1VQMP

The structure of the transition state analogue "dan" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 46
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1vqmP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1vqmP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1vqmP02
3G4SP 1Q7YQ 1JJ2O 1Q81Q 1VQ7P 2QEXP 1M90Q 3CMAP 1VQOP 1VQNP 1YIJP 1NJIQ 1YJNP 1Q86Q 1VQ9P 3G71P 1VQ5P 3G6EP 3CXCO 3OW2O 1N8RQ 1YI2P 1M1KQ 3CC2P 3CCEP 1YJWP 1QVGO 1VQ8P 3CC4P 1KC8Q 1K9MQ 3CCRP 1YJ9P 1K8AQ 1VQKP 3CCMP 3CCJP 1S72P 3CCQP 2OTJP 1VQMP 3CCSP 3I56P 1VQLP 3CD6P 1VQ4P 1Q82Q 2OTLP 1W2BO 2QA4P 3CMEP 1KQSO 1KD1Q 3CPWO 1K73Q 3CCVP 3CC7P 1VQ6P 3CCUP 3CCLP 1YHQP 3I55P 1YITP 1QVFO 1VQPP
chains in the Genus database with same CATH superfamily
1PEQA 1Q7YQ 1GU5A 2W6AA 2NO8A 3MUDA 2E43A 5CBNA 2QVAA 2E5YA 1JTHA 1SQPD 1LTJB 1SQPG 1YJ9P 2L22A 3GHGB 2LOLA 3PP5A 4HH2A 1MZ8A 2NPSC 2AXCA 4ASWA 2OYHC 4N6JA 1Q90D 4TLFA 4Y99B 2OYIA 3CWBG 2K9JA 2MF4A 3EWKA 1N7LA 1IMQA 2NPSA 1NU1J 4YXDC 1KILD 3VRLC 4GR6A 2H88C 4K3AA 1EZVE 3H6PA 2WSEJ 3MGEA 2MKVA 3H1KD 1H0TB 2JU2A 3B4QA 3H1KG 1D1DA 3AE6C 1W2EA 1ZLLA 2Q9IA 3L71E 1N73C 4I1LA 1S3JA 4AQRD 5AW3B 2BQ1E 3CC4P 3RK3D 3CCRP 5KLVD 3H1LE 1P84D 1FS0E 5KLVG 1X22A 1IFJA 2MY5A 2OTLP 1ZR4A 2GDXA 1VF5B 2MVUA 3RG6C 5AVXB 1T3UA 5HGNA 1BGYJ 4HJGH 2JGPA 5L8RJ 2O3JA 2FYZA 1VQKP 2WSFJ 1IFPA 5CJ4A 4PWVB 3D6ZA 1Q82Q 1KZUB 4GT1A 1SFCC 2JJLA 5F2NA 2OARA 1S9KE 4A7PA 4H0LB 1Q86Q 4BPFA 3RK2D 4NPFX 1NU1D 2JB0A 1KQLA 1AQTA 4PV1C 1ZR2A 2QJYC 1NU1G 2KIKA 4IFDK 1Q2NA 1IUQA 1SQXJ 3CLQA 3RK3B 2AF8A 2O01N 2M8LA 5DJTB 3CPWO 1MUUA 3CL3D 3HE5A 3SSUA 1DEEG 1SQBE 2K92A 1OFCX 1JY3P 4RJTA 1JTHB 1KFMA 2JKVA 4UB8E 3U59A 3TDKA 3BASA 2JAZA 4IZ6A 1Y47A 1SQQE 3L71J 1J1DC 1JMBA 1BGYD 2H7HA 2Q6QA 1YJNP 1BGYG 1KYOI 1YI2P 2K9JB 2Q3EA 1QVGO 1E0HA 3R4YA 2KOGA 4K35A 3WU2E 1IK7A 3H1LJ 1KB9E 2K1AA 2NPSB 2FQ1A 1L0NE 2OYHB 1YBKA 2FKWB 4OGQD 2P10A 2BHVA 3G4SP 3M9BA 3DS1A 2YO2A 5KAFE 2WPSA 2K88A 1ZRTD 4XE5B 1FOSF 3CC2P 1ZXGA 3MZWB 3A0BE 4XFXA 1KLPA 1SQXD 4EYYQ 1SQXG 5TISE 1IK9A 1N73B 2PEQA 2IDBA 1BDCA 2I1KA 4IL6X 1M6EX 1JOCA 1QVFO 4PD4D 4HB1A 3NY7B 4UB8H 3P32A 1JUNA 3AEBC 2JEEA 1VQ8P 2W8ZA 1FZBA 2B89A 2AFDA 1OW6A 2K5XA 1BDDA 1GMJA 5CCGC 3L71D 2QJPC 3L71G 3WU2H 1RNIA 1BE3J 1G1JA 3U43A 3NTEA 3CX5D 4H2XC 1SQBJ 3HTKA 4ZKUA 1FZCC 3PH0A 2DW3A 3AE1C 3H1LD 2CWOA 2K37A 2Q1KA 3H1LG 5KAFH 4C46A 3A0BH 1FZCA 3AE2C 1YHQP 1SQQJ 2P2UA 1URQC 1ZN5A 1LTSC 2G8YA 2JWDA 3O6QA 2Z4EA 1RO0A 3HE5B 4PV1B 2QJYB 3GF7A 2K0YA 1FDOA 3VP9A 1M74A 2BEZF 2CGQA 1FE6A 2KLUA 1PEUA 2AXTE 2PEJA 2UWJE 1DX7A 4ASVA 3LW5J 4WWIA 1S2EA 3TNUA 3CCLP 1S9KD 1RH5B 1WMKA 4QMAA 4KT0J 3H4EA 3KQGA 1MKMA 3KXDA 2QSIA 1T2KD 1PV3A 1J1DB 3CXHD 5M1BA 1KYOH 5HVCA 1OXZA 3M06A 1BE3D 5TJHA 1PEOA 1SS1A 1BE3G 1SQBD 3KYQA 3MGNA 1SQBG 2WMMA 1PIXA 1KQFB 4RO0A 5E79E 1NAYA 3H1HJ 3M0DC 3Q5RA 1RF0C 1SQQD 1SQQG 4DJGA 1X0TA 2OYOA 3JCUE 2AXTH 4COCA 1JEKA 1S4XA 4GOFA 1WT6A 4I7ZC 1FC2C 1KB9D 3HUSC 1FBMA 1JMMA 1P84I 3LIEA 1K73Q 3N4XA 1JCCA 1RO2A 1E79H 3HRNA 2QG4A 2WTYA 3V2QA 3WUVA 1L0LK 3G29A 2JU1A 2O01H 5KP6B 2M3EA 2A45H 3RL0C 2KB7P 2N1TC 2WWWA 2YO3A 2KG9A 5B5EE 3V4QA 3PLNA 5GTIE 1CEIA 5BU5A 2XXMA 4XFYA 2QJPB 5E79H 1KORA 4U0EA 3HE4B 4JF7A 1FZCB 2N1TA 3CWBE 3H1HD 3O6QB 2VRSA 1MV8A 3G21A 2KG8A 3H1HG 1LTIC 3JCUH 1DD3A 1QGKB 1DH3A 5AVRB 1URQB 2FXPA 5GTHE 1NAFA 1CW5A 2KOOA 3TF5A 3TNUB 2KGEA 4UB6E 1HJBA 2O1KA 4RKUJ 3R2PA 3BATA 2XKMA 1DNYA 2ZXXA 5APXA 3RK3E 2M0BA 2GZGA 5KLVE 1KD1Q 2M5RA 1VDFA 1AJYA 3CE7A 5GTIH 1VQ7P 5AW4B 4OWFA 4HYTB 1JNMA 2Z46A 3RL0g 1FJPA 5AVTB 4F37A 1JY2N 1GK6A 2FFDC 2OQQA 1H0TA 1DEBA 2N5IA 1QLED 5K5GB 5DJUB 3G9RA 3HD7D 2PEKA 2PAJA 4U0DA 3RL0D 2EHTA 2N1TD 3B5NC 2P58A 1M90Q 1K30A 1H89A 1A43A 5GTHH 1JY2O 1X9VA 2J5UA 2IX7C 1NTKE 1R5LA 5B66E 1NTZE 2E42A 3B5NA 4UB6H 2XV5A 3VMYA 4YTPC 1KMIZ 2YXRB 2E76C 2A45G 2N98A 3GZMA 3CWBJ 1G2CB 2HODA 2FVEA 1D7MA 3HUSB 2P9XA 3S1KA 2WZ7A 4PXHB 1GL2C 1T8KA 4WVZA 2XT1A 3FWNA 4XROA 2A06D 1NGMB 2IBZD 2A06G 1FZEA 2IBZG 3MP7B 1GD2E 2PEMA 4IFMA 5APSA 3G28A 2VLNA 2M3BA 3CX5I 1BGYE 3OW2O 3CXCO 2N1TB 3RL0B 4BRYA 2Y0EA 3Q5SA 3FX0A 2KOQA 3CCJP 2WITA 5KAIE 1VQ4P 4PH0A 1USEA 2HFED 3DS5A 1BSNA 1IJDB 3I55P 5B66H 1BAJA 3A3YB 1CZQA 3NMDA 1HF9A 2HG5D 2WSEH 2YIUC 1RQUA 1NKNA 3AE8C 3M9HA 3SFEC 2MVVA 1LP1A 2WT7A 1ZRTE 5AVUB 2FYUJ 1VF5D 1SQXE 3B5ND 1NH4A 1LNQA 1CI6A 2Z45A 2K9YA 3II6A 3AEAC 3A2AA 1RQVA 2H89C 2LR2A 3USSA 3AE9C 3CWBD 4AYCA 3QH9A 4PD4E 3V2NA 1T6AA 1NTKJ 1NTZJ 1ZP0C 2E76D 2FVFA 2QJKC 2OYHA 3A0HE 2AEFA 2MJZA 1WRGA 3CXHI 3H32B 3B5IA 4PJ0H 4H0LD 3DS4A 2WSFH 1VQNP 2FFDB 1LT9C 3CX5E 1M6NA 3FXDA 2GUVA 1RHZB 2V7QH 1K8AQ 4L75A 3PRJA 3KPEA 1N73A 1SQPK 2FHSC 2E75C 3EFFK 2KYVA 1HBWA 1PL5A 3L35A 2BASA 3CCVP 2D2CC 3CC7P 3B5NB 4U3FJ 2Y0DA 1M1JC 3P7KA 3NFQA 3H1JJ 5AW5B 3E2DA 3N7NA 2FYUD 2HODB 3MTUE 2NZ2A 1KB9I 2FYUG 4PD4H 2E76B 3K5BA 2Y9YA 4QKOA 2V7QJ 3A0HH 1UJZA 3W67A 2PP6A 5AW1B 1GXGA 1NTKD 1GL2B 1NTZD 1M1KQ 2LIWA 1NTKG 1LJ2A 2NPSD 2FQ0A 1NTZG 3B71A 1SFCA 2JBGA 1FAVA 4BRYB 5BU8B 1W2BO 3BRTB 1KQSO 3CX5H 5KLVK 4I6MC 1ZV8A 2ZT9C 1M8OB 7CEIA 1MZ9A 3CXHE 2FADA 1BE3E 1LTGC 3MD0A 1AVYA 1NWQA 1DV5A 3L75E 2FXMA 1NTME 1W5CE 1LP1B 2J59M 2WT7B 4U3FD 3H1IJ 5APYA 1YITP 4U3FG 2WVRA 5C39A 1CI6B 2LXBA 2YIUB 2PEOA 1S5LE 1SP4A 3S9OA 1X3OA 2E75D 3H1JD 3DS2A 3G71P 3H1JG 3Q1MA 2D2CD 2VLOA 1YYCA 2EG5A 1S72P 5BS1A 1NU1K 3P05A 2XV6A 3L4FA 4DG9A 3G0VA 3CMAP 2GUSA 2V4HA 1IFDA 2QJKB 3M9QA 3VMZA 2KSJA 1SFCD 2XNDH 3CXHH 2ERHA 2YKPA 3AEGC 1A02F 1OX3A 2GYKA 2IFMA 3VMAA 3D71A 3LRYA 2KUBA 4PV1D 2N6YA 1LT9B 3KHUA 3EQ2A 5AVWB 2OGUA 2FQ2A 4L76A 2R3CA 1GW4A 2E75B 3I5CA 2ZT9D 4D6TJ 2W83C 3H1HE 1S5LH 2W6JH 2D2CB 2BEQD 1FJKA 3H1ID 3L37A 3CMEP 2M8RA 3H1IG 2P1JA 1SLQA 1M1JB 2W90A 2GA1A 2MR7A 3IR9A 4IOIH 2A45I 1KB9H 3A7OA 4H2YC 3IF4A 3V2PA 3LW5H 3SWFA 4KHXA 5CCGA 2P7JA 2W6BA 3L75J 2RH0A 1NTMJ 1EXJA 1SQXK 1SFCB 2GDWA 2L91A 3G1IA 4H44C 3HE4A 2IBZI 1NO4A 1NQ4A 1NKZB 2FXOA 5TISH 1LGHB 2GZIA 2E74C 4U0CA 4M3LA 1IFMA 2ZVNB 2GZFA 1URQA 1HJ0A 4Z1MH 2ZT9B 1HH0A 1VHNA 3LIDA 4GIFA 2GDYA 1PP9J 5APQA 2IPPA 4EI2A 3B8EB 1KTMA 2L6EA 1FDMA 2QNWA 1H88A 4C7RA 1H8AA 4XFZA 4U7JA 2HLOA 4GR2A 4D6TD 2QRXA 2IZ0A 3AE5C 4D6TG 1Y9BA 2AEJA 3CCSP 3I56P 3PHLA 4NPDA 2LIUA 5AVQB 3L36A 3RG2A 3L75D 5CCGD 1NTMD 3L75G 1LTAC 1K05A 3WUUA 1NTMG 4WBAA 1GZLA 4AUWA 1X8YA 1EDKA 2Q3IA 2JQ4A 2PFXA 2G3AA 3L70J 4BWNA 2A06E 3M0DA 2IBZE 2ZXEB 1RF0A 1IO4A 3IN6A 1SQVJ 2QE7H 1U7JA 1VQ5P 2XZ1C 1LWUC 1FU1A 1PPJE 3C9IA 1NOHA 1KC8Q 3VTPC 1URQD 1PP9D 1JY3N 4BPGA 1KN7A 1PP9G 3VMXA 1FOSE 4YPCA 4DOJA 1PGJA 1G2CA 2Y0CA 3V6IA 3HUSA 2AFEA 1SQBK 3EJDA 1JY3O 4ZMDA 3CCQP 4EIJA 4WYMA 2M8PA 2AEMA 2GZEA 2C0XA 4H13C 1BCCJ 1T8ZA 1JJ2O 1SQQK 4JQ0D 4I2LC 4LC1A 5KP8B 3RGUA 2LF4A 2KSEA 4ZKPA 1QRJA 5AW9B 3G3ZA 1EMVA 4H44B 1EXIA 1L0NK 3L70D 1LT1A 1ZMBA 2N5HA 1GXHA 1XTGB 3L70G 3ZDMA 2KGDA 3KZIE 2E74B 1M7LA 1SQVD 1SQVG 1UIXA 4CPGA 4C7NA 2JYGA 4WY4C 2WSSH 1RF1C 4W80A 3Q5PA 2LMLA 2C0WA 3TK1A 2JO0A 4WB4A 4WY4A 5BVZA 5B5EH 3F5HA 5KTBA 2QM7A 1VL2A 1RF1A 4Y99C 3DPHA 3SWYA 1ZMEC 2XZ0D 1KFNA 1ZW0A 1JM0A 1PEMA 2FYUE 2QIWA 3T97A 5EFWB 3P8CE 4YXWH 3O8ZA 3H32A 1NYHA 1U57A 1BCCD 3DTJA 3AEDC 2HYNA 1E5WA 1BCCG 1EDIA 2FVAA 5I4TG 1A02J 1YQ4C 5AW2B 2FFDA 2KI7B 2PENA 1N7SC 2CQ8A 1HGVA 1IC2A 5CBOA 3E1IA 3SFDC 3Q20A 3U1CA 2RN0A 2KGAA 4HKZH 1N7SA 3OAKA 2LTEA 1Y8AA 3TGUJ 3VYIA 1Q81Q 1LWUB 2BCCJ 2R5BA 4PD4I 3FWLA 1MFZA 1N8RQ 4I7ZB 3E7KA 4JYBA 1EIAA 1PFIA 3PJSK 1AFOA 3V4WA 1ZOYC 1KILC 1L4AC 2YNYA 4U3FE 1HY8A 4WY4D 2PRRA 1L0HA 1GL2A 1GW3A 4GKGA 2R5DA 3FXEA 3AEEC 1PPJD 3H1JE 1PPJG 1L4AA 3M91A 2LKIA 3B4SA 3AE4C 2PY8A 4H13B 2KS1B 2RKLA 2ZYDA 4M0IA 4EOTA 1YTZI 2E5TA 3VP8A 2HR3A 3ITKA 3UIAA 2LL8A 1RE3C 2KZIA 2POHA 3MUDC 2YKQA 1FZFA 4C7NB 1FR2A 3EFGA 2Q5UA 1N7SD 1RE3A 4IL6E 1S1CX 3TGUD 2K2QA 2WSCJ 2BCCD 3TGUG 2C9LY 2BCCG 1ZNVA 1YIJP 1AVOA 2N50A 5BS2A 2JWAA 5CHXA 4W7YA 3G6EP 4WY4B 4N78D 1RF1B 1EC5A 2B87B 2OYIC 3GJNA 3EJEA 3RK2C 1QL2A 5EW5E 2KLVA 2J58A 2Z5IA 3T97B 3H1IE 3JC22 3FGAD 1GK4A 2HPCA 4DZOA 1GL2D 5KAIH 2XZRA 1NVOA 3GLMA 3C1LA 2R3SA 3Q3DA 2KW2A 4XA4A 4MRTC 3H47A 1L4AD 4COPA 4QNBA 1N2DC 3BCCJ 2FYNC 2I1JA 1LTBC 1LT9A 2H8PD 1FDIA 2KK7A 1N7SB 1OMIA 2KOSA 5HGOA 2KP8A 2CG5B 2Y9ZA 4IL6H 4O9BA 1F80D 2KORA 2YMYA 1DIPA 2KGCA 1LTTC 3P8CD 4GDOA 1M1JA 2ZVOB 3CI9A 3QWOC 2GZJA 2ITAA 1IMPA 4OGQC 1L2PA 5KJ7C 4CA3A 3L74E 4D6TE 2K93A 1KILB 1L4AB 3C8VA 1J2JB 2L5GB 1AF8A 5KJ7A 3RBXA 3Q2YA 3SWKA 4GOEA 5APWA 1VKUA 2LXCB 2ZYAA 1RE4C 1IFNA 4HKGA 2VLQA 3BCCD 3CCMP 2B9BA 3BCCG 1NHLA 2FYUK 3A5TA 3BVHA 2PGDA 3V2RA 1RE4A 5AVYB 5HV8A 1FZGA 1L0LE 2E1MA 1BXIA 3DS3A 1MFTA 3NXSA 1NTKK 1NTZK 2GM4A 1X79B 5KLIC 2JDIH 2QA4P 1PP9E 4U0AA 1J1EC 1NJIQ 2ZAEB 2EIAA 2SPZA 2OYIB 3D70A 2HPCB 4DT0A 1UIIA 3RK2B 1UNKA 4LGDE 1HQBA 4EDFA 5KJ7D 1N86A 1VQPP 1OVUA 5APUA 3M1MA 3WBHA 1QEXA 2M5AA 4TT3H 1OW7A 2H43A 1BSHA 3M0AA 2R32A 2FYNB 5EJDA 3L74J 3U1AA 3H25A 1T3JA 4UHPB 1Z56A 2XDJA 2L9FA 4U0BA 4JYCA 3TYYA 4ZNCA 3L70E 1T2KC 5JPAA 1GPJA 1SQVE 1A8OA 2P67A 3CCEP 1YJWP 1EDJA 1EZVD 1ACPA 1K9MQ 1AV1A 1JB0J 1EZVG 2W27A 2KNCA 1GTWA 2FACA 3KDPB 1VQ6P 1IZNB 2JP3A 2EHSA 2I8DA 4R0MA 4OGQB 1L0LJ 1OVVA 2O1JA 1JY2P 1K04A 2FAEA 3GG2A 1KYOE 3OA7A 1EOQA 4R4MA 1HTLC 2YMKA 4N3YB 3VOPA 5KP7B 3CD6P 1IFIA 1CSBA 1E6JP 4JBZA 5APVA 2KG6A 3DS0A 4BXLA 1OVRA 2JO1A 1BCCE 5APTA 5CJ0A 3W68A 2JYLA 1RY3A 2Z44A 3L74D 3S4RA 3L74G 3GKLC 1L0NJ 5CZDB 2N9YB 3IAOA 2OTKE 2IZ1A 3L73E 5F2OA 3G26A 3WUTA 2IFNA 4NEOA 2KR5A 5CMZA 4OH8B 4IFFA 4PH1A 2EFJA 2IYOA 1KV4A 5KLIB 2CNRA 2KOPA 2M8NA 3OJAB 4U0FA 1U7MA 2Z5HA 1VQLP 2L0QA 1J1EB 1PGPA 2K0DX 1OIPA 4OVNF 1L0LD 2MR8A 2LPKA 2CPBA 1L0LG 3HZQA 3GZLA 1GDTA 1HWTC 4DCKA 2M5AB 3GMAA 4H44D 1JCDA 1VQMP 1SVFA 3MHVA 1M56D 2WPRA 3AECC 3NTNA 3CCUP 3P8MC 1LWUA 2E74D 3G1GA 4GODA 4BPHA 1S5LX 2C9NY 4LLHA 4W7ZA 3LMOA 2FBWC 2BUOA 2Q7CA 2MD9A 1L0ND 5CCHC 1L0NG 3L72E 5F2KA 2XNXA 1NTMK 2DNWA 5KKZC 1R5SA 2KNCB 1Z6MA 4JPZB 4L73A 1YTZT 3TGUE 1L0IA 5CCHA 2BCCE 1HGZA 4NPEA 3HD7C 3HTKB 2K94A 4IPYA 3AE3C 1SQPE 4N78E 2KWLA 2KS1A 3ABVC 2OTJP 1DD4A 1AA0A 1OWAA 4H2WC 3L73J 5HGMA 3HD7A 3GF3A 2JR8A 1YQ3C 2CK3H 2WPTA 3MIWA 3VN0A 2PNGA 3PTZA 5AW8B 4L74A 1KILE 1LTJC 5H2FE 1PGQA 3GHGC 2WQYC 2O01J 3H1KE 2WPQA 1HUCA 1VPCA 4RESB 1VQOP 1LTJA 2YKOA 1VQ9P 1KYOD 2B87A 3HYBA 1JO5A 3IFMA 3GHGA 3EJBA 3AEFC 1QX8A 3AE7C 5DCKA 1QL1A 3RBZA 1EQ7A 2AVAA 2DGYA 1P84E 1KQGB 5HGLA 1OW8A 3WMM0 2QEXP 5CCHD 2KZJA 3JSVC 1OR5A 2QM8A 2X2BA 2CPSA 1SQVK 4Y28J 3KZIH 4H13D 3GW6A 4KJMA 3L72J 5AW6B 2ROQA 3L73D 5AVVB 1R8EA 3L73G 2K0XA 1FZAA 1VF5C 2N9BA 5H2FH 4XFJA 1AUMA 4XRQA 1G1IA 1XTCC 4R4LA 3D6YA 2ONTA 2ZJSE 5AVSB 1SQPJ 3V5BA 1NU1E 2K3RA 2FY8A 2XU6A 1EDLA 5AW7B 3BCCE 2WPVB 1PZQA 2IYPA 3F89A 2KXPB 1P84H 3E1RA 4B86A 2N6ZA 2WSCH 4H0LC 2ZFCA 1KILA 1EZVI 2R44A 5KKZB 3H1KJ 1HVVA 3RK3C 2ZYGA 3BRVB 3TSIA 1USDA 1TU3F 4MN4C 3HD7B 2RMZA 2YXQB 1GU4A 1AQ5A 2VSQA 3H0DA 2PEIA 1OZHA 3L72D 4PJ0E 5AW0B 2VLPA 1M57D 3L72G 2B88A 1PGOA 2LKMA 5KLVJ 2KODA 5AVZB 1AYIA 2NRGA 2L4BA
chains in the Genus database with same CATH topology
2L6EA 1PEQA 1Q7YQ 1PEOA 5F2NA 2OARA 1JJ2O 1Q81Q 2E1MA 2PEMA 3G0VA 2QEXP 4XFZA 3CMAP 1Q86Q 3G28A 4GR2A 1N8RQ 3OW2O 2LF4A 3CXCO 3DS3A 2BUOA 3E2DA 1VQ8P 3H47A 1EOQA 1QRJA 1YJ9P 1IUQA 4COPA 4QNBA 3CCJP 1EIAA 5F2KA 3CCSP 3I56P 3CD6P 1VQ4P 2QA4P 2M8LA 1KD1Q 4PH0A 1E6JP 3CPWO 3DS5A 3LRYA 1ZMBA 4U0AA 3I55P 3DS0A 1BAJA 1RNIA 4COCA 1AUMA 5HGOA 4XRQA 1VQ7P 3NTEA 1NJIQ 2JYLA 2EIAA 2Z44A 2Z46A 1M1KQ 2ONTA 4IPYA 2JYGA 2CWOA 3VRLC 4GR6A 2OTJP 3MGEA 2PY8A 1W2BO 3CMEP 1KQSO 2Z45A 1K73Q 4M0IA 5HGMA 1D1DA 1YHQP 2JO0A 5F2OA 1VQPP 1RO2A 3G26A 2PEKA 4U0DA 3M1MA 3WBHA 1M90Q 1RO0A 1K30A 1A43A 1YJNP 3G29A 3DPHA 1VQ5P 4PH1A 1YI2P 2EFJA 2BQ1E 1QVGO 3CC4P 1M74A 1KC8Q 3CCRP 2M8NA 4U0FA 1PEUA 1PEMA 2PEJA 2XXMA 1VQLP 4XFYA 2OTLP 3G1IA 3CCLP 2BHVA 3DTJA 4U0EA 4U0BA 1YITP 3G4SP 3B5IA 5I4TG 2PEOA 3DS4A 3RG6C 3DS1A 3HZQA 5HGNA 1VQOP 1VQNP 1YIJP 2PENA 5JPAA 5BS2A 1VQ9P 3DS2A 3G71P 2P9XA 3HYBA 3G6EP 1A8OA 4U0CA 3CC2P 3H0DA 4XFXA 2PEIA 1M6NA 3G21A 3Q20A 1YJWP 3CCEP 2EG5A 3H4EA 1K9MQ 1VQKP 1K8AQ 3CCMP 5DCKA 1S72P 5BS1A 3CCQP 4WYMA 1VQMP 3P05A 2XT1A 2M8PA 1Q82Q 2KODA 2DGYA 2XV6A 2PEQA 4XROA 3CCVP 5HGLA 1M6EX 3CC7P 1VQ6P 3CCUP 1QVFO 3G1GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G4S P;  1Q7Y Q;  1JJ2 O;  1Q81 Q;  1VQ7 P;  2QEX P;  1M90 Q;  3CMA P;  1VQO P;  1VQN P;  1YIJ P;  1NJI Q;  1YJN P;  1Q86 Q;  1VQ9 P;  3G71 P;  1VQ5 P;  3G6E P;  3CXC O;  3OW2 O;  1N8R Q;  1YI2 P;  1M1K Q;  3CC2 P;  3CCE P;  1YJW P;  1QVG O;  1VQ8 P;  3CC4 P;  1KC8 Q;  1K9M Q;  3CCR P;  1YJ9 P;  1K8A Q;  1VQK P;  3CCM P;  3CCJ P;  1S72 P;  3CCQ P;  2OTJ P;  1VQM P;  3CCS P;  3I56 P;  1VQL P;  3CD6 P;  1VQ4 P;  1Q82 Q;  2OTL P;  1W2B O;  2QA4 P;  3CME P;  1KQS O;  1KD1 Q;  3CPW O;  1K73 Q;  3CCV P;  3CC7 P;  1VQ6 P;  3CCU P;  3CCL P;  1YHQ P;  3I55 P;  1YIT P;  1QVF O;  1VQP P; 
#chains in the Genus database with same CATH topology
 1PEQ A;  1Q7Y Q;  1GU5 A;  2W6A A;  2NO8 A;  3MUD A;  2E43 A;  5CBN A;  2QVA A;  2E5Y A;  1JTH A;  1SQP D;  1LTJ B;  1SQP G;  1YJ9 P;  2L22 A;  3GHG B;  2LOL A;  3PP5 A;  4HH2 A;  1MZ8 A;  2NPS C;  2AXC A;  4ASW A;  2OYH C;  4N6J A;  1Q90 D;  4TLF A;  4Y99 B;  2OYI A;  3CWB G;  2K9J A;  2MF4 A;  3EWK A;  1N7L A;  1IMQ A;  2NPS A;  1NU1 J;  4YXD C;  1KIL D;  3VRL C;  4GR6 A;  2H88 C;  4K3A A;  1EZV E;  3H6P A;  2WSE J;  3MGE A;  2MKV A;  3H1K D;  1H0T B;  2JU2 A;  3B4Q A;  3H1K G;  1D1D A;  3AE6 C;  1W2E A;  1ZLL A;  2Q9I A;  3L71 E;  1N73 C;  4I1L A;  1S3J A;  4AQR D;  5AW3 B;  2BQ1 E;  3CC4 P;  3RK3 D;  3CCR P;  5KLV D;  3H1L E;  1P84 D;  1FS0 E;  5KLV G;  1X22 A;  1IFJ A;  2MY5 A;  2OTL P;  1ZR4 A;  2GDX A;  1VF5 B;  2MVU A;  3RG6 C;  5AVX B;  1T3U A;  5HGN A;  1BGY J;  4HJG H;  2JGP A;  5L8R J;  2O3J A;  2FYZ A;  1VQK P;  2WSF J;  1IFP A;  5CJ4 A;  4PWV B;  3D6Z A;  1Q82 Q;  1KZU B;  4GT1 A;  1SFC C;  2JJL A;  5F2N A;  2OAR A;  1S9K E;  4A7P A;  4H0L B;  1Q86 Q;  4BPF A;  3RK2 D;  4NPF X;  1NU1 D;  2JB0 A;  1KQL A;  1AQT A;  4PV1 C;  1ZR2 A;  2QJY C;  1NU1 G;  2KIK A;  4IFD K;  1Q2N A;  1IUQ A;  1SQX J;  3CLQ A;  3RK3 B;  2AF8 A;  2O01 N;  2M8L A;  5DJT B;  3CPW O;  1MUU A;  3CL3 D;  3HE5 A;  3SSU A;  1DEE G;  1SQB E;  2K92 A;  1OFC X;  1JY3 P;  4RJT A;  1JTH B;  1KFM A;  2JKV A;  4UB8 E;  3U59 A;  3TDK A;  3BAS A;  2JAZ A;  4IZ6 A;  1Y47 A;  1SQQ E;  3L71 J;  1J1D C;  1JMB A;  1BGY D;  2H7H A;  2Q6Q A;  1YJN P;  1BGY G;  1KYO I;  1YI2 P;  2K9J B;  2Q3E A;  1QVG O;  1E0H A;  3R4Y A;  2KOG A;  4K35 A;  3WU2 E;  1IK7 A;  3H1L J;  1KB9 E;  2K1A A;  2NPS B;  2FQ1 A;  1L0N E;  2OYH B;  1YBK A;  2FKW B;  4OGQ D;  2P10 A;  2BHV A;  3G4S P;  3M9B A;  3DS1 A;  2YO2 A;  5KAF E;  2WPS A;  2K88 A;  1ZRT D;  4XE5 B;  1FOS F;  3CC2 P;  1ZXG A;  3MZW B;  3A0B E;  4XFX A;  1KLP A;  1SQX D;  4EYY Q;  1SQX G;  5TIS E;  1IK9 A;  1N73 B;  2PEQ A;  2IDB A;  1BDC A;  2I1K A;  4IL6 X;  1M6E X;  1JOC A;  1QVF O;  4PD4 D;  4HB1 A;  3NY7 B;  4UB8 H;  3P32 A;  1JUN A;  3AEB C;  2JEE A;  1VQ8 P;  2W8Z A;  1FZB A;  2B89 A;  2AFD A;  1OW6 A;  2K5X A;  1BDD A;  1GMJ A;  5CCG C;  3L71 D;  2QJP C;  3L71 G;  3WU2 H;  1RNI A;  1BE3 J;  1G1J A;  3U43 A;  3NTE A;  3CX5 D;  4H2X C;  1SQB J;  3HTK A;  4ZKU A;  1FZC C;  3PH0 A;  2DW3 A;  3AE1 C;  3H1L D;  2CWO A;  2K37 A;  2Q1K A;  3H1L G;  5KAF H;  4C46 A;  3A0B H;  1FZC A;  3AE2 C;  1YHQ P;  1SQQ J;  2P2U A;  1URQ C;  1ZN5 A;  1LTS C;  2G8Y A;  2JWD A;  3O6Q A;  2Z4E A;  1RO0 A;  3HE5 B;  4PV1 B;  2QJY B;  3GF7 A;  2K0Y A;  1FDO A;  3VP9 A;  1M74 A;  2BEZ F;  2CGQ A;  1FE6 A;  2KLU A;  1PEU A;  2AXT E;  2PEJ A;  2UWJ E;  1DX7 A;  4ASV A;  3LW5 J;  4WWI A;  1S2E A;  3TNU A;  3CCL P;  1S9K D;  1RH5 B;  1WMK A;  4QMA A;  4KT0 J;  3H4E A;  3KQG A;  1MKM A;  3KXD A;  2QSI A;  1T2K D;  1PV3 A;  1J1D B;  3CXH D;  5M1B A;  1KYO H;  5HVC A;  1OXZ A;  3M06 A;  1BE3 D;  5TJH A;  1PEO A;  1SS1 A;  1BE3 G;  1SQB D;  3KYQ A;  3MGN A;  1SQB G;  2WMM A;  1PIX A;  1KQF B;  4RO0 A;  5E79 E;  1NAY A;  3H1H J;  3M0D C;  3Q5R A;  1RF0 C;  1SQQ D;  1SQQ G;  4DJG A;  1X0T A;  2OYO A;  3JCU E;  2AXT H;  4COC A;  1JEK A;  1S4X A;  4GOF A;  1WT6 A;  4I7Z C;  1FC2 C;  1KB9 D;  3HUS C;  1FBM A;  1JMM A;  1P84 I;  3LIE A;  1K73 Q;  3N4X A;  1JCC A;  1RO2 A;  1E79 H;  3HRN A;  2QG4 A;  2WTY A;  3V2Q A;  3WUV A;  1L0L K;  3G29 A;  2JU1 A;  2O01 H;  5KP6 B;  2M3E A;  2A45 H;  3RL0 C;  2KB7 P;  2N1T C;  2WWW A;  2YO3 A;  2KG9 A;  5B5E E;  3V4Q A;  3PLN A;  5GTI E;  1CEI A;  5BU5 A;  2XXM A;  4XFY A;  2QJP B;  5E79 H;  1KOR A;  4U0E A;  3HE4 B;  4JF7 A;  1FZC B;  2N1T A;  3CWB E;  3H1H D;  3O6Q B;  2VRS A;  1MV8 A;  3G21 A;  2KG8 A;  3H1H G;  1LTI C;  3JCU H;  1DD3 A;  1QGK B;  1DH3 A;  5AVR B;  1URQ B;  2FXP A;  5GTH E;  1NAF A;  1CW5 A;  2KOO A;  3TF5 A;  3TNU B;  2KGE A;  4UB6 E;  1HJB A;  2O1K A;  4RKU J;  3R2P A;  3BAT A;  2XKM A;  1DNY A;  2ZXX A;  5APX A;  3RK3 E;  2M0B A;  2GZG A;  5KLV E;  1KD1 Q;  2M5R A;  1VDF A;  1AJY A;  3CE7 A;  5GTI H;  1VQ7 P;  5AW4 B;  4OWF A;  4HYT B;  1JNM A;  2Z46 A;  3RL0 g;  1FJP A;  5AVT B;  4F37 A;  1JY2 N;  1GK6 A;  2FFD C;  2OQQ A;  1H0T A;  1DEB A;  2N5I A;  1QLE D;  5K5G B;  5DJU B;  3G9R A;  3HD7 D;  2PEK A;  2PAJ A;  4U0D A;  3RL0 D;  2EHT A;  2N1T D;  3B5N C;  2P58 A;  1M90 Q;  1K30 A;  1H89 A;  1A43 A;  5GTH H;  1JY2 O;  1X9V A;  2J5U A;  2IX7 C;  1NTK E;  1R5L A;  5B66 E;  1NTZ E;  2E42 A;  3B5N A;  4UB6 H;  2XV5 A;  3VMY A;  4YTP C;  1KMI Z;  2YXR B;  2E76 C;  2A45 G;  2N98 A;  3GZM A;  3CWB J;  1G2C B;  2HOD A;  2FVE A;  1D7M A;  3HUS B;  2P9X A;  3S1K A;  2WZ7 A;  4PXH B;  1GL2 C;  1T8K A;  4WVZ A;  2XT1 A;  3FWN A;  4XRO A;  2A06 D;  1NGM B;  2IBZ D;  2A06 G;  1FZE A;  2IBZ G;  3MP7 B;  1GD2 E;  2PEM A;  4IFM A;  5APS A;  3G28 A;  2VLN A;  2M3B A;  3CX5 I;  1BGY E;  3OW2 O;  3CXC O;  2N1T B;  3RL0 B;  4BRY A;  2Y0E A;  3Q5S A;  3FX0 A;  2KOQ A;  3CCJ P;  2WIT A;  5KAI E;  1VQ4 P;  4PH0 A;  1USE A;  2HFE D;  3DS5 A;  1BSN A;  1IJD B;  3I55 P;  5B66 H;  1BAJ A;  3A3Y B;  1CZQ A;  3NMD A;  1HF9 A;  2HG5 D;  2WSE H;  2YIU C;  1RQU A;  1NKN A;  3AE8 C;  3M9H A;  3SFE C;  2MVV A;  1LP1 A;  2WT7 A;  1ZRT E;  5AVU B;  2FYU J;  1VF5 D;  1SQX E;  3B5N D;  1NH4 A;  1LNQ A;  1CI6 A;  2Z45 A;  2K9Y A;  3II6 A;  3AEA C;  3A2A A;  1RQV A;  2H89 C;  2LR2 A;  3USS A;  3AE9 C;  3CWB D;  4AYC A;  3QH9 A;  4PD4 E;  3V2N A;  1T6A A;  1NTK J;  1NTZ J;  1ZP0 C;  2E76 D;  2FVF A;  2QJK C;  2OYH A;  3A0H E;  2AEF A;  2MJZ A;  1WRG A;  3CXH I;  3H32 B;  3B5I A;  4PJ0 H;  4H0L D;  3DS4 A;  2WSF H;  1VQN P;  2FFD B;  1LT9 C;  3CX5 E;  1M6N A;  3FXD A;  2GUV A;  1RHZ B;  2V7Q H;  1K8A Q;  4L75 A;  3PRJ A;  3KPE A;  1N73 A;  1SQP K;  2FHS C;  2E75 C;  3EFF K;  2KYV A;  1HBW A;  1PL5 A;  3L35 A;  2BAS A;  3CCV P;  2D2C C;  3CC7 P;  3B5N B;  4U3F J;  2Y0D A;  1M1J C;  3P7K A;  3NFQ A;  3H1J J;  5AW5 B;  3E2D A;  3N7N A;  2FYU D;  2HOD B;  3MTU E;  2NZ2 A;  1KB9 I;  2FYU G;  4PD4 H;  2E76 B;  3K5B A;  2Y9Y A;  4QKO A;  2V7Q J;  3A0H H;  1UJZ A;  3W67 A;  2PP6 A;  5AW1 B;  1GXG A;  1NTK D;  1GL2 B;  1NTZ D;  1M1K Q;  2LIW A;  1NTK G;  1LJ2 A;  2NPS D;  2FQ0 A;  1NTZ G;  3B71 A;  1SFC A;  2JBG A;  1FAV A;  4BRY B;  5BU8 B;  1W2B O;  3BRT B;  1KQS O;  3CX5 H;  5KLV K;  4I6M C;  1ZV8 A;  2ZT9 C;  1M8O B;  7CEI A;  1MZ9 A;  3CXH E;  2FAD A;  1BE3 E;  1LTG C;  3MD0 A;  1AVY A;  1NWQ A;  1DV5 A;  3L75 E;  2FXM A;  1NTM E;  1W5C E;  1LP1 B;  2J59 M;  2WT7 B;  4U3F D;  3H1I J;  5APY A;  1YIT P;  4U3F G;  2WVR A;  5C39 A;  1CI6 B;  2LXB A;  2YIU B;  2PEO A;  1S5L E;  1SP4 A;  3S9O A;  1X3O A;  2E75 D;  3H1J D;  3DS2 A;  3G71 P;  3H1J G;  3Q1M A;  2D2C D;  2VLO A;  1YYC A;  2EG5 A;  1S72 P;  5BS1 A;  1NU1 K;  3P05 A;  2XV6 A;  3L4F A;  4DG9 A;  3G0V A;  3CMA P;  2GUS A;  2V4H A;  1IFD A;  2QJK B;  3M9Q A;  3VMZ A;  2KSJ A;  1SFC D;  2XND H;  3CXH H;  2ERH A;  2YKP A;  3AEG C;  1A02 F;  1OX3 A;  2GYK A;  2IFM A;  3VMA A;  3D71 A;  3LRY A;  2KUB A;  4PV1 D;  2N6Y A;  1LT9 B;  3KHU A;  3EQ2 A;  5AVW B;  2OGU A;  2FQ2 A;  4L76 A;  2R3C A;  1GW4 A;  2E75 B;  3I5C A;  2ZT9 D;  4D6T J;  2W83 C;  3H1H E;  1S5L H;  2W6J H;  2D2C B;  2BEQ D;  1FJK A;  3H1I D;  3L37 A;  3CME P;  2M8R A;  3H1I G;  2P1J A;  1SLQ A;  1M1J B;  2W90 A;  2GA1 A;  2MR7 A;  3IR9 A;  4IOI H;  2A45 I;  1KB9 H;  3A7O A;  4H2Y C;  3IF4 A;  3V2P A;  3LW5 H;  3SWF A;  4KHX A;  5CCG A;  2P7J A;  2W6B A;  3L75 J;  2RH0 A;  1NTM J;  1EXJ A;  1SQX K;  1SFC B;  2GDW A;  2L91 A;  3G1I A;  4H44 C;  3HE4 A;  2IBZ I;  1NO4 A;  1NQ4 A;  1NKZ B;  2FXO A;  5TIS H;  1LGH B;  2GZI A;  2E74 C;  4U0C A;  4M3L A;  1IFM A;  2ZVN B;  2GZF A;  1URQ A;  1HJ0 A;  4Z1M H;  2ZT9 B;  1HH0 A;  1VHN A;  3LID A;  4GIF A;  2GDY A;  1PP9 J;  5APQ A;  2IPP A;  4EI2 A;  3B8E B;  1KTM A;  2L6E A;  1FDM A;  2QNW A;  1H88 A;  4C7R A;  1H8A A;  4XFZ A;  4U7J A;  2HLO A;  4GR2 A;  4D6T D;  2QRX A;  2IZ0 A;  3AE5 C;  4D6T G;  1Y9B A;  2AEJ A;  3CCS P;  3I56 P;  3PHL A;  4NPD A;  2LIU A;  5AVQ B;  3L36 A;  3RG2 A;  3L75 D;  5CCG D;  1NTM D;  3L75 G;  1LTA C;  1K05 A;  3WUU A;  1NTM G;  4WBA A;  1GZL A;  4AUW A;  1X8Y A;  1EDK A;  2Q3I A;  2JQ4 A;  2PFX A;  2G3A A;  3L70 J;  4BWN A;  2A06 E;  3M0D A;  2IBZ E;  2ZXE B;  1RF0 A;  1IO4 A;  3IN6 A;  1SQV J;  2QE7 H;  1U7J A;  1VQ5 P;  2XZ1 C;  1LWU C;  1FU1 A;  1PPJ E;  3C9I A;  1NOH A;  1KC8 Q;  3VTP C;  1URQ D;  1PP9 D;  1JY3 N;  4BPG A;  1KN7 A;  1PP9 G;  3VMX A;  1FOS E;  4YPC A;  4DOJ A;  1PGJ A;  1G2C A;  2Y0C A;  3V6I A;  3HUS A;  2AFE A;  1SQB K;  3EJD A;  1JY3 O;  4ZMD A;  3CCQ P;  4EIJ A;  4WYM A;  2M8P A;  2AEM A;  2GZE A;  2C0X A;  4H13 C;  1BCC J;  1T8Z A;  1JJ2 O;  1SQQ K;  4JQ0 D;  4I2L C;  4LC1 A;  5KP8 B;  3RGU A;  2LF4 A;  2KSE A;  4ZKP A;  1QRJ A;  5AW9 B;  3G3Z A;  1EMV A;  4H44 B;  1EXI A;  1L0N K;  3L70 D;  1LT1 A;  1ZMB A;  2N5H A;  1GXH A;  1XTG B;  3L70 G;  3ZDM A;  2KGD A;  3KZI E;  2E74 B;  1M7L A;  1SQV D;  1SQV G;  1UIX A;  4CPG A;  4C7N A;  2JYG A;  4WY4 C;  2WSS H;  1RF1 C;  4W80 A;  3Q5P A;  2LML A;  2C0W A;  3TK1 A;  2JO0 A;  4WB4 A;  4WY4 A;  5BVZ A;  5B5E H;  3F5H A;  5KTB A;  2QM7 A;  1VL2 A;  1RF1 A;  4Y99 C;  3DPH A;  3SWY A;  1ZME C;  2XZ0 D;  1KFN A;  1ZW0 A;  1JM0 A;  1PEM A;  2FYU E;  2QIW A;  3T97 A;  5EFW B;  3P8C E;  4YXW H;  3O8Z A;  3H32 A;  1NYH A;  1U57 A;  1BCC D;  3DTJ A;  3AED C;  2HYN A;  1E5W A;  1BCC G;  1EDI A;  2FVA A;  5I4T G;  1A02 J;  1YQ4 C;  5AW2 B;  2FFD A;  2KI7 B;  2PEN A;  1N7S C;  2CQ8 A;  1HGV A;  1IC2 A;  5CBO A;  3E1I A;  3SFD C;  3Q20 A;  3U1C A;  2RN0 A;  2KGA A;  4HKZ H;  1N7S A;  3OAK A;  2LTE A;  1Y8A A;  3TGU J;  3VYI A;  1Q81 Q;  1LWU B;  2BCC J;  2R5B A;  4PD4 I;  3FWL A;  1MFZ A;  1N8R Q;  4I7Z B;  3E7K A;  4JYB A;  1EIA A;  1PFI A;  3PJS K;  1AFO A;  3V4W A;  1ZOY C;  1KIL C;  1L4A C;  2YNY A;  4U3F E;  1HY8 A;  4WY4 D;  2PRR A;  1L0H A;  1GL2 A;  1GW3 A;  4GKG A;  2R5D A;  3FXE A;  3AEE C;  1PPJ D;  3H1J E;  1PPJ G;  1L4A A;  3M91 A;  2LKI A;  3B4S A;  3AE4 C;  2PY8 A;  4H13 B;  2KS1 B;  2RKL A;  2ZYD A;  4M0I A;  4EOT A;  1YTZ I;  2E5T A;  3VP8 A;  2HR3 A;  3ITK A;  3UIA A;  2LL8 A;  1RE3 C;  2KZI A;  2POH A;  3MUD C;  2YKQ A;  1FZF A;  4C7N B;  1FR2 A;  3EFG A;  2Q5U A;  1N7S D;  1RE3 A;  4IL6 E;  1S1C X;  3TGU D;  2K2Q A;  2WSC J;  2BCC D;  3TGU G;  2C9L Y;  2BCC G;  1ZNV A;  1YIJ P;  1AVO A;  2N50 A;  5BS2 A;  2JWA A;  5CHX A;  4W7Y A;  3G6E P;  4WY4 B;  4N78 D;  1RF1 B;  1EC5 A;  2B87 B;  2OYI C;  3GJN A;  3EJE A;  3RK2 C;  1QL2 A;  5EW5 E;  2KLV A;  2J58 A;  2Z5I A;  3T97 B;  3H1I E;  3JC2 2;  3FGA D;  1GK4 A;  2HPC A;  4DZO A;  1GL2 D;  5KAI H;  2XZR A;  1NVO A;  3GLM A;  3C1L A;  2R3S A;  3Q3D A;  2KW2 A;  4XA4 A;  4MRT C;  3H47 A;  1L4A D;  4COP A;  4QNB A;  1N2D C;  3BCC J;  2FYN C;  2I1J A;  1LTB C;  1LT9 A;  2H8P D;  1FDI A;  2KK7 A;  1N7S B;  1OMI A;  2KOS A;  5HGO A;  2KP8 A;  2CG5 B;  2Y9Z A;  4IL6 H;  4O9B A;  1F80 D;  2KOR A;  2YMY A;  1DIP A;  2KGC A;  1LTT C;  3P8C D;  4GDO A;  1M1J A;  2ZVO B;  3CI9 A;  3QWO C;  2GZJ A;  2ITA A;  1IMP A;  4OGQ C;  1L2P A;  5KJ7 C;  4CA3 A;  3L74 E;  4D6T E;  2K93 A;  1KIL B;  1L4A B;  3C8V A;  1J2J B;  2L5G B;  1AF8 A;  5KJ7 A;  3RBX A;  3Q2Y A;  3SWK A;  4GOE A;  5APW A;  1VKU A;  2LXC B;  2ZYA A;  1RE4 C;  1IFN A;  4HKG A;  2VLQ A;  3BCC D;  3CCM P;  2B9B A;  3BCC G;  1NHL A;  2FYU K;  3A5T A;  3BVH A;  2PGD A;  3V2R A;  1RE4 A;  5AVY B;  5HV8 A;  1FZG A;  1L0L E;  2E1M A;  1BXI A;  3DS3 A;  1MFT A;  3NXS A;  1NTK K;  1NTZ K;  2GM4 A;  1X79 B;  5KLI C;  2JDI H;  2QA4 P;  1PP9 E;  4U0A A;  1J1E C;  1NJI Q;  2ZAE B;  2EIA A;  2SPZ A;  2OYI B;  3D70 A;  2HPC B;  4DT0 A;  1UII A;  3RK2 B;  1UNK A;  4LGD E;  1HQB A;  4EDF A;  5KJ7 D;  1N86 A;  1VQP P;  1OVU A;  5APU A;  3M1M A;  3WBH A;  1QEX A;  2M5A A;  4TT3 H;  1OW7 A;  2H43 A;  1BSH A;  3M0A A;  2R32 A;  2FYN B;  5EJD A;  3L74 J;  3U1A A;  3H25 A;  1T3J A;  4UHP B;  1Z56 A;  2XDJ A;  2L9F A;  4U0B A;  4JYC A;  3TYY A;  4ZNC A;  3L70 E;  1T2K C;  5JPA A;  1GPJ A;  1SQV E;  1A8O A;  2P67 A;  3CCE P;  1YJW P;  1EDJ A;  1EZV D;  1ACP A;  1K9M Q;  1AV1 A;  1JB0 J;  1EZV G;  2W27 A;  2KNC A;  1GTW A;  2FAC A;  3KDP B;  1VQ6 P;  1IZN B;  2JP3 A;  2EHS A;  2I8D A;  4R0M A;  4OGQ B;  1L0L J;  1OVV A;  2O1J A;  1JY2 P;  1K04 A;  2FAE A;  3GG2 A;  1KYO E;  3OA7 A;  1EOQ A;  4R4M A;  1HTL C;  2YMK A;  4N3Y B;  3VOP A;  5KP7 B;  3CD6 P;  1IFI A;  1CSB A;  1E6J P;  4JBZ A;  5APV A;  2KG6 A;  3DS0 A;  4BXL A;  1OVR A;  2JO1 A;  1BCC E;  5APT A;  5CJ0 A;  3W68 A;  2JYL A;  1RY3 A;  2Z44 A;  3L74 D;  3S4R A;  3L74 G;  3GKL C;  1L0N J;  5CZD B;  2N9Y B;  3IAO A;  2OTK E;  2IZ1 A;  3L73 E;  5F2O A;  3G26 A;  3WUT A;  2IFN A;  4NEO A;  2KR5 A;  5CMZ A;  4OH8 B;  4IFF A;  4PH1 A;  2EFJ A;  2IYO A;  1KV4 A;  5KLI B;  2CNR A;  2KOP A;  2M8N A;  3OJA B;  4U0F A;  1U7M A;  2Z5H A;  1VQL P;  2L0Q A;  1J1E B;  1PGP A;  2K0D X;  1OIP A;  4OVN F;  1L0L D;  2MR8 A;  2LPK A;  2CPB A;  1L0L G;  3HZQ A;  3GZL A;  1GDT A;  1HWT C;  4DCK A;  2M5A B;  3GMA A;  4H44 D;  1JCD A;  1VQM P;  1SVF A;  3MHV A;  1M56 D;  2WPR A;  3AEC C;  3NTN A;  3CCU P;  3P8M C;  1LWU A;  2E74 D;  3G1G A;  4GOD A;  4BPH A;  1S5L X;  2C9N Y;  4LLH A;  4W7Z A;  3LMO A;  2FBW C;  2BUO A;  2Q7C A;  2MD9 A;  1L0N D;  5CCH C;  1L0N G;  3L72 E;  5F2K A;  2XNX A;  1NTM K;  2DNW A;  5KKZ C;  1R5S A;  2KNC B;  1Z6M A;  4JPZ B;  4L73 A;  1YTZ T;  3TGU E;  1L0I A;  5CCH A;  2BCC E;  1HGZ A;  4NPE A;  3HD7 C;  3HTK B;  2K94 A;  4IPY A;  3AE3 C;  1SQP E;  4N78 E;  2KWL A;  2KS1 A;  3ABV C;  2OTJ P;  1DD4 A;  1AA0 A;  1OWA A;  4H2W C;  3L73 J;  5HGM A;  3HD7 A;  3GF3 A;  2JR8 A;  1YQ3 C;  2CK3 H;  2WPT A;  3MIW A;  3VN0 A;  2PNG A;  3PTZ A;  5AW8 B;  4L74 A;  1KIL E;  1LTJ C;  5H2F E;  1PGQ A;  3GHG C;  2WQY C;  2O01 J;  3H1K E;  2WPQ A;  1HUC A;  1VPC A;  4RES B;  1VQO P;  1LTJ A;  2YKO A;  1VQ9 P;  1KYO D;  2B87 A;  3HYB A;  1JO5 A;  3IFM A;  3GHG A;  3EJB A;  3AEF C;  1QX8 A;  3AE7 C;  5DCK A;  1QL1 A;  3RBZ A;  1EQ7 A;  2AVA A;  2DGY A;  1P84 E;  1KQG B;  5HGL A;  1OW8 A;  3WMM 0;  2QEX P;  5CCH D;  2KZJ A;  3JSV C;  1OR5 A;  2QM8 A;  2X2B A;  2CPS A;  1SQV K;  4Y28 J;  3KZI H;  4H13 D;  3GW6 A;  4KJM A;  3L72 J;  5AW6 B;  2ROQ A;  3L73 D;  5AVV B;  1R8E A;  3L73 G;  2K0X A;  1FZA A;  1VF5 C;  2N9B A;  5H2F H;  4XFJ A;  1AUM A;  4XRQ A;  1G1I A;  1XTC C;  4R4L A;  3D6Y A;  2ONT A;  2ZJS E;  5AVS B;  1SQP J;  3V5B A;  1NU1 E;  2K3R A;  2FY8 A;  2XU6 A;  1EDL A;  5AW7 B;  3BCC E;  2WPV B;  1PZQ A;  2IYP A;  3F89 A;  2KXP B;  1P84 H;  3E1R A;  4B86 A;  2N6Z A;  2WSC H;  4H0L C;  2ZFC A;  1KIL A;  1EZV I;  2R44 A;  5KKZ B;  3H1K J;  1HVV A;  3RK3 C;  2ZYG A;  3BRV B;  3TSI A;  1USD A;  1TU3 F;  4MN4 C;  3HD7 B;  2RMZ A;  2YXQ B;  1GU4 A;  1AQ5 A;  2VSQ A;  3H0D A;  2PEI A;  1OZH A;  3L72 D;  4PJ0 E;  5AW0 B;  2VLP A;  1M57 D;  3L72 G;  2B88 A;  1PGO A;  2LKM A;  5KLV J;  2KOD A;  5AVZ B;  1AYI A;  2NRG A;  2L4B A; 
#chains in the Genus database with same CATH homology
 2L6E A;  1PEQ A;  1Q7Y Q;  1PEO A;  5F2N A;  2OAR A;  1JJ2 O;  1Q81 Q;  2E1M A;  2PEM A;  3G0V A;  2QEX P;  4XFZ A;  3CMA P;  1Q86 Q;  3G28 A;  4GR2 A;  1N8R Q;  3OW2 O;  2LF4 A;  3CXC O;  3DS3 A;  2BUO A;  3E2D A;  1VQ8 P;  3H47 A;  1EOQ A;  1QRJ A;  1YJ9 P;  1IUQ A;  4COP A;  4QNB A;  3CCJ P;  1EIA A;  5F2K A;  3CCS P;  3I56 P;  3CD6 P;  1VQ4 P;  2QA4 P;  2M8L A;  1KD1 Q;  4PH0 A;  1E6J P;  3CPW O;  3DS5 A;  3LRY A;  1ZMB A;  4U0A A;  3I55 P;  3DS0 A;  1BAJ A;  1RNI A;  4COC A;  1AUM A;  5HGO A;  4XRQ A;  1VQ7 P;  3NTE A;  1NJI Q;  2JYL A;  2EIA A;  2Z44 A;  2Z46 A;  1M1K Q;  2ONT A;  4IPY A;  2JYG A;  2CWO A;  3VRL C;  4GR6 A;  2OTJ P;  3MGE A;  2PY8 A;  1W2B O;  3CME P;  1KQS O;  2Z45 A;  1K73 Q;  4M0I A;  5HGM A;  1D1D A;  1YHQ P;  2JO0 A;  5F2O A;  1VQP P;  1RO2 A;  3G26 A;  2PEK A;  4U0D A;  3M1M A;  3WBH A;  1M90 Q;  1RO0 A;  1K30 A;  1A43 A;  1YJN P;  3G29 A;  3DPH A;  1VQ5 P;  4PH1 A;  1YI2 P;  2EFJ A;  2BQ1 E;  1QVG O;  3CC4 P;  1M74 A;  1KC8 Q;  3CCR P;  2M8N A;  4U0F A;  1PEU A;  1PEM A;  2PEJ A;  2XXM A;  1VQL P;  4XFY A;  2OTL P;  3G1I A;  3CCL P;  2BHV A;  3DTJ A;  4U0E A;  4U0B A;  1YIT P;  3G4S P;  3B5I A;  5I4T G;  2PEO A;  3DS4 A;  3RG6 C;  3DS1 A;  3HZQ A;  5HGN A;  1VQO P;  1VQN P;  1YIJ P;  2PEN A;  5JPA A;  5BS2 A;  1VQ9 P;  3DS2 A;  3G71 P;  2P9X A;  3HYB A;  3G6E P;  1A8O A;  4U0C A;  3CC2 P;  3H0D A;  4XFX A;  2PEI A;  1M6N A;  3G21 A;  3Q20 A;  1YJW P;  3CCE P;  2EG5 A;  3H4E A;  1K9M Q;  1VQK P;  1K8A Q;  3CCM P;  5DCK A;  1S72 P;  5BS1 A;  3CCQ P;  4WYM A;  1VQM P;  3P05 A;  2XT1 A;  2M8P A;  1Q82 Q;  2KOD A;  2DGY A;  2XV6 A;  2PEQ A;  4XRO A;  3CCV P;  5HGL A;  1M6E X;  3CC7 P;  1VQ6 P;  3CCU P;  1QVF O;  3G1G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...