1M1KQ

Co-crystal structure of azithromycin bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAKGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S RRNA
publication title The structures of four macrolide antibiotics bound to the large ribosomal subunit.
pubmed doi rcsb
total genus 48
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2002-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1m1kQ02
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1m1kQ01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1m1kQ03
3CCEP 3CC7P 3CCLP 1Q82Q 1Q81Q 1KD1Q 3CMAP 2QEXP 1K9MQ 1VQKP 1VQ7P 1VQ9P 1KC8Q 3G71P 3CMEP 3CD6P 3CCJP 2OTJP 3CCVP 1QVFO 1KQSO 3CC4P 1M90Q 1YHQP 1YITP 1NJIQ 1VQ5P 3G6EP 1YI2P 1JJ2O 1N8RQ 1YIJP 1VQPP 1YJNP 3I56P 3CXCO 1M1KQ 1VQNP 1K73Q 1QVGO 1VQ6P 1VQMP 1VQOP 3CCQP 1YJWP 1S72P 3CCUP 1K8AQ 1VQLP 1YJ9P 3OW2O 3CCMP 1Q7YQ 3G4SP 2OTLP 2QA4P 1VQ8P 3CPWO 1W2BO 3CC2P 3CCRP 1Q86Q 1VQ4P 3I55P 3CCSP
chains in the Genus database with same CATH superfamily
1BE3J 1ZR2A 5H2FH 3V4QA 3H0DA 1VPCA 3VMYA 2Q3IA 1OR5A 3P32A 1QRJA 3L75J 1CEIA 3CI9A 1RNIA 1JY2O 2KYVA 4QMAA 1G2CA 1VQ4P 4PJ0H 2N50A 1PV3A 3CMAP 3RK2B 5F2KA 3H1LD 3VN0A 2RN0A 2LKMA 5EW5E 5AW0B 1HY8A 1GU5A 1Z56A 2ITAA 4ZNCA 3A3YB 3TDKA 1N7SA 1CSBA 2K9JB 3CPWO 4XRQA 2J5UA 3B5ND 4M3LA 1L2PA 1IFPA 3TGUG 1FZBA 3E2DA 2PEOA 3H1IE 1AQ5A 5CMZA 1HJ0A 1LTSC 1VQ6P 1M74A 1OVUA 2PRRA 1SQBE 3H1KD 2FXPA 3L70J 1LP1A 1KV4A 1BGYD 1Q90D 3U1CA 1YJNP 4U3FJ 2L5GB 1YBKA 1S9KD 5AVQB 2E76B 2OTLP 2HPCB 1SQVK 2KODA 3L35A 1J1DC 2N5HA 2P1JA 1NU1G 2Y9ZA 2IX7C 1JY3N 1YTZT 1AQTA 3V5BA 3CX5I 3HE4B 5APUA 2YMKA 1YI2P 1L4AB 5AW2B 3B5NB 4GIFA 1VL2A 3IFMA 1GU4A 2EHTA 2QJYC 3V4WA 4MRTC 3I5CA 5CJ0A 4C7NB 1NVOA 3AE9C 2KW2A 4K35A 5AW6B 4ZKUA 2FYZA 4I1LA 2E75B 3KDPB 1YITP 2FFDC 3QWOC 1NTZG 2G8YA 2XV5A 2KI7B 1L0HA 3AEEC 1MFZA 2XKMA 1IFJA 4XA4A 2CQ8A 1SFCB 1NWQA 3BRVB 5CBOA 2K0DX 2N6YA 2QVAA 1YQ3C 1QL2A 1EXJA 2FAEA 3GZMA 3JSVC 1LWUB 1M6EX 2FY8A 1NKNA 2GUSA 3H1HE 4KHXA 2AF8A 3NY7B 5HGLA 3HE5B 1K8AQ 3VTPC 2Q5UA 3W67A 1Y47A 3HTKB 3CCSP 5APSA 3RK3E 2IYPA 4H44B 3DPHA 1JTHA 4RO0A 1GL2C 1EOQA 4YXWH 1Y8AA 5APQA 3A7OA 4GDOA 3MIWA 4I6MC 2N9YB 3H1LJ 1SQBD 3WBHA 5APYA 2NPSB 2AFEA 1RF1A 1HBWA 2IZ1A 2MD9A 2QJKC 3TGUE 1E79H 1OW6A 1ZP0C 3EJEA 1FAVA 3V6IA 2IYOA 1ACPA 3NMDA 2GZJA 3AE4C 5C39A 2M5AA 2DGYA 3G1IA 3H47A 1MUUA 3ABVC 2FHSC 3RK3C 1PP9D 1RE3C 1JB0J 2E5YA 3QH9A 1LGHB 2KOGA 3H1KJ 2UWJE 5F2OA 3O6QA 2R3SA 2GZGA 1L0LG 3II6A 1BGYJ 1PZQA 5B5EE 2BHVA 3PLNA 3F5HA 4N6JA 1LT9A 2JWAA 2Q9IA 3KXDA 4BPGA 4OWFA 1LTTC 3D6YA 3V2PA 3A5TA 2H89C 2O01J 1NU1E 1OXZA 2PEKA 3SSUA 3M0AA 3M1MA 3IF4A 1GL2D 1M1JB 2JR8A 2QNWA 1NOHA 2XV6A 3PJSK 1GPJA 1NTKK 3DS4A 1FZEA 2CPSA 3M9QA 2OTJP 1JCCA 3HD7C 2SPZA 2LPKA 3BATA 1ZMBA 2O3JA 1FZCA 3H1HD 4DG9A 1VQNP 3TK1A 1NTZE 2XDJA 1KILE 2WSEH 1N73B 3EJBA 1ZV8A 2FYNC 3H32B 2OYOA 2QM7A 1OFCX 1SQPK 1SQXK 5KLVG 1U7JA 3HZQA 1KORA 4TT3H 2E74B 5CCHC 1F80D 4PXHB 1M6NA 3L72G 2N1TC 4W7YA 1QX8A 1FJPA 3BASA 2M8RA 2P58A 4PV1C 2P67A 1RQVA 2YNYA 1M7LA 1VKUA 2WQYC 2PY8A 4Y99B 2VLOA 2QJPB 1WRGA 4COCA 1X22A 1G2CB 1E6JP 1SQVJ 5B5EH 2KGDA 3MGEA 1CZQA 2FVEA 1J1EC 3MUDC 2OYHC 4RJTA 1BCCG 2ZT9B 1NTKD 5APVA 1KYOI 2D2CD 5CZDB 1N7SB 4GR6A 3NTNA 4CPGA 3G9RA 1URQC 5K5GB 2KUBA 2XZRA 3GZLA 2YIUC 1M57D 1J2JB 4DT0A 1VHNA 2HLOA 4UB6E 1SQPD 1SQXD 2A45I 5GTIE 4GODA 1LP1B 2NO8A 1PP9J 1L0LE 5CCHD 1Q7YQ 2KG6A 3RL0B 2W83C 3OAKA 3UIAA 4U0FA 1FE6A 1GXHA 1DEEG 1H0TA 2B87B 3V2QA 2LTEA 1S72P 1VQLP 2GA1A 2KLUA 2FBWC 1KILD 3VMZA 1HGVA 2W6BA 3B5IA 3CCEP 3BCCG 3S9OA 1Q81Q 1XTGB 3RK2C 4PH0A 2B88A 2POHA 2KR5A 4U0DA 1EZVG 3HRNA 1NGMB 2ROQA 1GD2E 1KB9E 3T97A 1T2KC 3DTJA 2QA4P 5AVUB 1LTBC 2E42A 4PJ0E 4I7ZB 3H1HJ 4H2XC 2K94A 1SS1A 4L73A 1VQ9P 1HUCA 5KLVE 1PIXA 4XFYA 4Z1MH 1IFDA 1LNQA 4H13D 4I2LC 2QG4A 3EWKA 1GK4A 2K92A 3L72E 1WT6A 2YMYA 5KP8B 3E1RA 2FXMA 1EC5A 1A8OA 4KT0J 2E5TA 4U0CA 4PD4E 3LIEA 2KB7P 3PP5A 2OARA 2WSEJ 1YHQP 4UB6H 1N8RQ 1DH3A 2LR2A 5GTIH 2C9NY 1VF5C 2C0WA 1T3JA 1PPJG 1P84E 3WU2E 3D71A 2E76C 1W2BO 1JTHB 3CWBD 1PGPA 5BVZA 2HR3A 3E1IA 1VQKP 3N7NA 4WY4C 2JU2A 1BCCE 5KLVK 5AW3B 2HYNA 1FZGA 3MGNA 4HYTB 2L4BA 4H2WC 1QVGO 5B66E 1RF1B 3MZWB 3DS2A 1L0LD 1RF0A 2B9BA 2OYIA 1NTKJ 1D7MA 3EJDA 2M5AB 4NEOA 1L0NK 1YYCA 3DS3A 2FYUG 3L71G 1KQSO 3C9IA 4AYCA 2LIUA 2M8PA 1VQPP 2Q6QA 4N78E 3CXHE 1RE4A 1KB9H 1GL2A 1YJ9P 2XNDH 4H0LD 1X79B 3ITKA 1SFCC 2ZAEB 1SQPJ 1SQXJ 2H7HA 3O6QB 1EIAA 1Q2NA 2GZIA 3GJNA 2WSSH 1LWUC 2HG5D 2EG5A 1LT9B 2CNRA 3CXCO 2KLVA 2PENA 1KB9D 2ZXEB 4L76A 1DV5A 1BDDA 2E1MA 1FBMA 2AEMA 2VSQA 1VF5D 1H89A 2VLPA 4U0EA 2ZXXA 1H88A 3BCCE 4HB1A 4H44C 2Z4EA 1SQQG 1QVFO 3AE1C 4PD4H 1LTJA 5KLVD 1K05A 2IPPA 1EZVE 1OZHA 4A7PA 3LMOA 4HKZH 1USEA 1KN7A 2FACA 1P84H 3L72D 4NPEA 1JOCA 3M91A 3WU2H 5AVRB 2KS1A 5I4TG 2ONTA 2NPSC 5CJ4A 2GDWA 1FZCB 1LTAC 2QEXP 3CCVP 5KAFE 1L0ND 1S4XA 4PD4D 1VQ5P 2J58A 2KP8A 3L73G 5F2NA 1QL1A 2IBZE 1IK9A 5B66H 2LL8A 1PEUA 2IZ0A 5TISE 2B87A 1P84D 2DNWA 3FWNA 3H1JG 1Q86Q 3NTEA 3SFDC 1E0HA 5EFWB 1BE3G 3GHGA 5AVWB 3M0DA 1BCCD 1HVVA 2AEJA 1NQ4A 2O1KA 3TNUA 7CEIA 1USDA 1BAJA 2O01N 1ZMEC 2K3RA 3CXHH 2KOSA 2N98A 1T6AA 1SQBK 3WUTA 1NTMG 1IC2A 1PPJE 3DS1A 4WB4A 2LF4A 1JNMA 3VMXA 3RL0g 2YO2A 2M3BA 1HJBA 3CWBJ 2YO3A 4YXDC 3H6PA 2ZVOB 3U59A 1FU1A 4N78D 3CXHD 1DD4A 2HFED 5CCHA 2NZ2A 4HJGH 1IFNA 4OGQC 5AVVB 1M1JC 1EDIA 1KZUB 1HGZA 3HUSA 4B86A 3GKLC 3OJAB 1ZNVA 5BU5A 4PH1A 2KSEA 2FYUE 1OW7A 4COPA 3L71E 1L0LJ 2BCCG 5BS2A 2R3CA 1KILA 3VP8A 2KWLA 1N73C 2LKIA 4BPHA 3EFFK 2Z44A 4OVNF 1N2DC 4RKUJ 1KFMA 3CLQA 3KHUA 1OIPA 4C7RA 3MUDA 3H1ID 5KAFH 1NHLA 2GDYA 2LMLA 2E74C 3BVHA 1VQMP 1EZVD 4U3FG 1H0TB 5TISH 3CC2P 1MV8A 3KPEA 2L91A 3IR9A 1IK7A 4TLFA 1DD3A 4Y99C 3AEBC 3SWYA 3E7KA 1SQQE 2QJPC 1K30A 4U7JA 2J59M 2K0XA 2PAJA 4UHPB 2IBZD 3PHLA 1ZRTE 2MVUA 4NPFX 5KLVJ 2XT1A 3G28A 2QSIA 2ZT9C 3T97B 3A0HE 3B71A 4IFFA 2JWDA 1GZLA 2KGAA 2K2QA 3L72J 2I1JA 3FX0A 2JU1A 2LOLA 3CCUP 3L73E 1WMKA 1HH0A 3B4QA 2KGEA 1L0NJ 4XFXA 1S3JA 4XE5B 1PPJD 1L0IA 2I8DA 4DOJA 3AE7C 3H1JE 2MR8A 3DS5A 2WPVB 2WT7A 4EDFA 1BE3E 4W80A 2KNCA 1JEKA 4BXLA 3Q5SA 1FC2C 4JF7A 2L9FA 3MD0A 2KZIA 2AEFA 3RL0C 3IAOA 1FDMA 1NTME 3P8MC 1S5LX 1EQ7A 3PTZA 2ERHA 3FXDA 2RMZA 2ZFCA 1AYIA 2FYUD 2JO1A 2FVFA 1R5SA 4QNBA 4N3YB 2AXCA 5GTHE 3EQ2A 2M0BA 3CX5E 5DJTB 1GTWA 3H1LG 4IL6E 1FOSF 2WPRA 2KGCA 4AQRD 2P9XA 1NU1K 3L4FA 2JEEA 3RK3D 3CCJP 2OYIB 4ZMDA 1EDJA 2JGPA 5AVXB 1AJYA 1FJKA 2BCCE 3PRJA 3KYQA 2KG9A 3B4SA 4C46A 3L74G 3P7KA 4WYMA 1VDFA 2CPBA 2JYGA 2K37A 2PEJA 4I7ZC 3VYIA 1GL2B 4IZ6A 3L37A 3A0HH 2YKOA 4R4MA 1M90Q 3TGUD 2GUVA 1SQQD 1RO0A 1A02J 3GF7A 1NTZK 3VOPA 1BXIA 5HGOA 4U3FE 2KOPA 2K88A 3H1IJ 5HV8A 4OH8B 1ZRTD 2HODA 2FQ0A 1DEBA 3FWLA 2BQ1E 1A43A 2WSFH 4JBZA 2XU6A 3KZIE 1PL5A 3PH0A 3G1GA 1SQBJ 5KP7B 1VQOP 3CCQP 3HD7D 1JO5A 1OVVA 5E79E 2MJZA 3L73D 2DW3A 1BSNA 1LTJB 1K9MQ 2H43A 3H1JD 1R8EA 1ZN5A 2WTYA 1NU1D 3MHVA 1NYHA 5BS1A 2KIKA 2BEQD 1JMBA 5EJDA 2O1JA 2R5DA 2KS1B 1RF1C 5GTHH 1UJZA 3CX5H 2N1TD 1MFTA 1NTMD 4IL6H 2RKLA 2OGUA 3CL3D 4PV1D 3MTUE 2KORA 1YTZI 2Q3EA 3Q5RA 2A45G 3OW2O 1NTZD 2R5BA 3CX5D 1LJ2A 2FVAA 2KXPB 3GHGB 2D2CB 4D6TG 3TNUB 2MF4A 2JJLA 1IMPA 3G71P 3IN6A 2XZ0D 4WWIA 3AEFC 5AVTB 1SP4A 1AFOA 1L0LK 1EDKA 4JYCA 1KTMA 1JMMA 1SQVG 2BCCD 5HVCA 3L36A 1URQD 3G21A 4NPDA 2FYUJ 3RBXA 3H1LE 1IZNB 1OW8A 2W90A 4YPCA 5AVYB 1U57A 1Y9BA 3KZIH 2QM8A 3P8CE 2L6EA 5CHXA 4U0BA 4ZKPA 3HUSB 1OWAA 1X3OA 3P05A 2JP3A 5E79H 1N7LA 4PV1B 4U3FD 2P2UA 2Y9YA 3L74E 2MY5A 1FZCC 3JCUE 3H25A 3V2RA 1KILB 1CW5A 3SFEC 4GKGA 1K73Q 2FXOA 1PP9G 2FFDA 2JAZA 3TGUJ 2MKVA 1UIIA 2RH0A 1D1DA 3GW6A 1SQQJ 1UNKA 2WWWA 2NRGA 2N6ZA 2Z5HA 2KOQA 1S9KE 1YIJP 3RK2D 5KLIB 1L4AC 3B5NC 3Q5PA 3G4SP 1T2KD 4H13B 1IUQA 1DNYA 1NH4A 2OTKE 2JBGA 2GDXA 2ZVNB 2E75C 4CA3A 1XTCC 4W7ZA 4IOIH 1NAYA 2YKPA 1KYOE 3FGAD 4LC1A 2R44A 4BRYA 3S1KA 5L8RJ 1GW3A 1NU1J 1KQFB 2Z45A 4GOEA 2I1KA 3H1HG 2JKVA 1EXIA 3OA7A 4UB8E 4YTPC 2ZYAA 5KJ7C 3GF3A 1FS0E 1U7MA 4HH2A 1PGOA 4GT1A 4RESB 1NTMJ 5KKZB 2BASA 4DCKA 3R4YA 2WT7B 1A02F 2KNCB 1PEOA 4D6TE 2P10A 2E76D 2V7QH 3FXEA 1AF8A 2Q1KA 3JCUH 2B89A 1NTZJ 2L22A 1KMIZ 1RE3A 3A2AA 3S4RA 4WY4D 2PNGA 3P8CD 1S2EA 1QLED 4WVZA 1NKZB 1S1CX 1AVYA 1L4AD 4EOTA 1SQVE 1RY3A 3R2PA 3NFQA 2VLNA 4IFDK 2GZFA 3L74D 1RQUA 2BCCJ 4Y28J 4H0LB 3D6ZA 2O01H 3NXSA 1BDCA 2E75D 4JPZB 3RG2A 1MZ8A 1G1JA 1NTKG 1DX7A 1X8YA 2M8LA 3WUUA 4O9BA 5CCGC 3GLMA 2XZ1C 1SFCD 3CMEP 1BSHA 1NJIQ 1ZXGA 1T8ZA 2JO0A 1VF5B 2CK3H 1KFNA 1JY2P 5KJ7D 1IFMA 5CBNA 1GMJA 3HD7A 5DJUB 1KYOH 2YXQB 2QRXA 3L75G 1PP9E 2IFNA 2KZJA 2K5XA 4AUWA 1NO4A 2L0QA 3M9HA 1SQPG 3CC7P 1SQXG 4WY4B 1KD1Q 2KK7A 2K93A 1TU3F 3AE8C 1ZOYC 1H8AA 1AA0A 3LIDA 4UB8H 3V2NA 3WUVA 5AVZB 2FKWB 2XXMA 4EI2A 2Y0DA 1EMVA 1KQLA 4H44D 2HODB 3JC22 2ZJSE 1T3UA 1KYOD 3SWFA 2A45H 2Q7CA 1KQGB 2YXRB 2M8NA 2N1TA 2WPTA 5AW5B 1K04A 4GOFA 1IFIA 2EIAA 1W5CE 2NPSD 3CE7A 2W6JH 3LW5H 1IMQA 2OQQA 3CCMP 5APTA 2EFJA 4ASVA 4XROA 4F37A 1SLQA 3LRYA 4IFMA 1CI6A 2WSCH 3L70G 1QEXA 1HQBA 3DS0A 4D6TD 1FZFA 2CGQA 3BCCD 2OYHA 5CCGD 1RF0C 2OYIC 5KAIE 3RBZA 1GK6A 1HTLC 1NAFA 4K3AA 4BWNA 2N9BA 5DCKA 1URQA 1ZW0A 2AXTE 1T8KA 1SQVD 2A06G 4KJMA 3AEAC 3CCLP 3U1AA 3H4EA 1JM0A 2LXBA 3WMM0 2WPQA 1RE4C 4MN4C 2FYUK 3AE3C 1S5LE 3AECC 2VLQA 2WPSA 1X0TA 2M3EA 5AW1B 2FQ2A 2Y0CA 5AVSB 4OGQD 2IFMA 3AE6C 2AVAA 2WVRA 1OX3A 2M5RA 5AW4B 2C0XA 1N7SC 3N4XA 2W8ZA 1AVOA 3CWBG 1GDTA 4HKGA 3L74J 1VQ8P 2V7QJ 1J1DB 1LTJC 1NTKE 1M8OB 2W27A 1VQ7P 5BU8B 1JY3O 3O8ZA 1PEMA 2G3AA 3HYBA 3AE2C 1SQQK 4JQ0D 2WMMA 3AEDC 2Z5IA 3Q3DA 2H8PD 2QJYB 2E74D 3F89A 4EYYQ 3D70A 3L75E 3KQGA 1BCCJ 1EDLA 2PEIA 2ZYGA 1KB9I 1SQPE 1SQXE 2K9JA 2FFDB 1R5LA 2XNXA 3VRLC 3L71D 3A0BE 1YJWP 5KAIH 4OGQB 5APWA 2JYLA 1FDOA 2IDBA 3TSIA 4EIJA 1N86A 4DZOA 1HF9A 3GHGC 1AUMA 3M0DC 2D2CC 3Q20A 2X2BA 2AXTH 3Q2YA 1IO4A 1PGJA 3RG6C 2Z46A 2QE7H 4LGDE 1GXGA 2H88C 3G6EP 5AW9B 2ZT9D 5AW8B 3SWKA 4L75A 1S5LH 4PWVB 1N7SD 2KG8A 4PD4I 3ZDMA 1FOSE 1NTMK 2ZYDA 4U0AA 1JUNA 1JY3P 2Y0EA 3L70E 2HPCA 4BRYB 1P84I 1JJ2O 1HWTC 5KP6B 1UIXA 3H1KG 2WITA 4WY4A 3G29A 1LTGC 3HUSC 4D6TJ 4XFJA 3HE4A 1BGYG 2LXCB 1L4AA 4JYBA 4QKOA 1AV1A 3B5NA 3BCCJ 2KSJA 1L0NG 1FZAA 4H2YC 2QJKB 3LW5J 1MZ9A 2A06E 2CWOA 3RL0D 4C7NA 1G1IA 1KILC 3G3ZA 2EHSA 2N5IA 2PGDA 3AEGC 2WSCJ 1PFIA 2MVVA 2GM4A 3RK3B 1GW4A 5TJHA 2GZEA 3CXHI 1SFCA 1OVRA 3CC4P 3G26A 3TYYA 3BRTB 2V4HA 5AW7B 3C1LA 3W68A 2K9YA 1BE3D 5APXA 1DIPA 3I56P 1M1KQ 3A0BH 4IL6X 5KLIC 5KJ7A 2C9LY 1MKMA 1E5WA 1LWUA 3CWBE 2YKQA 1PGQA 2LIWA 3TF5A 3HE5A 3L75D 3K5BA 1Q82Q 5HGMA 4H13C 1KLPA 3HTKA 2JB0A 1YQ4C 3EFGA 2AFDA 3U43A 3GG2A 5KTBA 3USSA 1SVFA 1FDIA 4R4LA 2R32A 3B8EB 3I55P 5HGNA 1IJDB 4L74A 4ASWA 1ZR4A 1EZVI 2FQ1A 3CD6P 3M9BA 3HD7B 3Q1MA 4IPYA 2NPSA 2WZ7A 1FR2A 3GMAA 1LT9C 4M0IA 2CG5B 2PEMA 1JY2N 2P7JA 2FYNB 4WBAA 5KKZC 2MR7A 2BUOA 1M56D 1JCDA 3H1IG 2JQ4A 3L71J 1RHZB 5H2FE 2IBZI 3L70D 1W2EA 2PFXA 5CCGA 5M1BA 1Z6MA 1LT1A 2N1TB 1RO2A 1SQBG 2JDIH 2K1AA 1PEQA 4R0MA 2FADA 2A06D 2KOOA 2QIWA 2VRSA 3MP7B 1RH5B 4H0LC 2IBZG 2GYKA 1CI6B 3M06A 4GR2A 1OMIA 3H1KE 4LLHA 2PEQA 1J1EB 2OYHB 1BGYE 2W6AA 3G0VA 1L0NE 1KC8Q 1M1JA 2E43A 1ZLLA 1URQB 1QGKB 3VP9A 3AE5C 3RGUA 4BPFA 2YIUB 5JPAA 2PP6A 2K0YA 3VMAA 1X9VA 1N73A 3H32A 3C8VA 4XFZA 3L73J 1LTIC 2BEZF 2WSFJ 3H1JJ 4DJGA 3CCRP
chains in the Genus database with same CATH topology
5I4TG 2ONTA 1PEOA 4U0FA 2QEXP 1K9MQ 1VQKP 2CWOA 1VQ7P 3HZQA 3CCVP 2EIAA 3H0DA 1PEMA 3HYBA 1VQ5P 1YI2P 5BS1A 1QRJA 2DGYA 1K73Q 1M6NA 1RO2A 4QNBA 3G1IA 1VQMP 1S72P 1QVGO 3H47A 5F2NA 1VQLP 1RNIA 3CCMP 3DS2A 2EFJA 1PEUA 4XROA 3LRYA 3CC2P 1Q86Q 1VQ4P 3NTEA 2PEIA 1PEQA 3B5IA 1D1DA 3CCEP 1Q81Q 3CMAP 3DS0A 2P9XA 2PY8A 3DS3A 5F2KA 4PH0A 3CCJP 1KQSO 2M8NA 3CC4P 3G26A 4U0DA 1YITP 3VRLC 2M8PA 5F2OA 1YIJP 4COCA 1VQPP 3I56P 1M1KQ 1K30A 1BAJA 4GR2A 1E6JP 1YJWP 1YJ9P 3OW2O 2BHVA 3DTJA 3G4SP 2JYLA 3MGEA 2QA4P 5DCKA 3CPWO 2PEQA 4XRQA 1AUMA 3Q20A 4WYMA 3DS1A 1EIAA 2XT1A 2M8LA 3G28A 2JYGA 3CCLP 1Q82Q 3H4EA 2PEJA 2LF4A 3RG6C 3E2DA 3G0VA 2PEOA 2Z46A 1IUQA 1KC8Q 3G71P 1VQ9P 3CMEP 5HGMA 1M6EX 1M90Q 1NJIQ 2PEKA 3G6EP 2EG5A 2JO0A 4GR6A 4XFYA 3M1MA 5HGLA 1RO0A 3CXCO 1VQ6P 1K8AQ 1M74A 2PENA 3CCUP 5HGOA 2E1MA 3G21A 2XV6A 5JPAA 4XFXA 3I55P 3CCSP 4U0AA 5HGNA 4U0EA 3CC7P 1KD1Q 2BQ1E 2Z45A 1A43A 1A8OA 3DS4A 3DPHA 3DS5A 4PH1A 3CD6P 2OTJP 4U0CA 1QVFO 2OARA 1YHQP 4COPA 4XFZA 2XXMA 4IPYA 1EOQA 1JJ2O 1N8RQ 3G1GA 1ZMBA 2L6EA 1YJNP 4U0BA 5BS2A 1VQNP 3G29A 1VQOP 3CCQP 4M0IA 1Q7YQ 2PEMA 3P05A 2OTLP 1VQ8P 2KODA 3WBHA 1W2BO 3CCRP 2BUOA 2Z44A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCE P;  3CC7 P;  3CCL P;  1Q82 Q;  1Q81 Q;  1KD1 Q;  3CMA P;  2QEX P;  1K9M Q;  1VQK P;  1VQ7 P;  1VQ9 P;  1KC8 Q;  3G71 P;  3CME P;  3CD6 P;  3CCJ P;  2OTJ P;  3CCV P;  1QVF O;  1KQS O;  3CC4 P;  1M90 Q;  1YHQ P;  1YIT P;  1NJI Q;  1VQ5 P;  3G6E P;  1YI2 P;  1JJ2 O;  1N8R Q;  1YIJ P;  1VQP P;  1YJN P;  3I56 P;  3CXC O;  1M1K Q;  1VQN P;  1K73 Q;  1QVG O;  1VQ6 P;  1VQM P;  1VQO P;  3CCQ P;  1YJW P;  1S72 P;  3CCU P;  1K8A Q;  1VQL P;  1YJ9 P;  3OW2 O;  3CCM P;  1Q7Y Q;  3G4S P;  2OTL P;  2QA4 P;  1VQ8 P;  3CPW O;  1W2B O;  3CC2 P;  3CCR P;  1Q86 Q;  1VQ4 P;  3I55 P;  3CCS P; 
#chains in the Genus database with same CATH topology
 1BE3 J;  1ZR2 A;  5H2F H;  3V4Q A;  3H0D A;  1VPC A;  3VMY A;  2Q3I A;  1OR5 A;  3P32 A;  1QRJ A;  3L75 J;  1CEI A;  3CI9 A;  1RNI A;  1JY2 O;  2KYV A;  4QMA A;  1G2C A;  1VQ4 P;  4PJ0 H;  2N50 A;  1PV3 A;  3CMA P;  3RK2 B;  5F2K A;  3H1L D;  3VN0 A;  2RN0 A;  2LKM A;  5EW5 E;  5AW0 B;  1HY8 A;  1GU5 A;  1Z56 A;  2ITA A;  4ZNC A;  3A3Y B;  3TDK A;  1N7S A;  1CSB A;  2K9J B;  3CPW O;  4XRQ A;  2J5U A;  3B5N D;  4M3L A;  1L2P A;  1IFP A;  3TGU G;  1FZB A;  3E2D A;  2PEO A;  3H1I E;  1AQ5 A;  5CMZ A;  1HJ0 A;  1LTS C;  1VQ6 P;  1M74 A;  1OVU A;  2PRR A;  1SQB E;  3H1K D;  2FXP A;  3L70 J;  1LP1 A;  1KV4 A;  1BGY D;  1Q90 D;  3U1C A;  1YJN P;  4U3F J;  2L5G B;  1YBK A;  1S9K D;  5AVQ B;  2E76 B;  2OTL P;  2HPC B;  1SQV K;  2KOD A;  3L35 A;  1J1D C;  2N5H A;  2P1J A;  1NU1 G;  2Y9Z A;  2IX7 C;  1JY3 N;  1YTZ T;  1AQT A;  3V5B A;  3CX5 I;  3HE4 B;  5APU A;  2YMK A;  1YI2 P;  1L4A B;  5AW2 B;  3B5N B;  4GIF A;  1VL2 A;  3IFM A;  1GU4 A;  2EHT A;  2QJY C;  3V4W A;  4MRT C;  3I5C A;  5CJ0 A;  4C7N B;  1NVO A;  3AE9 C;  2KW2 A;  4K35 A;  5AW6 B;  4ZKU A;  2FYZ A;  4I1L A;  2E75 B;  3KDP B;  1YIT P;  2FFD C;  3QWO C;  1NTZ G;  2G8Y A;  2XV5 A;  2KI7 B;  1L0H A;  3AEE C;  1MFZ A;  2XKM A;  1IFJ A;  4XA4 A;  2CQ8 A;  1SFC B;  1NWQ A;  3BRV B;  5CBO A;  2K0D X;  2N6Y A;  2QVA A;  1YQ3 C;  1QL2 A;  1EXJ A;  2FAE A;  3GZM A;  3JSV C;  1LWU B;  1M6E X;  2FY8 A;  1NKN A;  2GUS A;  3H1H E;  4KHX A;  2AF8 A;  3NY7 B;  5HGL A;  3HE5 B;  1K8A Q;  3VTP C;  2Q5U A;  3W67 A;  1Y47 A;  3HTK B;  3CCS P;  5APS A;  3RK3 E;  2IYP A;  4H44 B;  3DPH A;  1JTH A;  4RO0 A;  1GL2 C;  1EOQ A;  4YXW H;  1Y8A A;  5APQ A;  3A7O A;  4GDO A;  3MIW A;  4I6M C;  2N9Y B;  3H1L J;  1SQB D;  3WBH A;  5APY A;  2NPS B;  2AFE A;  1RF1 A;  1HBW A;  2IZ1 A;  2MD9 A;  2QJK C;  3TGU E;  1E79 H;  1OW6 A;  1ZP0 C;  3EJE A;  1FAV A;  3V6I A;  2IYO A;  1ACP A;  3NMD A;  2GZJ A;  3AE4 C;  5C39 A;  2M5A A;  2DGY A;  3G1I A;  3H47 A;  1MUU A;  3ABV C;  2FHS C;  3RK3 C;  1PP9 D;  1RE3 C;  1JB0 J;  2E5Y A;  3QH9 A;  1LGH B;  2KOG A;  3H1K J;  2UWJ E;  5F2O A;  3O6Q A;  2R3S A;  2GZG A;  1L0L G;  3II6 A;  1BGY J;  1PZQ A;  5B5E E;  2BHV A;  3PLN A;  3F5H A;  4N6J A;  1LT9 A;  2JWA A;  2Q9I A;  3KXD A;  4BPG A;  4OWF A;  1LTT C;  3D6Y A;  3V2P A;  3A5T A;  2H89 C;  2O01 J;  1NU1 E;  1OXZ A;  2PEK A;  3SSU A;  3M0A A;  3M1M A;  3IF4 A;  1GL2 D;  1M1J B;  2JR8 A;  2QNW A;  1NOH A;  2XV6 A;  3PJS K;  1GPJ A;  1NTK K;  3DS4 A;  1FZE A;  2CPS A;  3M9Q A;  2OTJ P;  1JCC A;  3HD7 C;  2SPZ A;  2LPK A;  3BAT A;  1ZMB A;  2O3J A;  1FZC A;  3H1H D;  4DG9 A;  1VQN P;  3TK1 A;  1NTZ E;  2XDJ A;  1KIL E;  2WSE H;  1N73 B;  3EJB A;  1ZV8 A;  2FYN C;  3H32 B;  2OYO A;  2QM7 A;  1OFC X;  1SQP K;  1SQX K;  5KLV G;  1U7J A;  3HZQ A;  1KOR A;  4TT3 H;  2E74 B;  5CCH C;  1F80 D;  4PXH B;  1M6N A;  3L72 G;  2N1T C;  4W7Y A;  1QX8 A;  1FJP A;  3BAS A;  2M8R A;  2P58 A;  4PV1 C;  2P67 A;  1RQV A;  2YNY A;  1M7L A;  1VKU A;  2WQY C;  2PY8 A;  4Y99 B;  2VLO A;  2QJP B;  1WRG A;  4COC A;  1X22 A;  1G2C B;  1E6J P;  1SQV J;  5B5E H;  2KGD A;  3MGE A;  1CZQ A;  2FVE A;  1J1E C;  3MUD C;  2OYH C;  4RJT A;  1BCC G;  2ZT9 B;  1NTK D;  5APV A;  1KYO I;  2D2C D;  5CZD B;  1N7S B;  4GR6 A;  3NTN A;  4CPG A;  3G9R A;  1URQ C;  5K5G B;  2KUB A;  2XZR A;  3GZL A;  2YIU C;  1M57 D;  1J2J B;  4DT0 A;  1VHN A;  2HLO A;  4UB6 E;  1SQP D;  1SQX D;  2A45 I;  5GTI E;  4GOD A;  1LP1 B;  2NO8 A;  1PP9 J;  1L0L E;  5CCH D;  1Q7Y Q;  2KG6 A;  3RL0 B;  2W83 C;  3OAK A;  3UIA A;  4U0F A;  1FE6 A;  1GXH A;  1DEE G;  1H0T A;  2B87 B;  3V2Q A;  2LTE A;  1S72 P;  1VQL P;  2GA1 A;  2KLU A;  2FBW C;  1KIL D;  3VMZ A;  1HGV A;  2W6B A;  3B5I A;  3CCE P;  3BCC G;  3S9O A;  1Q81 Q;  1XTG B;  3RK2 C;  4PH0 A;  2B88 A;  2POH A;  2KR5 A;  4U0D A;  1EZV G;  3HRN A;  1NGM B;  2ROQ A;  1GD2 E;  1KB9 E;  3T97 A;  1T2K C;  3DTJ A;  2QA4 P;  5AVU B;  1LTB C;  2E42 A;  4PJ0 E;  4I7Z B;  3H1H J;  4H2X C;  2K94 A;  1SS1 A;  4L73 A;  1VQ9 P;  1HUC A;  5KLV E;  1PIX A;  4XFY A;  4Z1M H;  1IFD A;  1LNQ A;  4H13 D;  4I2L C;  2QG4 A;  3EWK A;  1GK4 A;  2K92 A;  3L72 E;  1WT6 A;  2YMY A;  5KP8 B;  3E1R A;  2FXM A;  1EC5 A;  1A8O A;  4KT0 J;  2E5T A;  4U0C A;  4PD4 E;  3LIE A;  2KB7 P;  3PP5 A;  2OAR A;  2WSE J;  1YHQ P;  4UB6 H;  1N8R Q;  1DH3 A;  2LR2 A;  5GTI H;  2C9N Y;  1VF5 C;  2C0W A;  1T3J A;  1PPJ G;  1P84 E;  3WU2 E;  3D71 A;  2E76 C;  1W2B O;  1JTH B;  3CWB D;  1PGP A;  5BVZ A;  2HR3 A;  3E1I A;  1VQK P;  3N7N A;  4WY4 C;  2JU2 A;  1BCC E;  5KLV K;  5AW3 B;  2HYN A;  1FZG A;  3MGN A;  4HYT B;  2L4B A;  4H2W C;  1QVG O;  5B66 E;  1RF1 B;  3MZW B;  3DS2 A;  1L0L D;  1RF0 A;  2B9B A;  2OYI A;  1NTK J;  1D7M A;  3EJD A;  2M5A B;  4NEO A;  1L0N K;  1YYC A;  3DS3 A;  2FYU G;  3L71 G;  1KQS O;  3C9I A;  4AYC A;  2LIU A;  2M8P A;  1VQP P;  2Q6Q A;  4N78 E;  3CXH E;  1RE4 A;  1KB9 H;  1GL2 A;  1YJ9 P;  2XND H;  4H0L D;  1X79 B;  3ITK A;  1SFC C;  2ZAE B;  1SQP J;  1SQX J;  2H7H A;  3O6Q B;  1EIA A;  1Q2N A;  2GZI A;  3GJN A;  2WSS H;  1LWU C;  2HG5 D;  2EG5 A;  1LT9 B;  2CNR A;  3CXC O;  2KLV A;  2PEN A;  1KB9 D;  2ZXE B;  4L76 A;  1DV5 A;  1BDD A;  2E1M A;  1FBM A;  2AEM A;  2VSQ A;  1VF5 D;  1H89 A;  2VLP A;  4U0E A;  2ZXX A;  1H88 A;  3BCC E;  4HB1 A;  4H44 C;  2Z4E A;  1SQQ G;  1QVF O;  3AE1 C;  4PD4 H;  1LTJ A;  5KLV D;  1K05 A;  2IPP A;  1EZV E;  1OZH A;  4A7P A;  3LMO A;  4HKZ H;  1USE A;  1KN7 A;  2FAC A;  1P84 H;  3L72 D;  4NPE A;  1JOC A;  3M91 A;  3WU2 H;  5AVR B;  2KS1 A;  5I4T G;  2ONT A;  2NPS C;  5CJ4 A;  2GDW A;  1FZC B;  1LTA C;  2QEX P;  3CCV P;  5KAF E;  1L0N D;  1S4X A;  4PD4 D;  1VQ5 P;  2J58 A;  2KP8 A;  3L73 G;  5F2N A;  1QL1 A;  2IBZ E;  1IK9 A;  5B66 H;  2LL8 A;  1PEU A;  2IZ0 A;  5TIS E;  2B87 A;  1P84 D;  2DNW A;  3FWN A;  3H1J G;  1Q86 Q;  3NTE A;  3SFD C;  1E0H A;  5EFW B;  1BE3 G;  3GHG A;  5AVW B;  3M0D A;  1BCC D;  1HVV A;  2AEJ A;  1NQ4 A;  2O1K A;  3TNU A;  7CEI A;  1USD A;  1BAJ A;  2O01 N;  1ZME C;  2K3R A;  3CXH H;  2KOS A;  2N98 A;  1T6A A;  1SQB K;  3WUT A;  1NTM G;  1IC2 A;  1PPJ E;  3DS1 A;  4WB4 A;  2LF4 A;  1JNM A;  3VMX A;  3RL0 g;  2YO2 A;  2M3B A;  1HJB A;  3CWB J;  2YO3 A;  4YXD C;  3H6P A;  2ZVO B;  3U59 A;  1FU1 A;  4N78 D;  3CXH D;  1DD4 A;  2HFE D;  5CCH A;  2NZ2 A;  4HJG H;  1IFN A;  4OGQ C;  5AVV B;  1M1J C;  1EDI A;  1KZU B;  1HGZ A;  3HUS A;  4B86 A;  3GKL C;  3OJA B;  1ZNV A;  5BU5 A;  4PH1 A;  2KSE A;  2FYU E;  1OW7 A;  4COP A;  3L71 E;  1L0L J;  2BCC G;  5BS2 A;  2R3C A;  1KIL A;  3VP8 A;  2KWL A;  1N73 C;  2LKI A;  4BPH A;  3EFF K;  2Z44 A;  4OVN F;  1N2D C;  4RKU J;  1KFM A;  3CLQ A;  3KHU A;  1OIP A;  4C7R A;  3MUD A;  3H1I D;  5KAF H;  1NHL A;  2GDY A;  2LML A;  2E74 C;  3BVH A;  1VQM P;  1EZV D;  4U3F G;  1H0T B;  5TIS H;  3CC2 P;  1MV8 A;  3KPE A;  2L91 A;  3IR9 A;  1IK7 A;  4TLF A;  1DD3 A;  4Y99 C;  3AEB C;  3SWY A;  3E7K A;  1SQQ E;  2QJP C;  1K30 A;  4U7J A;  2J59 M;  2K0X A;  2PAJ A;  4UHP B;  2IBZ D;  3PHL A;  1ZRT E;  2MVU A;  4NPF X;  5KLV J;  2XT1 A;  3G28 A;  2QSI A;  2ZT9 C;  3T97 B;  3A0H E;  3B71 A;  4IFF A;  2JWD A;  1GZL A;  2KGA A;  2K2Q A;  3L72 J;  2I1J A;  3FX0 A;  2JU1 A;  2LOL A;  3CCU P;  3L73 E;  1WMK A;  1HH0 A;  3B4Q A;  2KGE A;  1L0N J;  4XFX A;  1S3J A;  4XE5 B;  1PPJ D;  1L0I A;  2I8D A;  4DOJ A;  3AE7 C;  3H1J E;  2MR8 A;  3DS5 A;  2WPV B;  2WT7 A;  4EDF A;  1BE3 E;  4W80 A;  2KNC A;  1JEK A;  4BXL A;  3Q5S A;  1FC2 C;  4JF7 A;  2L9F A;  3MD0 A;  2KZI A;  2AEF A;  3RL0 C;  3IAO A;  1FDM A;  1NTM E;  3P8M C;  1S5L X;  1EQ7 A;  3PTZ A;  2ERH A;  3FXD A;  2RMZ A;  2ZFC A;  1AYI A;  2FYU D;  2JO1 A;  2FVF A;  1R5S A;  4QNB A;  4N3Y B;  2AXC A;  5GTH E;  3EQ2 A;  2M0B A;  3CX5 E;  5DJT B;  1GTW A;  3H1L G;  4IL6 E;  1FOS F;  2WPR A;  2KGC A;  4AQR D;  2P9X A;  1NU1 K;  3L4F A;  2JEE A;  3RK3 D;  3CCJ P;  2OYI B;  4ZMD A;  1EDJ A;  2JGP A;  5AVX B;  1AJY A;  1FJK A;  2BCC E;  3PRJ A;  3KYQ A;  2KG9 A;  3B4S A;  4C46 A;  3L74 G;  3P7K A;  4WYM A;  1VDF A;  2CPB A;  2JYG A;  2K37 A;  2PEJ A;  4I7Z C;  3VYI A;  1GL2 B;  4IZ6 A;  3L37 A;  3A0H H;  2YKO A;  4R4M A;  1M90 Q;  3TGU D;  2GUV A;  1SQQ D;  1RO0 A;  1A02 J;  3GF7 A;  1NTZ K;  3VOP A;  1BXI A;  5HGO A;  4U3F E;  2KOP A;  2K88 A;  3H1I J;  5HV8 A;  4OH8 B;  1ZRT D;  2HOD A;  2FQ0 A;  1DEB A;  3FWL A;  2BQ1 E;  1A43 A;  2WSF H;  4JBZ A;  2XU6 A;  3KZI E;  1PL5 A;  3PH0 A;  3G1G A;  1SQB J;  5KP7 B;  1VQO P;  3CCQ P;  3HD7 D;  1JO5 A;  1OVV A;  5E79 E;  2MJZ A;  3L73 D;  2DW3 A;  1BSN A;  1LTJ B;  1K9M Q;  2H43 A;  3H1J D;  1R8E A;  1ZN5 A;  2WTY A;  1NU1 D;  3MHV A;  1NYH A;  5BS1 A;  2KIK A;  2BEQ D;  1JMB A;  5EJD A;  2O1J A;  2R5D A;  2KS1 B;  1RF1 C;  5GTH H;  1UJZ A;  3CX5 H;  2N1T D;  1MFT A;  1NTM D;  4IL6 H;  2RKL A;  2OGU A;  3CL3 D;  4PV1 D;  3MTU E;  2KOR A;  1YTZ I;  2Q3E A;  3Q5R A;  2A45 G;  3OW2 O;  1NTZ D;  2R5B A;  3CX5 D;  1LJ2 A;  2FVA A;  2KXP B;  3GHG B;  2D2C B;  4D6T G;  3TNU B;  2MF4 A;  2JJL A;  1IMP A;  3G71 P;  3IN6 A;  2XZ0 D;  4WWI A;  3AEF C;  5AVT B;  1SP4 A;  1AFO A;  1L0L K;  1EDK A;  4JYC A;  1KTM A;  1JMM A;  1SQV G;  2BCC D;  5HVC A;  3L36 A;  1URQ D;  3G21 A;  4NPD A;  2FYU J;  3RBX A;  3H1L E;  1IZN B;  1OW8 A;  2W90 A;  4YPC A;  5AVY B;  1U57 A;  1Y9B A;  3KZI H;  2QM8 A;  3P8C E;  2L6E A;  5CHX A;  4U0B A;  4ZKP A;  3HUS B;  1OWA A;  1X3O A;  3P05 A;  2JP3 A;  5E79 H;  1N7L A;  4PV1 B;  4U3F D;  2P2U A;  2Y9Y A;  3L74 E;  2MY5 A;  1FZC C;  3JCU E;  3H25 A;  3V2R A;  1KIL B;  1CW5 A;  3SFE C;  4GKG A;  1K73 Q;  2FXO A;  1PP9 G;  2FFD A;  2JAZ A;  3TGU J;  2MKV A;  1UII A;  2RH0 A;  1D1D A;  3GW6 A;  1SQQ J;  1UNK A;  2WWW A;  2NRG A;  2N6Z A;  2Z5H A;  2KOQ A;  1S9K E;  1YIJ P;  3RK2 D;  5KLI B;  1L4A C;  3B5N C;  3Q5P A;  3G4S P;  1T2K D;  4H13 B;  1IUQ A;  1DNY A;  1NH4 A;  2OTK E;  2JBG A;  2GDX A;  2ZVN B;  2E75 C;  4CA3 A;  1XTC C;  4W7Z A;  4IOI H;  1NAY A;  2YKP A;  1KYO E;  3FGA D;  4LC1 A;  2R44 A;  4BRY A;  3S1K A;  5L8R J;  1GW3 A;  1NU1 J;  1KQF B;  2Z45 A;  4GOE A;  2I1K A;  3H1H G;  2JKV A;  1EXI A;  3OA7 A;  4UB8 E;  4YTP C;  2ZYA A;  5KJ7 C;  3GF3 A;  1FS0 E;  1U7M A;  4HH2 A;  1PGO A;  4GT1 A;  4RES B;  1NTM J;  5KKZ B;  2BAS A;  4DCK A;  3R4Y A;  2WT7 B;  1A02 F;  2KNC B;  1PEO A;  4D6T E;  2P10 A;  2E76 D;  2V7Q H;  3FXE A;  1AF8 A;  2Q1K A;  3JCU H;  2B89 A;  1NTZ J;  2L22 A;  1KMI Z;  1RE3 A;  3A2A A;  3S4R A;  4WY4 D;  2PNG A;  3P8C D;  1S2E A;  1QLE D;  4WVZ A;  1NKZ B;  1S1C X;  1AVY A;  1L4A D;  4EOT A;  1SQV E;  1RY3 A;  3R2P A;  3NFQ A;  2VLN A;  4IFD K;  2GZF A;  3L74 D;  1RQU A;  2BCC J;  4Y28 J;  4H0L B;  3D6Z A;  2O01 H;  3NXS A;  1BDC A;  2E75 D;  4JPZ B;  3RG2 A;  1MZ8 A;  1G1J A;  1NTK G;  1DX7 A;  1X8Y A;  2M8L A;  3WUU A;  4O9B A;  5CCG C;  3GLM A;  2XZ1 C;  1SFC D;  3CME P;  1BSH A;  1NJI Q;  1ZXG A;  1T8Z A;  2JO0 A;  1VF5 B;  2CK3 H;  1KFN A;  1JY2 P;  5KJ7 D;  1IFM A;  5CBN A;  1GMJ A;  3HD7 A;  5DJU B;  1KYO H;  2YXQ B;  2QRX A;  3L75 G;  1PP9 E;  2IFN A;  2KZJ A;  2K5X A;  4AUW A;  1NO4 A;  2L0Q A;  3M9H A;  1SQP G;  3CC7 P;  1SQX G;  4WY4 B;  1KD1 Q;  2KK7 A;  2K93 A;  1TU3 F;  3AE8 C;  1ZOY C;  1H8A A;  1AA0 A;  3LID A;  4UB8 H;  3V2N A;  3WUV A;  5AVZ B;  2FKW B;  2XXM A;  4EI2 A;  2Y0D A;  1EMV A;  1KQL A;  4H44 D;  2HOD B;  3JC2 2;  2ZJS E;  1T3U A;  1KYO D;  3SWF A;  2A45 H;  2Q7C A;  1KQG B;  2YXR B;  2M8N A;  2N1T A;  2WPT A;  5AW5 B;  1K04 A;  4GOF A;  1IFI A;  2EIA A;  1W5C E;  2NPS D;  3CE7 A;  2W6J H;  3LW5 H;  1IMQ A;  2OQQ A;  3CCM P;  5APT A;  2EFJ A;  4ASV A;  4XRO A;  4F37 A;  1SLQ A;  3LRY A;  4IFM A;  1CI6 A;  2WSC H;  3L70 G;  1QEX A;  1HQB A;  3DS0 A;  4D6T D;  1FZF A;  2CGQ A;  3BCC D;  2OYH A;  5CCG D;  1RF0 C;  2OYI C;  5KAI E;  3RBZ A;  1GK6 A;  1HTL C;  1NAF A;  4K3A A;  4BWN A;  2N9B A;  5DCK A;  1URQ A;  1ZW0 A;  2AXT E;  1T8K A;  1SQV D;  2A06 G;  4KJM A;  3AEA C;  3CCL P;  3U1A A;  3H4E A;  1JM0 A;  2LXB A;  3WMM 0;  2WPQ A;  1RE4 C;  4MN4 C;  2FYU K;  3AE3 C;  1S5L E;  3AEC C;  2VLQ A;  2WPS A;  1X0T A;  2M3E A;  5AW1 B;  2FQ2 A;  2Y0C A;  5AVS B;  4OGQ D;  2IFM A;  3AE6 C;  2AVA A;  2WVR A;  1OX3 A;  2M5R A;  5AW4 B;  2C0X A;  1N7S C;  3N4X A;  2W8Z A;  1AVO A;  3CWB G;  1GDT A;  4HKG A;  3L74 J;  1VQ8 P;  2V7Q J;  1J1D B;  1LTJ C;  1NTK E;  1M8O B;  2W27 A;  1VQ7 P;  5BU8 B;  1JY3 O;  3O8Z A;  1PEM A;  2G3A A;  3HYB A;  3AE2 C;  1SQQ K;  4JQ0 D;  2WMM A;  3AED C;  2Z5I A;  3Q3D A;  2H8P D;  2QJY B;  2E74 D;  3F89 A;  4EYY Q;  3D70 A;  3L75 E;  3KQG A;  1BCC J;  1EDL A;  2PEI A;  2ZYG A;  1KB9 I;  1SQP E;  1SQX E;  2K9J A;  2FFD B;  1R5L A;  2XNX A;  3VRL C;  3L71 D;  3A0B E;  1YJW P;  5KAI H;  4OGQ B;  5APW A;  2JYL A;  1FDO A;  2IDB A;  3TSI A;  4EIJ A;  1N86 A;  4DZO A;  1HF9 A;  3GHG C;  1AUM A;  3M0D C;  2D2C C;  3Q20 A;  2X2B A;  2AXT H;  3Q2Y A;  1IO4 A;  1PGJ A;  3RG6 C;  2Z46 A;  2QE7 H;  4LGD E;  1GXG A;  2H88 C;  3G6E P;  5AW9 B;  2ZT9 D;  5AW8 B;  3SWK A;  4L75 A;  1S5L H;  4PWV B;  1N7S D;  2KG8 A;  4PD4 I;  3ZDM A;  1FOS E;  1NTM K;  2ZYD A;  4U0A A;  1JUN A;  1JY3 P;  2Y0E A;  3L70 E;  2HPC A;  4BRY B;  1P84 I;  1JJ2 O;  1HWT C;  5KP6 B;  1UIX A;  3H1K G;  2WIT A;  4WY4 A;  3G29 A;  1LTG C;  3HUS C;  4D6T J;  4XFJ A;  3HE4 A;  1BGY G;  2LXC B;  1L4A A;  4JYB A;  4QKO A;  1AV1 A;  3B5N A;  3BCC J;  2KSJ A;  1L0N G;  1FZA A;  4H2Y C;  2QJK B;  3LW5 J;  1MZ9 A;  2A06 E;  2CWO A;  3RL0 D;  4C7N A;  1G1I A;  1KIL C;  3G3Z A;  2EHS A;  2N5I A;  2PGD A;  3AEG C;  2WSC J;  1PFI A;  2MVV A;  2GM4 A;  3RK3 B;  1GW4 A;  5TJH A;  2GZE A;  3CXH I;  1SFC A;  1OVR A;  3CC4 P;  3G26 A;  3TYY A;  3BRT B;  2V4H A;  5AW7 B;  3C1L A;  3W68 A;  2K9Y A;  1BE3 D;  5APX A;  1DIP A;  3I56 P;  1M1K Q;  3A0B H;  4IL6 X;  5KLI C;  5KJ7 A;  2C9L Y;  1MKM A;  1E5W A;  1LWU A;  3CWB E;  2YKQ A;  1PGQ A;  2LIW A;  3TF5 A;  3HE5 A;  3L75 D;  3K5B A;  1Q82 Q;  5HGM A;  4H13 C;  1KLP A;  3HTK A;  2JB0 A;  1YQ4 C;  3EFG A;  2AFD A;  3U43 A;  3GG2 A;  5KTB A;  3USS A;  1SVF A;  1FDI A;  4R4L A;  2R32 A;  3B8E B;  3I55 P;  5HGN A;  1IJD B;  4L74 A;  4ASW A;  1ZR4 A;  1EZV I;  2FQ1 A;  3CD6 P;  3M9B A;  3HD7 B;  3Q1M A;  4IPY A;  2NPS A;  2WZ7 A;  1FR2 A;  3GMA A;  1LT9 C;  4M0I A;  2CG5 B;  2PEM A;  1JY2 N;  2P7J A;  2FYN B;  4WBA A;  5KKZ C;  2MR7 A;  2BUO A;  1M56 D;  1JCD A;  3H1I G;  2JQ4 A;  3L71 J;  1RHZ B;  5H2F E;  2IBZ I;  3L70 D;  1W2E A;  2PFX A;  5CCG A;  5M1B A;  1Z6M A;  1LT1 A;  2N1T B;  1RO2 A;  1SQB G;  2JDI H;  2K1A A;  1PEQ A;  4R0M A;  2FAD A;  2A06 D;  2KOO A;  2QIW A;  2VRS A;  3MP7 B;  1RH5 B;  4H0L C;  2IBZ G;  2GYK A;  1CI6 B;  3M06 A;  4GR2 A;  1OMI A;  3H1K E;  4LLH A;  2PEQ A;  1J1E B;  2OYH B;  1BGY E;  2W6A A;  3G0V A;  1L0N E;  1KC8 Q;  1M1J A;  2E43 A;  1ZLL A;  1URQ B;  1QGK B;  3VP9 A;  3AE5 C;  3RGU A;  4BPF A;  2YIU B;  5JPA A;  2PP6 A;  2K0Y A;  3VMA A;  1X9V A;  1N73 A;  3H32 A;  3C8V A;  4XFZ A;  3L73 J;  1LTI C;  2BEZ F;  2WSF J;  3H1J J;  4DJG A;  3CCR P; 
#chains in the Genus database with same CATH homology
 5I4T G;  2ONT A;  1PEO A;  4U0F A;  2QEX P;  1K9M Q;  1VQK P;  2CWO A;  1VQ7 P;  3HZQ A;  3CCV P;  2EIA A;  3H0D A;  1PEM A;  3HYB A;  1VQ5 P;  1YI2 P;  5BS1 A;  1QRJ A;  2DGY A;  1K73 Q;  1M6N A;  1RO2 A;  4QNB A;  3G1I A;  1VQM P;  1S72 P;  1QVG O;  3H47 A;  5F2N A;  1VQL P;  1RNI A;  3CCM P;  3DS2 A;  2EFJ A;  1PEU A;  4XRO A;  3LRY A;  3CC2 P;  1Q86 Q;  1VQ4 P;  3NTE A;  2PEI A;  1PEQ A;  3B5I A;  1D1D A;  3CCE P;  1Q81 Q;  3CMA P;  3DS0 A;  2P9X A;  2PY8 A;  3DS3 A;  5F2K A;  4PH0 A;  3CCJ P;  1KQS O;  2M8N A;  3CC4 P;  3G26 A;  4U0D A;  1YIT P;  3VRL C;  2M8P A;  5F2O A;  1YIJ P;  4COC A;  1VQP P;  3I56 P;  1M1K Q;  1K30 A;  1BAJ A;  4GR2 A;  1E6J P;  1YJW P;  1YJ9 P;  3OW2 O;  2BHV A;  3DTJ A;  3G4S P;  2JYL A;  3MGE A;  2QA4 P;  5DCK A;  3CPW O;  2PEQ A;  4XRQ A;  1AUM A;  3Q20 A;  4WYM A;  3DS1 A;  1EIA A;  2XT1 A;  2M8L A;  3G28 A;  2JYG A;  3CCL P;  1Q82 Q;  3H4E A;  2PEJ A;  2LF4 A;  3RG6 C;  3E2D A;  3G0V A;  2PEO A;  2Z46 A;  1IUQ A;  1KC8 Q;  3G71 P;  1VQ9 P;  3CME P;  5HGM A;  1M6E X;  1M90 Q;  1NJI Q;  2PEK A;  3G6E P;  2EG5 A;  2JO0 A;  4GR6 A;  4XFY A;  3M1M A;  5HGL A;  1RO0 A;  3CXC O;  1VQ6 P;  1K8A Q;  1M74 A;  2PEN A;  3CCU P;  5HGO A;  2E1M A;  3G21 A;  2XV6 A;  5JPA A;  4XFX A;  3I55 P;  3CCS P;  4U0A A;  5HGN A;  4U0E A;  3CC7 P;  1KD1 Q;  2BQ1 E;  2Z45 A;  1A43 A;  1A8O A;  3DS4 A;  3DPH A;  3DS5 A;  4PH1 A;  3CD6 P;  2OTJ P;  4U0C A;  1QVF O;  2OAR A;  1YHQ P;  4COP A;  4XFZ A;  2XXM A;  4IPY A;  1EOQ A;  1JJ2 O;  1N8R Q;  3G1G A;  1ZMB A;  2L6E A;  1YJN P;  4U0B A;  5BS2 A;  1VQN P;  3G29 A;  1VQO P;  3CCQ P;  4M0I A;  1Q7Y Q;  2PEM A;  3P05 A;  2OTL P;  1VQ8 P;  2KOD A;  3WBH A;  1W2B O;  3CCR P;  2BUO A;  2Z44 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...