG9 A;  2ZT9 B;  5B5E H;  4GOF A;  1OW8 A;  1K8A Q;  5F2N A;  3L71 D;  1VPC A;  1EQ7 A;  2ZFC A;  5AW6 B;  2JEE A;  1VF5 D;  1J1D B;  3O6Q A;  1FZA A;  2GZG A;  1T8Z A;  3RK3 D;  2MR8 A;  2Z46 A;  3MZW B;  1SQV J;  1NTK J;  4W80 A;  1HH0 A;  3WU2 H;  3MTU E;  2K92 A;  4BXL A;  2RH0 A;  4H13 D;  2GZJ A;  1PEU A;  2C9L Y;  2EHS A;  3A0H H;  5CCG D;  2G3A A;  2P9X A;  2K37 A;  3CX5 I;  4RJT A;  3EJD A;  3L71 J;  2H89 C;  1VQK P;  2YKO A;  1FDM A;  3H1L G;  2PY8 A;  3Q3D A;  2QJK C;  1FC2 C;  2NPS B;  3B5N B;  1PPJ E;  3M06 A;  5APY A;  2OYH A;  2RMZ A;  3CD6 P;  2FVA A;  4WY4 D;  2R3C A;  3M9B A;  2YMK A;  3F89 A;  4OGQ B;  1FR2 A;  3AEE C;  2K9J B;  4IFM A;  2XXM A;  1GZL A;  1NU1 D;  2KW2 A;  3VMZ A;  3E1R A;  5AVX B;  4BPH A;  2FYN C;  3CE7 A;  2A45 G;  4GT1 A;  2IBZ I;  4XFY A;  4XE5 B;  4R4L A;  3H1J E;  3OW2 O;  3LMO A;  2W8Z A;  3JCU H;  3AEC C;  1T3U A;  2K5X A;  2JQ4 A;  1K9M Q;  3M9Q A;  1GPJ A;  1NOH A;  2QJP B;  2ZJS E;  5AVQ B;  1LT1 A;  1NVO A;  1M56 D;  2FYU G;  3CCE P;  1NU1 J;  4YPC A;  3FWL A;  1VF5 B;  5KP7 B;  3V5B A;  1EZV G;  1RF1 A;  1HY8 A;  2OQQ A;  1EDK A;  3RK3 B;  2FFD B;  2E1M A;  2A06 D;  4H44 D;  3A2A A;  3KDP B;  2O1K A;  4XFX A;  2H7H A;  2IDB A;  1IO4 A;  3I55 P;  2JR8 A;  1EIA A;  3JSV C;  4H13 B;  2E74 C;  3L73 E;  1S4X A;  4I2L C;  4UB8 E;  5HGO A;  2QM7 A;  2QIW A;  1VQ6 P;  1NAY A;  3B5I A;  4IZ6 A;  2YO3 A;  1E0H A;  4HYT B;  1G1I A;  1JEK A;  2XKM A;  2W6A A;  1FE6 A;  4RO0 A;  3TSI A;  2WT7 B;  5B66 H;  5TIS H;  2QVA A;  2E42 A;  3PJS K;  1S2E A;  2HLO A;  4WY4 B;  2R32 A;  2M5R A;  1GXH A;  2AFD A;  2Q9I A;  2KOO A;  3M9H A;  1OZH A;  3AED C;  3TGU E;  1LTI C;  3H1I E;  3EJE A;  5KJ7 C;  2JGP A;  3VMX A;  2QE7 H;  5AVR B;  3CCQ P;  1DNY A;  3W68 A;  2QG4 A;  2WSE H;  2FAE A;  3AE2 C;  3H25 A;  4EYY Q;  1EOQ A;  1KIL A;  1CI6 B;  1FS0 E;  4I6M C;  3S4R A;  3PRJ A;  1N86 A;  1DV5 A;  1SQV K;  2EHT A;  2B9B A;  3RL0 D;  3H1H D;  4PV1 D;  1AVO A;  3CCS P;  1NTZ D;  3Q20 A;  2Y0C A;  1LNQ A;  4H44 B;  2FBW C; 
#chains in the Genus database with same CATH homology
 5HGL A;  4GR2 A;  4XFX A;  1IUQ A;  5JPA A;  1QVF O;  2Z46 A;  4U0D A;  4COC A;  4U0E A;  3I55 P;  2ONT A;  3I56 P;  2OTL P;  1EIA A;  4QNB A;  4XRQ A;  1AUM A;  1QRJ A;  3DS1 A;  1YIJ P;  3G6E P;  1YHQ P;  1YI2 P;  1PEU A;  3NTE A;  3H0D A;  5HGO A;  1RO2 A;  5HGM A;  1VQ6 P;  4U0F A;  3P05 A;  3G1G A;  5DCK A;  1YJ9 P;  3B5I A;  3VRL C;  2P9X A;  4IPY A;  2JO0 A;  2M8P A;  3DS4 A;  4XRO A;  2OAR A;  1M1K Q;  3CCJ P;  5F2O A;  3DPH A;  4PH1 A;  3HYB A;  4U0B A;  2EFJ A;  1BAJ A;  1VQK P;  2JYL A;  1E6J P;  1RO0 A;  2PY8 A;  1QVG O;  1PEQ A;  1M90 Q;  1N8R Q;  1Q86 Q;  1NJI Q;  3CC2 P;  1Q81 Q;  3H47 A;  2M8N A;  3H4E A;  2M8L A;  3CCV P;  1VQ5 P;  1VQ8 P;  1ZMB A;  5BS2 A;  3CD6 P;  3CCM P;  1VQ7 P;  1M6E X;  3G0V A;  2PEK A;  1S72 P;  2DGY A;  2CWO A;  2KOD A;  2BHV A;  4COP A;  1KC8 Q;  1VQ9 P;  1PEM A;  5BS1 A;  4WYM A;  1VQO P;  2L6E A;  3G1I A;  3DTJ A;  1W2B O;  2PEO A;  1VQP P;  1YJN P;  3G21 A;  2XXM A;  2XV6 A;  2BUO A;  3E2D A;  2EIA A;  2OTJ P;  1D1D A;  2QEX P;  3M1M A;  3G71 P;  1VQ4 P;  5HGN A;  1PEO A;  3CCU P;  2LF4 A;  4XFY A;  2PEM A;  1A43 A;  1M74 A;  3LRY A;  4PH0 A;  3CCQ P;  1RNI A;  1VQM P;  3DS5 A;  3OW2 O;  4M0I A;  1Q82 Q;  2Z44 A;  1EOQ A;  2PEQ A;  1M6N A;  1VQL P;  3DS2 A;  4U0C A;  1YIT P;  3CCR P;  1A8O A;  2Z45 A;  5F2K A;  1K9M Q;  2JYG A;  1K30 A;  3CMA P;  1KQS O;  3DS3 A;  3CCL P;  3G28 A;  3HZQ A;  1YJW P;  2XT1 A;  3CPW O;  1KD1 Q;  3WBH A;  2QA4 P;  3CXC O;  3CME P;  5I4T G;  4XFZ A;  1JJ2 O;  3CCS P;  2EG5 A;  3RG6 C;  3CCE P;  1K8A Q;  1VQN P;  5F2N A;  3Q20 A;  4U0A A;  2PEJ A;  3MGE A;  3CC4 P;  1K73 Q;  3G29 A;  3DS0 A;  2PEI A;  3G26 A;  3G4S P;  1Q7Y Q;  3CC7 P;  2PEN A;  2E1M A;  4GR6 A;  2BQ1 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...