1M1KQ

Co-crystal structure of azithromycin bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAKGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structures of four macrolide antibiotics bound to the large ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S RRNA
total genus 48
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2002-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1m1kQ02
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1m1kQ01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1m1kQ03
3G4SP 3CCMP 3CD6P 3CCUP 3I55P 3CCQP 3CMEP 1YHQP 2OTJP 1VQOP 1K8AQ 1VQLP 1VQKP 1VQ7P 3CMAP 3CXCO 1VQMP 1YJWP 1M1KQ 1VQ6P 3G71P 1N8RQ 2OTLP 1YI2P 2QEXP 1Q81Q 3CCJP 1NJIQ 1YJNP 1K9MQ 1VQ4P 1S72P 3CPWO 1YIJP 3CC7P 2QA4P 3CCVP 3CCLP 3OW2O 1VQ5P 1KQSO 1Q7YQ 3CC4P 1QVGO 3CC2P 3CCEP 1M90Q 3CCRP 1KD1Q 1KC8Q 1QVFO 1YJ9P 1W2BO 1Q86Q 1VQ9P 1VQNP 1Q82Q 1JJ2O 1K73Q 1YITP 3G6EP 3CCSP 3I56P 1VQ8P 1VQPP
chains in the Genus database with same CATH superfamily
1SQXG 2JO1A 3C8VA 1PP9E 2N6YA 1M7LA 1SQPD 5AVQB 3VMZA 3G29A 5KP7B 4D6TJ 3VP8A 2IZ1A 1G2CA 2EHSA 2JYLA 1NTKJ 3SWYA 2HODA 1HWTC 1GL2A 3SWFA 1JUNA 1SQVG 2WPQA 3LW5J 2PFXA 3DS2A 1ZV8A 3W68A 1L0NK 1PIXA 2Y9YA 3MZWB 2L4BA 2ONTA 4WBAA 2GZGA 2A06D 2K9JB 3P32A 2GUVA 1S3JA 1S9KE 1PFIA 4CA3A 2A45H 4JBZA 3AE8C 1AVYA 3L4FA 5E79H 1KFMA 1RY3A 2YKPA 3NY7B 1JY3P 3GJNA 1M1JC 1FZAA 2E76C 4LGDE 3VP9A 1G1IA 3PHLA 4DZOA 2LIUA 1HQBA 2M8PA 4GR2A 1SFCD 1HUCA 2K9JA 1GXGA 4Y28J 1EQ7A 2KUBA 3HE4B 4HKZH 3CCJP 1URQA 3L75G 5AW5B 3FX0A 2HPCA 1L0ND 5AW8B 1AJYA 4PWVB 4KHXA 1ZRTE 1KLPA 2UWJE 2VLQA 2JQ4A 3CCMP 1N86A 1S2EA 1Y9BA 3F5HA 2PEQA 2WSFH 2BCCD 1YYCA 1DEEG 2KIKA 1SQQE 2PENA 4OGQB 2LXBA 2WQYC 3G3ZA 2IZ0A 3EWKA 1BE3E 2QM8A 3M06A 2Q3IA 1RH5B 3S4RA 3BCCG 5KLVJ 2PNGA 2FAEA 1KQFB 4U7JA 4D6TG 2XZ1C 3EJEA 2KK7A 1JNMA 2JWDA 3WBHA 2FYUE 1E0HA 2N1TB 2ZVOB 3TK1A 3CX5I 2XNDH 3A5TA 1OXZA 1SQBK 3H1LD 5L8RJ 2PEKA 1VHNA 3TGUD 3BRTB 1N73C 1IFDA 4NPFX 2OYHA 1RE4A 2POHA 2AEJA 1M1JB 1SQPK 5AVXB 4XA4A 2DNWA 3CCLP 3L71J 4IL6E 1LGHB 2P58A 2WZ7A 1EXJA 1VQ9P 1T6AA 3G6EP 3B5NB 1N7SD 1GU4A 1FZCA 3L73J 2BUOA 2ZYAA 3RK3B 2R44A 3V2NA 3R2PA 1R5LA 2RH0A 3AE6C 3MD0A 3P7KA 4UB8E 3U59A 4GDOA 3CL3D 3VMAA 5AVUB 5CCGC 2GA1A 2FACA 2VLPA 3I55P 3OJAB 2KYVA 2M8LA 2B9BA 1SLQA 1FZBA 1BXIA 1SQVK 3L36A 1ZP0C 1EZVI 1Y8AA 2D2CD 1Q90D 3H1HJ 4PH0A 2XKMA 2NPSC 2LF4A 3H32B 5EW5E 3B5IA 3H1IJ 3L35A 3BASA 4GT1A 2YIUC 4EYYQ 1VQOP 2OYIC 1AUMA 1FE6A 1FR2A 4L75A 5KAIH 2KODA 2W6AA 3OW2O 1KQSO 5C39A 1GD2E 1YQ3C 2HYNA 2A45I 1NU1G 3H47A 3U1CA 3NTNA 3H1ID 2KZIA 2LKIA 1BE3J 2WT7A 1CI6A 1KILE 5AW9B 3USSA 4A7PA 1AYIA 4K35A 5DCKA 2JYGA 1MFTA 4BPHA 2M0BA 1U7JA 2ZYGA 3C9IA 1XTGB 1M57D 5APWA 3DS5A 1LT9A 1LTIC 2LR2A 2PRRA 1PP9D 3I56P 1L0IA 3W67A 2EG5A 5KLVG 3H1HE 1VF5B 3JCUH 3RK2D 3Q2YA 2PY8A 1PL5A 4W80A 1GDTA 3II6A 4OVNF 2H43A 3G1GA 2O3JA 5KKZB 2GDWA 3H0DA 1EOQA 1JY3N 4Y99C 3I5CA 3L72J 1H0TA 3L73D 1W5CE 4XE5B 2OYHC 1M8OB 1K04A 1N7SC 5GTHE 3EQ2A 3A0HE 1X9VA 1PPJE 1KYOI 1P84I 4XFZA 3L71D 2BCCE 3O6QA 2G8YA 4ZNCA 4GIFA 2K0XA 2PEOA 3GMAA 4IOIH 4MN4C 5AW7B 3RBXA 3H1LE 1J2JB 3PJSK 3H4EA 3LIDA 1LWUA 3BCCJ 1EMVA 1VQKP 5KLIC 3VRLC 2PP6A 1AF8A 4DG9A 3RG2A 2H88C 1T2KC 2N5HA 3CXHE 4TT3H 2BEZF 3L70J 3CX5D 4RO0A 3BCCE 2FQ2A 5AW4B 1FZEA 1KC8Q 4IFFA 3RL0C 1LT9B 3T97B 5APQA 1BCCG 3G4SP 4C46A 1G1JA 2QJYC 2E42A 1K8AQ 1VQLP 3SFEC 3ABVC 4L74A 2MR8A 1NJIQ 3M0DC 4PD4H 1S9KD 2KWLA 1KMIZ 1NO4A 2KGDA 5APVA 2ZT9B 2CNRA 1PP9G 1LJ2A 4H13B 4HKGA 1FDOA 4I6MC 1KQGB 3IFMA 1NGMB 2C0XA 4U0DA 2OGUA 3WU2E 3AE4C 4IL6X 2IBZD 1CZQA 1S5LE 2CWOA 1FJKA 3VTPC 3G1IA 4HB1A 4U3FD 1J1DC 2WSEH 2KSEA 3P8MC 3RK3D 1IJDB 5H2FH 1K9MQ 3LW5H 2SPZA 3VMXA 2M8NA 5F2KA 3HZQA 1PV3A 5B5EH 1T3UA 1NU1K 1IFNA 2X2BA 3A0HH 2I8DA 2WPTA 1ZLLA 3M0AA 1QX8A 3BATA 1VQ6P 4YXWH 4BRYA 2Q1KA 1L0LG 1W2EA 3GLMA 4RESB 2LIWA 3FXDA 1L0LE 2E75B 1SQXK 4GR6A 3CCUP 2A06G 5EJDA 1H0TB 1NAYA 3E1RA 3L74E 4PJ0E 3MTUE 2QM7A 3G21A 1XTCC 2WPVB 1NTZK 2Y0CA 1SQVJ 1RF1B 1CSBA 2MVVA 3JSVC 5CJ0A 4OGQD 1N7SA 2ITAA 3EFFK 4LLHA 4ZKUA 3L37A 2R3CA 3WMM0 3Q1MA 1SQVD 4WY4A 1N2DC 4M0IA 3HD7D 3TF5A 5DJTB 2VLOA 4H0LB 2LKMA 2L22A 1ZN5A 1NTKE 2C0WA 2HR3A 2J58A 3DTJA 1SQXJ 4WYMA 1NTMG 3CWBD 1AA0A 1NWQA 2KOPA 2RMZA 4XFXA 1X22A 2W27A 5F2OA 1SQQD 3G0VA 1PPJD 1SQPG 2VLNA 1LTGC 2P9XA 2KGAA 3L74J 5AVSB 3S1KA 2FFDB 3DS3A 4JQ0D 4KT0J 4R4MA 2A45G 1OFCX 3H1KJ 1IUQA 2LOLA 2IYPA 3N4XA 2K0YA 3Q5SA 2KG9A 4U3FJ 3IR9A 2M8RA 1UNKA 2P10A 3RGUA 2MD9A 2CK3H 4H13C 5APTA 5HGOA 4U0EA 2N1TA 3P8CE 2KG6A 5BS2A 2W90A 1Z6MA 3NXSA 1SQBJ 2O1KA 1QEXA 2YMYA 1RQVA 3B8EB 2Q3EA 3L72E 1L4AB 2CPSA 2GYKA 4UHPB 4TLFA 4AUWA 3H1IE 5CJ4A 4EDFA 4GOEA 1UIIA 1LNQA 1NYHA 1RE3C 5AW3B 3MIWA 3WUVA 1GMJA 2IFMA 3N7NA 1EZVD 3LRYA 1SP4A 3K5BA 2GZJA 3HD7A 5DJUB 1HY8A 5AVYB 2KLUA 2NRGA 3GF3A 1L0NE 1J1EC 3H1JD 2QJPC 3AE2C 2QE7H 2Y0EA 1S4XA 1EXIA 1PGOA 1IC2A 1T3JA 5APSA 2K9YA 2GZFA 2HODB 4OGQC 5CZDB 1YITP 1E6JP 1HJBA 2Z45A 2OTJP 5TISH 3U43A 2ZT9D 3L70D 1LTJA 1BCCE 2FADA 2QIWA 2Q6QA 1DV5A 1NTZE 4R4LA 1PGPA 2K3RA 1AQ5A 3G26A 1NKNA 5KJ7D 1LWUC 2QJYB 1NU1D 2YO3A 3DS1A 1S5LX 3AE9C 3CMEP 3MP7B 2BASA 2HPCB 4H44C 1BDCA 1L0LK 2N9BA 1VF5D 3B5NA 1WT6A 3GHGA 1NU1E 3H1LG 3CC7P 2FYZA 1M56D 2KP8A 4H2WC 2CQ8A 2K37A 1M74A 2QNWA 4R0MA 5CCHA 3AEEC 4YXDC 1SQBD 2IBZI 1EIAA 2MR7A 2K2QA 5TJHA 1MZ8A 4PD4D 2FFDA 5HGMA 4I2LC 4YTPC 4WY4C 4QMAA 2Z4EA 1PP9J 1AFOA 2BEQD 3KQGA 2IX7C 4COCA 2JR8A 2FYUJ 1GL2C 4H2XC 3KZIE 2NPSA 2PGDA 2E1MA 2OYHB 1M1JA 2FVAA 1D7MA 5AVWB 2QJPB 3M91A 2Q7CA 1H8AA 3CXHD 1HGVA 3H32A 3AE7C 1A8OA 2YO2A 3CCVP 1GU5A 1X8YA 4MRTC 5CCHD 2ZYDA 2Q9IA 2FY8A 2XZ0D 4CPGA 2B88A 1BAJA 1J1DB 5KTBA 1SQXD 1RF0A 5AW2B 3MUDC 3A2AA 1DH3A 2O01J 1CI6B 3TGUE 1FOSE 4C7NB 1AQTA 2B87B 4ASVA 1NAFA 1LT9C 1QLED 2GUSA 2WSCJ 3CCQP 2KG8A 1KV4A 5K5GB 2VRSA 2QRXA 1ZNVA 2AXCA 4ASWA 3IAOA 1P84D 3RK3C 4N6JA 2XU6A 1LTSC 5KLIB 1Q82Q 1DD3A 3SFDC 2KNCB 1H88A 2KGEA 2FHSC 2CPBA 3GW6A 4DT0A 2MF4A 3KHUA 4PV1D 1AVOA 4XFYA 4EI2A 2WPSA 3Q20A 3Q3DA 1VDFA 1L0HA 3GZLA 1H89A 4OH8B 2E43A 2CGQA 1NTKG 5BVZA 2V7QH 2H7HA 1LTAC 3CX5H 3E1IA 2Y9ZA 2NZ2A 5H2FE 2O01N 1NQ4A 3LMOA 1DX7A 2Z5IA 2P7JA 1JY2O 2IDBA 1X0TA 1JOCA 3AEDC 1Z56A 1VPCA 2R5DA 4BXLA 4JPZB 1BSHA 4NPDA 1N73A 4UB8H 3RL0D 1OVRA 1N7SB 1KILB 2YIUB 1P84H 3CXCO 2YXQB 2JEEA 2L91A 1FC2C 1RO2A 7CEIA 2NPSD 2KSJA 2WSFJ 1ZMBA 4GOFA 5HGNA 2K0DX 1IK7A 5AVVB 1T8ZA 3ZDMA 1KN7A 2FYUG 3GHGC 1ZRTD 1EDLA 1MV8A 5M1BA 4PJ0H 1JO5A 4D6TE 2QEXP 1PEUA 3HRNA 5KP8B 3OAKA 2P1JA 2M5RA 2BHVA 2ZVNB 3HE4A 2YMKA 2WSSH 2AXTE 1A02F 1BE3G 3FXEA 2N1TC 2JP3A 2YXRB 2E75D 1EC5A 1K73Q 1L0NJ 1SQVE 3HUSA 5APYA 4U0BA 3VYIA 2ZAEB 5AW0B 5F2NA 5AW1B 2VSQA 2V4HA 2YNYA 3KDPB 4PD4E 1JEKA 2MJZA 4GKGA 2R5BA 1S1CX 1RE3A 1W2BO 1IK9A 2AF8A 3FWLA 4H13D 3HE5B 3BCCD 2PEJA 5HV8A 1VQ7P 1X79B 3GF7A 3MGEA 1AV1A 5APXA 1PGJA 1VF5C 5AVRB 4DJGA 2HLOA 2ZFCA 4BRYB 1JCDA 3VOPA 1LP1A 3LIEA 1QRJA 2DW3A 4BPFA 1GXHA 2HFED 3L72D 3M9HA 4IFDK 2E76B 5HGLA 1KYOH 5B66E 1NTKK 5EFWB 3T97A 2YKQA 2G3AA 1JJ2O 2B89A 5KAFH 5B5EE 1P84E 3DS0A 5GTIH 3RL0B 5AVZB 3V2QA 2FXOA 3D6ZA 3HUSB 2JKVA 1GW4A 2KS1A 1J1EB 4WVZA 3QWOC 1KORA 2QA4P 3AECC 3R4YA 1FU1A 2BCCG 2OQQA 4COPA 1PPJG 3V2PA 1NVOA 1SQXE 2FXPA 2FVEA 4U3FG 4H44D 3V6IA 4HJGH 2Q5UA 3TDKA 4OWFA 2WITA 1E5WA 3GKLC 2H8PD 1FJPA 1BGYD 1EDKA 3CD6P 2C9LY 2JGPA 2E74D 2R3SA 5KLVE 3PLNA 1FDMA 2OYOA 1WMKA 2FYUD 2RN0A 3WU2H 4B86A 3Q5PA 1A43A 3TNUB 5CHXA 4HH2A 2KZJA 2PAJA 5BU8B 1QL2A 1YHQP 1KB9H 4WB4A 3E7KA 4WY4D 2PEMA 2XDJA 1L0LD 1FS0E 1OR5A 3DPHA 2M5AA 2P2UA 1M6NA 4UB6E 1Q86Q 1ZW0A 2KR5A 3O8ZA 1L2PA 2KXPB 2ERHA 2GDYA 1Q81Q 4U0CA 2IYOA 5CBOA 2N6ZA 3C1LA 2J59M 1NKZB 2HG5D 2Z44A 3RBZA 3KZIH 2N5IA 2KI7B 2M5AB 4YPCA 1EDJA 3TGUJ 2LPKA 1VQMP 1UJZA 3BRVB 2QVAA 3H1LJ 3U1AA 1L0LJ 1VQ4P 2Z46A 2FVFA 1QVGO 3H1KE 2H89C 1ZXGA 2JDIH 1SQQG 3H1JJ 1OX3A 2GM4A 1KILC 3A0BH 3QH9A 3PRJA 1IFIA 3UIAA 3AE5C 1M1KQ 2ZJSE 3AE3C 3EJDA 3CXHI 1BSNA 2LMLA 1GL2B 3SSUA 1GZLA 3JC22 1KTMA 2ZXXA 2BCCJ 2NO8A 3GHGB 1OWAA 2JU1A 2QJKC 2PEIA 2L0QA 4NPEA 1YJNP 1JMBA 3PP5A 3A3YB 4PD4I 1RO0A 3G28A 3HD7B 4L76A 2R32A 2XZRA 1SFCC 5AW6B 2FYNB 4XFJA 1OW8A 2LTEA 4UB6H 1T2KD 2AFEA 3HTKB 2KLVA 3EJBA 1SFCA 4I1LA 1OW6A 1URQB 1NTMJ 1SQBG 2L5GB 1U7MA 4HYTB 3AE1C 1VL2A 1ACPA 3PH0A 2FFDC 5KJ7A 1L4AD 4EOTA 3E2DA 5CCGA 1KILD 1A02J 2EIAA 3ITKA 4RJTA 3L70G 4DOJA 2XV5A 4Z1MH 2WMMA 3CWBJ 2KGCA 1D1DA 1E79H 1GW3A 1EDIA 3L75E 3NFQA 4XRQA 1SFCB 1K30A 1YBKA 1NTKD 3D71A 3L71G 5KKZC 3TSIA 2OYIA 1HVVA 3M9BA 3PTZA 4D6TD 1SQPJ 2E74C 4IZ6A 3G9RA 1OIPA 3CC4P 3A0BE 1NTMK 1RQUA 1USEA 4BWNA 2K92A 3L72G 1L4AA 2JBGA 2NPSB 2K88A 3KYQA 1GPJA 1QGKB 2YKOA 2GZEA 4GODA 2Z5HA 1DEBA 2D2CC 4WWIA 1Y47A 2A06E 3HE5A 4H0LD 2OTKE 4PV1B 3BVHA 4PH1A 1MKMA 2K94A 1S72P 1FAVA 1KB9D 2KOQA 1ZR4A 3S9OA 2BQ1E 1LT1A 3L75D 1SQPE 1NTZD 3A7OA 1CEIA 1IZNB 1LTJB 1FDIA 1RNIA 4NEOA 4KJMA 1LTBC 1RE4C 1IFMA 2N98A 2B87A 4QKOA 1Q2NA 1KILA 4IL6H 2QJKB 3O6QB 2WT7B 3CCEP 2WPRA 3RK3E 3IN6A 2W6JH 3JCUE 3NMDA 3H6PA 3HTKA 3CX5E 2OARA 4Y99B 2E5TA 2KOGA 1FZFA 4C7NA 3B5NC 2AVAA 3H1JE 3P05A 2M3BA 2WSEJ 5E79E 4N3YB 3H25A 3WUTA 5KAFE 2JAZA 5GTHH 1IMPA 3AEBC 1MZ9A 1BDDA 2N50A 4H2YC 3L71E 3CMAP 2OTLP 2DGYA 2JU2A 3MHVA 3V4WA 3CE7A 1JY2N 3M0DA 2W83C 1EZVG 4RKUJ 2FQ0A 4LC1A 3WUUA 1OVVA 4XROA 3L73E 4JYBA 4AQRD 3L70E 2MY5A 3MUDA 4AYCA 2FYNC 2IBZE 4DCKA 2WWWA 2L6EA 4JF7A 2AEFA 3G71P 2V7QJ 1U57A 5BS1A 5KAIE 3HYBA 4H44B 2MVUA 3TGUG 2AXTH 4U0AA 1M90Q 3V4QA 1KD1Q 3MGNA 2XXMA 1X3OA 1QL1A 5KP6B 2KS1B 1BGYE 2GDXA 3F89A 2O1JA 1RF1C 3D6YA 1TU3F 4F37A 3D70A 1KYOD 1RF0C 4C7RA 2FKWB 3M1MA 2WSCH 1N73B 1HF9A 4BPGA 1UIXA 3AEFC 1OZHA 3TYYA 1ZMEC 1DNYA 1KB9E 2FYUK 1HTLC 3CWBE 1N8RQ 1LWUB 1GK6A 1R8EA 1FBMA 1FOSF 1HJ0A 5CMZA 1BCCJ 1NTMD 3VMYA 3HD7C 1L0NG 1URQD 1R5SA 2ZT9C 1JTHB 2GZIA 2XV6A 1OMIA 1PZQA 4IFMA 1KQLA 1HBWA 1NH4A 5BU5A 1YI2P 1BE3D 5CCHC 1DIPA 2I1JA 3RG6C 1BCCD 2W6BA 1SQBE 1WRGA 1HGZA 3H1KG 3OA7A 3RK2C 2CG5B 5B66H 2E76D 3VN0A 4K3AA 3H1IG 3GG2A 3B5ND 3CCRP 1USDA 1K05A 1RHZB 3AEGC 2I1KA 1KZUB 3GZMA 4W7ZA 1GTWA 2O01H 1JMMA 3CXHH 2KOSA 3CI9A 1JY3O 1BGYG 1JB0J 3SWKA 3CPWO 1N7LA 3AEAC 2LL8A 1IFPA 1FZCB 1SS1A 2RKLA 1NTZG 3Q5RA 1PGQA 2WTYA 3H1HD 1VQNP 2C9NY 2D2CB 2Y0DA 1NU1J 1KB9I 2IBZG 1LTTC 3B4SA 2ROQA 1IFJA 1NOHA 2XNXA 5HVCA 4O9BA 3L73G 2KOOA 1FZGA 1LP1B 3P8CD 1M6EX 1VKUA 4PV1C 3CCSP 2IPPA 1YTZT 1FZCC 1JTHA 3V5BA 3CWBG 2AEMA 1PEOA 1SQQK 3H1HG 4IPYA 1IMQA 2E74B 4PXHB 1NTME 2K5XA 4L73A 2EHTA 1JM0A 4W7YA 2IFNA 1KFNA 2EFJA 2QSIA 3HUSC 4JYCA 1S5LH 4N78D 1OW7A 2QG4A 3RK2B 2N9YB 2M3EA 1L4AC 4WY4B 2KNCA 3B71A 5KJ7C 1HH0A 1YTZI 2JJLA 1JY2P 1ZOYC 4M3LA 2N1TD 4EIJA 2KB7P 2P67A 1KYOE 3M9QA 3DS4A 4U3FE 3L74G 1URQC 1VQPP 3NTEA 1IO4A 2MKVA 2JB0A 1SVFA 5AVTB 1T8KA 5KLVK 4ZKPA 1PEMA 3KXDA 5GTIE 2JO0A 4U0FA 1OVUA 2JWAA 1NHLA 1PEQA 4ZMDA 4I7ZC 2LXCB 3CC2P 2XT1A 1RF1A 5KLVD 5CBNA 2E5YA 3FGAD 5CCGD 3IF4A 3B4QA 1EZVE 3H1KD 1VQ8P 5APUA 2AFDA 2K93A 1NTZJ 2J5UA 3V2RA 3L75J 2FQ1A 3L74D 2FBWC 2WVRA 2E75C 3CLQA 2KW2A 2ZXEB 1BGYJ 1YIJP 3FWNA 1CW5A 1VQ5P 1LTJC 1Q7YQ 1F80D 1JCCA 2L9FA 4N78E 1MFZA 2K1AA 1QVFO 1YJ9P 1SQQJ 3H1JG 2W8ZA 5JPAA 1MUUA 4I7ZB 1GK4A 4H0LC 1YJWP 3KPEA 1YQ4C 1GL2D 2FXMA 3EFGA 3TNUA 4QNBA 1ZR2A 2KORA 1G2CB 5I4TG 2OYIB 5TISE 1DD4A 3RL0g
chains in the Genus database with same CATH topology
3CCMP 2Z45A 4XFXA 3I55P 2PEIA 1YHQP 2OTJP 2PEQA 1BAJA 2M8LA 5F2OA 3CMAP 3CXCO 2OTLP 2DGYA 3G0VA 1YI2P 4XFZA 3RG6C 1RO2A 2PENA 1YJNP 1K9MQ 5HGLA 2PEMA 2PEOA 4XROA 2P9XA 3DPHA 1RO0A 1ZMBA 2M8NA 3G29A 4PH0A 3G26A 3CCRP 1M6NA 1Q86Q 5F2KA 3HZQA 5HGNA 1JJ2O 3DS4A 3H4EA 3G28A 2LF4A 3DS0A 3DS3A 3B5IA 3DS1A 1VQPP 2JYLA 3NTEA 3VRLC 1VQKP 3CCQP 3CMEP 1VQOP 3WBHA 1IUQA 2L6EA 1PEMA 1AUMA 2JO0A 4U0FA 3G71P 1VQ6P 2QEXP 1Q81Q 4U0CA 1PEUA 5BS1A 1PEQA 4PH1A 3DS2A 1S72P 3CPWO 3CC7P 2BHVA 2KODA 2QA4P 3HYBA 3OW2O 1KQSO 2BQ1E 2Z44A 3CC2P 2XT1A 4U0AA 1M90Q 1KD1Q 1KC8Q 2PEKA 2ONTA 2XXMA 5HGOA 1VQNP 4U0EA 1Q82Q 1M74A 1K73Q 3H47A 4COPA 5BS2A 1VQ8P 4GR6A 3G4SP 3CCUP 4U0BA 1RNIA 1K8AQ 1VQLP 1EIAA 1VQMP 3E2DA 5HGMA 4XFYA 5F2NA 5DCKA 2JYGA 3Q20A 1NJIQ 2EIAA 1VQ4P 1YIJP 3G21A 2Z46A 3CCLP 1VQ5P 1Q7YQ 3M1MA 1QVGO 3CCEP 1D1DA 4COCA 3DS5A 1QVFO 1YJ9P 1W2BO 1VQ9P 1M6EX 3G6EP 3CCSP 4XRQA 3I56P 1K30A 2E1MA 4M0IA 3CD6P 2BUOA 2EG5A 2M8PA 3LRYA 5JPAA 1PEOA 2PEJA 4GR2A 4IPYA 1VQ7P 1YJWP 1M1KQ 1N8RQ 3MGEA 3CCJP 2PY8A 2OARA 4U0DA 4QNBA 1A8OA 3G1GA 3CCVP 2EFJA 3P05A 5I4TG 3H0DA 3CC4P 1EOQA 3DTJA 4WYMA 1A43A 2CWOA 1YITP 1E6JP 2XV6A 3G1IA 1QRJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G4S P;  3CCM P;  3CD6 P;  3CCU P;  3I55 P;  3CCQ P;  3CME P;  1YHQ P;  2OTJ P;  1VQO P;  1K8A Q;  1VQL P;  1VQK P;  1VQ7 P;  3CMA P;  3CXC O;  1VQM P;  1YJW P;  1M1K Q;  1VQ6 P;  3G71 P;  1N8R Q;  2OTL P;  1YI2 P;  2QEX P;  1Q81 Q;  3CCJ P;  1NJI Q;  1YJN P;  1K9M Q;  1VQ4 P;  1S72 P;  3CPW O;  1YIJ P;  3CC7 P;  2QA4 P;  3CCV P;  3CCL P;  3OW2 O;  1VQ5 P;  1KQS O;  1Q7Y Q;  3CC4 P;  1QVG O;  3CC2 P;  3CCE P;  1M90 Q;  3CCR P;  1KD1 Q;  1KC8 Q;  1QVF O;  1YJ9 P;  1W2B O;  1Q86 Q;  1VQ9 P;  1VQN P;  1Q82 Q;  1JJ2 O;  1K73 Q;  1YIT P;  3G6E P;  3CCS P;  3I56 P;  1VQ8 P;  1VQP P; 
#chains in the Genus database with same CATH topology
 1SQX G;  2JO1 A;  3C8V A;  1PP9 E;  2N6Y A;  1M7L A;  1SQP D;  5AVQ B;  3VMZ A;  3G29 A;  5KP7 B;  4D6T J;  3VP8 A;  2IZ1 A;  1G2C A;  2EHS A;  2JYL A;  1NTK J;  3SWY A;  2HOD A;  1HWT C;  1GL2 A;  3SWF A;  1JUN A;  1SQV G;  2WPQ A;  3LW5 J;  2PFX A;  3DS2 A;  1ZV8 A;  3W68 A;  1L0N K;  1PIX A;  2Y9Y A;  3MZW B;  2L4B A;  2ONT A;  4WBA A;  2GZG A;  2A06 D;  2K9J B;  3P32 A;  2GUV A;  1S3J A;  1S9K E;  1PFI A;  4CA3 A;  2A45 H;  4JBZ A;  3AE8 C;  1AVY A;  3L4F A;  5E79 H;  1KFM A;  1RY3 A;  2YKP A;  3NY7 B;  1JY3 P;  3GJN A;  1M1J C;  1FZA A;  2E76 C;  4LGD E;  3VP9 A;  1G1I A;  3PHL A;  4DZO A;  2LIU A;  1HQB A;  2M8P A;  4GR2 A;  1SFC D;  1HUC A;  2K9J A;  1GXG A;  4Y28 J;  1EQ7 A;  2KUB A;  3HE4 B;  4HKZ H;  3CCJ P;  1URQ A;  3L75 G;  5AW5 B;  3FX0 A;  2HPC A;  1L0N D;  5AW8 B;  1AJY A;  4PWV B;  4KHX A;  1ZRT E;  1KLP A;  2UWJ E;  2VLQ A;  2JQ4 A;  3CCM P;  1N86 A;  1S2E A;  1Y9B A;  3F5H A;  2PEQ A;  2WSF H;  2BCC D;  1YYC A;  1DEE G;  2KIK A;  1SQQ E;  2PEN A;  4OGQ B;  2LXB A;  2WQY C;  3G3Z A;  2IZ0 A;  3EWK A;  1BE3 E;  2QM8 A;  3M06 A;  2Q3I A;  1RH5 B;  3S4R A;  3BCC G;  5KLV J;  2PNG A;  2FAE A;  1KQF B;  4U7J A;  4D6T G;  2XZ1 C;  3EJE A;  2KK7 A;  1JNM A;  2JWD A;  3WBH A;  2FYU E;  1E0H A;  2N1T B;  2ZVO B;  3TK1 A;  3CX5 I;  2XND H;  3A5T A;  1OXZ A;  1SQB K;  3H1L D;  5L8R J;  2PEK A;  1VHN A;  3TGU D;  3BRT B;  1N73 C;  1IFD A;  4NPF X;  2OYH A;  1RE4 A;  2POH A;  2AEJ A;  1M1J B;  1SQP K;  5AVX B;  4XA4 A;  2DNW A;  3CCL P;  3L71 J;  4IL6 E;  1LGH B;  2P58 A;  2WZ7 A;  1EXJ A;  1VQ9 P;  1T6A A;  3G6E P;  3B5N B;  1N7S D;  1GU4 A;  1FZC A;  3L73 J;  2BUO A;  2ZYA A;  3RK3 B;  2R44 A;  3V2N A;  3R2P A;  1R5L A;  2RH0 A;  3AE6 C;  3MD0 A;  3P7K A;  4UB8 E;  3U59 A;  4GDO A;  3CL3 D;  3VMA A;  5AVU B;  5CCG C;  2GA1 A;  2FAC A;  2VLP A;  3I55 P;  3OJA B;  2KYV A;  2M8L A;  2B9B A;  1SLQ A;  1FZB A;  1BXI A;  1SQV K;  3L36 A;  1ZP0 C;  1EZV I;  1Y8A A;  2D2C D;  1Q90 D;  3H1H J;  4PH0 A;  2XKM A;  2NPS C;  2LF4 A;  3H32 B;  5EW5 E;  3B5I A;  3H1I J;  3L35 A;  3BAS A;  4GT1 A;  2YIU C;  4EYY Q;  1VQO P;  2OYI C;  1AUM A;  1FE6 A;  1FR2 A;  4L75 A;  5KAI H;  2KOD A;  2W6A A;  3OW2 O;  1KQS O;  5C39 A;  1GD2 E;  1YQ3 C;  2HYN A;  2A45 I;  1NU1 G;  3H47 A;  3U1C A;  3NTN A;  3H1I D;  2KZI A;  2LKI A;  1BE3 J;  2WT7 A;  1CI6 A;  1KIL E;  5AW9 B;  3USS A;  4A7P A;  1AYI A;  4K35 A;  5DCK A;  2JYG A;  1MFT A;  4BPH A;  2M0B A;  1U7J A;  2ZYG A;  3C9I A;  1XTG B;  1M57 D;  5APW A;  3DS5 A;  1LT9 A;  1LTI C;  2LR2 A;  2PRR A;  1PP9 D;  3I56 P;  1L0I A;  3W67 A;  2EG5 A;  5KLV G;  3H1H E;  1VF5 B;  3JCU H;  3RK2 D;  3Q2Y A;  2PY8 A;  1PL5 A;  4W80 A;  1GDT A;  3II6 A;  4OVN F;  2H43 A;  3G1G A;  2O3J A;  5KKZ B;  2GDW A;  3H0D A;  1EOQ A;  1JY3 N;  4Y99 C;  3I5C A;  3L72 J;  1H0T A;  3L73 D;  1W5C E;  4XE5 B;  2OYH C;  1M8O B;  1K04 A;  1N7S C;  5GTH E;  3EQ2 A;  3A0H E;  1X9V A;  1PPJ E;  1KYO I;  1P84 I;  4XFZ A;  3L71 D;  2BCC E;  3O6Q A;  2G8Y A;  4ZNC A;  4GIF A;  2K0X A;  2PEO A;  3GMA A;  4IOI H;  4MN4 C;  5AW7 B;  3RBX A;  3H1L E;  1J2J B;  3PJS K;  3H4E A;  3LID A;  1LWU A;  3BCC J;  1EMV A;  1VQK P;  5KLI C;  3VRL C;  2PP6 A;  1AF8 A;  4DG9 A;  3RG2 A;  2H88 C;  1T2K C;  2N5H A;  3CXH E;  4TT3 H;  2BEZ F;  3L70 J;  3CX5 D;  4RO0 A;  3BCC E;  2FQ2 A;  5AW4 B;  1FZE A;  1KC8 Q;  4IFF A;  3RL0 C;  1LT9 B;  3T97 B;  5APQ A;  1BCC G;  3G4S P;  4C46 A;  1G1J A;  2QJY C;  2E42 A;  1K8A Q;  1VQL P;  3SFE C;  3ABV C;  4L74 A;  2MR8 A;  1NJI Q;  3M0D C;  4PD4 H;  1S9K D;  2KWL A;  1KMI Z;  1NO4 A;  2KGD A;  5APV A;  2ZT9 B;  2CNR A;  1PP9 G;  1LJ2 A;  4H13 B;  4HKG A;  1FDO A;  4I6M C;  1KQG B;  3IFM A;  1NGM B;  2C0X A;  4U0D A;  2OGU A;  3WU2 E;  3AE4 C;  4IL6 X;  2IBZ D;  1CZQ A;  1S5L E;  2CWO A;  1FJK A;  3VTP C;  3G1I A;  4HB1 A;  4U3F D;  1J1D C;  2WSE H;  2KSE A;  3P8M C;  3RK3 D;  1IJD B;  5H2F H;  1K9M Q;  3LW5 H;  2SPZ A;  3VMX A;  2M8N A;  5F2K A;  3HZQ A;  1PV3 A;  5B5E H;  1T3U A;  1NU1 K;  1IFN A;  2X2B A;  3A0H H;  2I8D A;  2WPT A;  1ZLL A;  3M0A A;  1QX8 A;  3BAT A;  1VQ6 P;  4YXW H;  4BRY A;  2Q1K A;  1L0L G;  1W2E A;  3GLM A;  4RES B;  2LIW A;  3FXD A;  1L0L E;  2E75 B;  1SQX K;  4GR6 A;  3CCU P;  2A06 G;  5EJD A;  1H0T B;  1NAY A;  3E1R A;  3L74 E;  4PJ0 E;  3MTU E;  2QM7 A;  3G21 A;  1XTC C;  2WPV B;  1NTZ K;  2Y0C A;  1SQV J;  1RF1 B;  1CSB A;  2MVV A;  3JSV C;  5CJ0 A;  4OGQ D;  1N7S A;  2ITA A;  3EFF K;  4LLH A;  4ZKU A;  3L37 A;  2R3C A;  3WMM 0;  3Q1M A;  1SQV D;  4WY4 A;  1N2D C;  4M0I A;  3HD7 D;  3TF5 A;  5DJT B;  2VLO A;  4H0L B;  2LKM A;  2L22 A;  1ZN5 A;  1NTK E;  2C0W A;  2HR3 A;  2J58 A;  3DTJ A;  1SQX J;  4WYM A;  1NTM G;  3CWB D;  1AA0 A;  1NWQ A;  2KOP A;  2RMZ A;  4XFX A;  1X22 A;  2W27 A;  5F2O A;  1SQQ D;  3G0V A;  1PPJ D;  1SQP G;  2VLN A;  1LTG C;  2P9X A;  2KGA A;  3L74 J;  5AVS B;  3S1K A;  2FFD B;  3DS3 A;  4JQ0 D;  4KT0 J;  4R4M A;  2A45 G;  1OFC X;  3H1K J;  1IUQ A;  2LOL A;  2IYP A;  3N4X A;  2K0Y A;  3Q5S A;  2KG9 A;  4U3F J;  3IR9 A;  2M8R A;  1UNK A;  2P10 A;  3RGU A;  2MD9 A;  2CK3 H;  4H13 C;  5APT A;  5HGO A;  4U0E A;  2N1T A;  3P8C E;  2KG6 A;  5BS2 A;  2W90 A;  1Z6M A;  3NXS A;  1SQB J;  2O1K A;  1QEX A;  2YMY A;  1RQV A;  3B8E B;  2Q3E A;  3L72 E;  1L4A B;  2CPS A;  2GYK A;  4UHP B;  4TLF A;  4AUW A;  3H1I E;  5CJ4 A;  4EDF A;  4GOE A;  1UII A;  1LNQ A;  1NYH A;  1RE3 C;  5AW3 B;  3MIW A;  3WUV A;  1GMJ A;  2IFM A;  3N7N A;  1EZV D;  3LRY A;  1SP4 A;  3K5B A;  2GZJ A;  3HD7 A;  5DJU B;  1HY8 A;  5AVY B;  2KLU A;  2NRG A;  3GF3 A;  1L0N E;  1J1E C;  3H1J D;  2QJP C;  3AE2 C;  2QE7 H;  2Y0E A;  1S4X A;  1EXI A;  1PGO A;  1IC2 A;  1T3J A;  5APS A;  2K9Y A;  2GZF A;  2HOD B;  4OGQ C;  5CZD B;  1YIT P;  1E6J P;  1HJB A;  2Z45 A;  2OTJ P;  5TIS H;  3U43 A;  2ZT9 D;  3L70 D;  1LTJ A;  1BCC E;  2FAD A;  2QIW A;  2Q6Q A;  1DV5 A;  1NTZ E;  4R4L A;  1PGP A;  2K3R A;  1AQ5 A;  3G26 A;  1NKN A;  5KJ7 D;  1LWU C;  2QJY B;  1NU1 D;  2YO3 A;  3DS1 A;  1S5L X;  3AE9 C;  3CME P;  3MP7 B;  2BAS A;  2HPC B;  4H44 C;  1BDC A;  1L0L K;  2N9B A;  1VF5 D;  3B5N A;  1WT6 A;  3GHG A;  1NU1 E;  3H1L G;  3CC7 P;  2FYZ A;  1M56 D;  2KP8 A;  4H2W C;  2CQ8 A;  2K37 A;  1M74 A;  2QNW A;  4R0M A;  5CCH A;  3AEE C;  4YXD C;  1SQB D;  2IBZ I;  1EIA A;  2MR7 A;  2K2Q A;  5TJH A;  1MZ8 A;  4PD4 D;  2FFD A;  5HGM A;  4I2L C;  4YTP C;  4WY4 C;  4QMA A;  2Z4E A;  1PP9 J;  1AFO A;  2BEQ D;  3KQG A;  2IX7 C;  4COC A;  2JR8 A;  2FYU J;  1GL2 C;  4H2X C;  3KZI E;  2NPS A;  2PGD A;  2E1M A;  2OYH B;  1M1J A;  2FVA A;  1D7M A;  5AVW B;  2QJP B;  3M91 A;  2Q7C A;  1H8A A;  3CXH D;  1HGV A;  3H32 A;  3AE7 C;  1A8O A;  2YO2 A;  3CCV P;  1GU5 A;  1X8Y A;  4MRT C;  5CCH D;  2ZYD A;  2Q9I A;  2FY8 A;  2XZ0 D;  4CPG A;  2B88 A;  1BAJ A;  1J1D B;  5KTB A;  1SQX D;  1RF0 A;  5AW2 B;  3MUD C;  3A2A A;  1DH3 A;  2O01 J;  1CI6 B;  3TGU E;  1FOS E;  4C7N B;  1AQT A;  2B87 B;  4ASV A;  1NAF A;  1LT9 C;  1QLE D;  2GUS A;  2WSC J;  3CCQ P;  2KG8 A;  1KV4 A;  5K5G B;  2VRS A;  2QRX A;  1ZNV A;  2AXC A;  4ASW A;  3IAO A;  1P84 D;  3RK3 C;  4N6J A;  2XU6 A;  1LTS C;  5KLI B;  1Q82 Q;  1DD3 A;  3SFD C;  2KNC B;  1H88 A;  2KGE A;  2FHS C;  2CPB A;  3GW6 A;  4DT0 A;  2MF4 A;  3KHU A;  4PV1 D;  1AVO A;  4XFY A;  4EI2 A;  2WPS A;  3Q20 A;  3Q3D A;  1VDF A;  1L0H A;  3GZL A;  1H89 A;  4OH8 B;  2E43 A;  2CGQ A;  1NTK G;  5BVZ A;  2V7Q H;  2H7H A;  1LTA C;  3CX5 H;  3E1I A;  2Y9Z A;  2NZ2 A;  5H2F E;  2O01 N;  1NQ4 A;  3LMO A;  1DX7 A;  2Z5I A;  2P7J A;  1JY2 O;  2IDB A;  1X0T A;  1JOC A;  3AED C;  1Z56 A;  1VPC A;  2R5D A;  4BXL A;  4JPZ B;  1BSH A;  4NPD A;  1N73 A;  4UB8 H;  3RL0 D;  1OVR A;  1N7S B;  1KIL B;  2YIU B;  1P84 H;  3CXC O;  2YXQ B;  2JEE A;  2L91 A;  1FC2 C;  1RO2 A;  7CEI A;  2NPS D;  2KSJ A;  2WSF J;  1ZMB A;  4GOF A;  5HGN A;  2K0D X;  1IK7 A;  5AVV B;  1T8Z A;  3ZDM A;  1KN7 A;  2FYU G;  3GHG C;  1ZRT D;  1EDL A;  1MV8 A;  5M1B A;  4PJ0 H;  1JO5 A;  4D6T E;  2QEX P;  1PEU A;  3HRN A;  5KP8 B;  3OAK A;  2P1J A;  2M5R A;  2BHV A;  2ZVN B;  3HE4 A;  2YMK A;  2WSS H;  2AXT E;  1A02 F;  1BE3 G;  3FXE A;  2N1T C;  2JP3 A;  2YXR B;  2E75 D;  1EC5 A;  1K73 Q;  1L0N J;  1SQV E;  3HUS A;  5APY A;  4U0B A;  3VYI A;  2ZAE B;  5AW0 B;  5F2N A;  5AW1 B;  2VSQ A;  2V4H A;  2YNY A;  3KDP B;  4PD4 E;  1JEK A;  2MJZ A;  4GKG A;  2R5B A;  1S1C X;  1RE3 A;  1W2B O;  1IK9 A;  2AF8 A;  3FWL A;  4H13 D;  3HE5 B;  3BCC D;  2PEJ A;  5HV8 A;  1VQ7 P;  1X79 B;  3GF7 A;  3MGE A;  1AV1 A;  5APX A;  1PGJ A;  1VF5 C;  5AVR B;  4DJG A;  2HLO A;  2ZFC A;  4BRY B;  1JCD A;  3VOP A;  1LP1 A;  3LIE A;  1QRJ A;  2DW3 A;  4BPF A;  1GXH A;  2HFE D;  3L72 D;  3M9H A;  4IFD K;  2E76 B;  5HGL A;  1KYO H;  5B66 E;  1NTK K;  5EFW B;  3T97 A;  2YKQ A;  2G3A A;  1JJ2 O;  2B89 A;  5KAF H;  5B5E E;  1P84 E;  3DS0 A;  5GTI H;  3RL0 B;  5AVZ B;  3V2Q A;  2FXO A;  3D6Z A;  3HUS B;  2JKV A;  1GW4 A;  2KS1 A;  1J1E B;  4WVZ A;  3QWO C;  1KOR A;  2QA4 P;  3AEC C;  3R4Y A;  1FU1 A;  2BCC G;  2OQQ A;  4COP A;  1PPJ G;  3V2P A;  1NVO A;  1SQX E;  2FXP A;  2FVE A;  4U3F G;  4H44 D;  3V6I A;  4HJG H;  2Q5U A;  3TDK A;  4OWF A;  2WIT A;  1E5W A;  3GKL C;  2H8P D;  1FJP A;  1BGY D;  1EDK A;  3CD6 P;  2C9L Y;  2JGP A;  2E74 D;  2R3S A;  5KLV E;  3PLN A;  1FDM A;  2OYO A;  1WMK A;  2FYU D;  2RN0 A;  3WU2 H;  4B86 A;  3Q5P A;  1A43 A;  3TNU B;  5CHX A;  4HH2 A;  2KZJ A;  2PAJ A;  5BU8 B;  1QL2 A;  1YHQ P;  1KB9 H;  4WB4 A;  3E7K A;  4WY4 D;  2PEM A;  2XDJ A;  1L0L D;  1FS0 E;  1OR5 A;  3DPH A;  2M5A A;  2P2U A;  1M6N A;  4UB6 E;  1Q86 Q;  1ZW0 A;  2KR5 A;  3O8Z A;  1L2P A;  2KXP B;  2ERH A;  2GDY A;  1Q81 Q;  4U0C A;  2IYO A;  5CBO A;  2N6Z A;  3C1L A;  2J59 M;  1NKZ B;  2HG5 D;  2Z44 A;  3RBZ A;  3KZI H;  2N5I A;  2KI7 B;  2M5A B;  4YPC A;  1EDJ A;  3TGU J;  2LPK A;  1VQM P;  1UJZ A;  3BRV B;  2QVA A;  3H1L J;  3U1A A;  1L0L J;  1VQ4 P;  2Z46 A;  2FVF A;  1QVG O;  3H1K E;  2H89 C;  1ZXG A;  2JDI H;  1SQQ G;  3H1J J;  1OX3 A;  2GM4 A;  1KIL C;  3A0B H;  3QH9 A;  3PRJ A;  1IFI A;  3UIA A;  3AE5 C;  1M1K Q;  2ZJS E;  3AE3 C;  3EJD A;  3CXH I;  1BSN A;  2LML A;  1GL2 B;  3SSU A;  1GZL A;  3JC2 2;  1KTM A;  2ZXX A;  2BCC J;  2NO8 A;  3GHG B;  1OWA A;  2JU1 A;  2QJK C;  2PEI A;  2L0Q A;  4NPE A;  1YJN P;  1JMB A;  3PP5 A;  3A3Y B;  4PD4 I;  1RO0 A;  3G28 A;  3HD7 B;  4L76 A;  2R32 A;  2XZR A;  1SFC C;  5AW6 B;  2FYN B;  4XFJ A;  1OW8 A;  2LTE A;  4UB6 H;  1T2K D;  2AFE A;  3HTK B;  2KLV A;  3EJB A;  1SFC A;  4I1L A;  1OW6 A;  1URQ B;  1NTM J;  1SQB G;  2L5G B;  1U7M A;  4HYT B;  3AE1 C;  1VL2 A;  1ACP A;  3PH0 A;  2FFD C;  5KJ7 A;  1L4A D;  4EOT A;  3E2D A;  5CCG A;  1KIL D;  1A02 J;  2EIA A;  3ITK A;  4RJT A;  3L70 G;  4DOJ A;  2XV5 A;  4Z1M H;  2WMM A;  3CWB J;  2KGC A;  1D1D A;  1E79 H;  1GW3 A;  1EDI A;  3L75 E;  3NFQ A;  4XRQ A;  1SFC B;  1K30 A;  1YBK A;  1NTK D;  3D71 A;  3L71 G;  5KKZ C;  3TSI A;  2OYI A;  1HVV A;  3M9B A;  3PTZ A;  4D6T D;  1SQP J;  2E74 C;  4IZ6 A;  3G9R A;  1OIP A;  3CC4 P;  3A0B E;  1NTM K;  1RQU A;  1USE A;  4BWN A;  2K92 A;  3L72 G;  1L4A A;  2JBG A;  2NPS B;  2K88 A;  3KYQ A;  1GPJ A;  1QGK B;  2YKO A;  2GZE A;  4GOD A;  2Z5H A;  1DEB A;  2D2C C;  4WWI A;  1Y47 A;  2A06 E;  3HE5 A;  4H0L D;  2OTK E;  4PV1 B;  3BVH A;  4PH1 A;  1MKM A;  2K94 A;  1S72 P;  1FAV A;  1KB9 D;  2KOQ A;  1ZR4 A;  3S9O A;  2BQ1 E;  1LT1 A;  3L75 D;  1SQP E;  1NTZ D;  3A7O A;  1CEI A;  1IZN B;  1LTJ B;  1FDI A;  1RNI A;  4NEO A;  4KJM A;  1LTB C;  1RE4 C;  1IFM A;  2N98 A;  2B87 A;  4QKO A;  1Q2N A;  1KIL A;  4IL6 H;  2QJK B;  3O6Q B;  2WT7 B;  3CCE P;  2WPR A;  3RK3 E;  3IN6 A;  2W6J H;  3JCU E;  3NMD A;  3H6P A;  3HTK A;  3CX5 E;  2OAR A;  4Y99 B;  2E5T A;  2KOG A;  1FZF A;  4C7N A;  3B5N C;  2AVA A;  3H1J E;  3P05 A;  2M3B A;  2WSE J;  5E79 E;  4N3Y B;  3H25 A;  3WUT A;  5KAF E;  2JAZ A;  5GTH H;  1IMP A;  3AEB C;  1MZ9 A;  1BDD A;  2N50 A;  4H2Y C;  3L71 E;  3CMA P;  2OTL P;  2DGY A;  2JU2 A;  3MHV A;  3V4W A;  3CE7 A;  1JY2 N;  3M0D A;  2W83 C;  1EZV G;  4RKU J;  2FQ0 A;  4LC1 A;  3WUU A;  1OVV A;  4XRO A;  3L73 E;  4JYB A;  4AQR D;  3L70 E;  2MY5 A;  3MUD A;  4AYC A;  2FYN C;  2IBZ E;  4DCK A;  2WWW A;  2L6E A;  4JF7 A;  2AEF A;  3G71 P;  2V7Q J;  1U57 A;  5BS1 A;  5KAI E;  3HYB A;  4H44 B;  2MVU A;  3TGU G;  2AXT H;  4U0A A;  1M90 Q;  3V4Q A;  1KD1 Q;  3MGN A;  2XXM A;  1X3O A;  1QL1 A;  5KP6 B;  2KS1 B;  1BGY E;  2GDX A;  3F89 A;  2O1J A;  1RF1 C;  3D6Y A;  1TU3 F;  4F37 A;  3D70 A;  1KYO D;  1RF0 C;  4C7R A;  2FKW B;  3M1M A;  2WSC H;  1N73 B;  1HF9 A;  4BPG A;  1UIX A;  3AEF C;  1OZH A;  3TYY A;  1ZME C;  1DNY A;  1KB9 E;  2FYU K;  1HTL C;  3CWB E;  1N8R Q;  1LWU B;  1GK6 A;  1R8E A;  1FBM A;  1FOS F;  1HJ0 A;  5CMZ A;  1BCC J;  1NTM D;  3VMY A;  3HD7 C;  1L0N G;  1URQ D;  1R5S A;  2ZT9 C;  1JTH B;  2GZI A;  2XV6 A;  1OMI A;  1PZQ A;  4IFM A;  1KQL A;  1HBW A;  1NH4 A;  5BU5 A;  1YI2 P;  1BE3 D;  5CCH C;  1DIP A;  2I1J A;  3RG6 C;  1BCC D;  2W6B A;  1SQB E;  1WRG A;  1HGZ A;  3H1K G;  3OA7 A;  3RK2 C;  2CG5 B;  5B66 H;  2E76 D;  3VN0 A;  4K3A A;  3H1I G;  3GG2 A;  3B5N D;  3CCR P;  1USD A;  1K05 A;  1RHZ B;  3AEG C;  2I1K A;  1KZU B;  3GZM A;  4W7Z A;  1GTW A;  2O01 H;  1JMM A;  3CXH H;  2KOS A;  3CI9 A;  1JY3 O;  1BGY G;  1JB0 J;  3SWK A;  3CPW O;  1N7L A;  3AEA C;  2LL8 A;  1IFP A;  1FZC B;  1SS1 A;  2RKL A;  1NTZ G;  3Q5R A;  1PGQ A;  2WTY A;  3H1H D;  1VQN P;  2C9N Y;  2D2C B;  2Y0D A;  1NU1 J;  1KB9 I;  2IBZ G;  1LTT C;  3B4S A;  2ROQ A;  1IFJ A;  1NOH A;  2XNX A;  5HVC A;  4O9B A;  3L73 G;  2KOO A;  1FZG A;  1LP1 B;  3P8C D;  1M6E X;  1VKU A;  4PV1 C;  3CCS P;  2IPP A;  1YTZ T;  1FZC C;  1JTH A;  3V5B A;  3CWB G;  2AEM A;  1PEO A;  1SQQ K;  3H1H G;  4IPY A;  1IMQ A;  2E74 B;  4PXH B;  1NTM E;  2K5X A;  4L73 A;  2EHT A;  1JM0 A;  4W7Y A;  2IFN A;  1KFN A;  2EFJ A;  2QSI A;  3HUS C;  4JYC A;  1S5L H;  4N78 D;  1OW7 A;  2QG4 A;  3RK2 B;  2N9Y B;  2M3E A;  1L4A C;  4WY4 B;  2KNC A;  3B71 A;  5KJ7 C;  1HH0 A;  1YTZ I;  2JJL A;  1JY2 P;  1ZOY C;  4M3L A;  2N1T D;  4EIJ A;  2KB7 P;  2P67 A;  1KYO E;  3M9Q A;  3DS4 A;  4U3F E;  3L74 G;  1URQ C;  1VQP P;  3NTE A;  1IO4 A;  2MKV A;  2JB0 A;  1SVF A;  5AVT B;  1T8K A;  5KLV K;  4ZKP A;  1PEM A;  3KXD A;  5GTI E;  2JO0 A;  4U0F A;  1OVU A;  2JWA A;  1NHL A;  1PEQ A;  4ZMD A;  4I7Z C;  2LXC B;  3CC2 P;  2XT1 A;  1RF1 A;  5KLV D;  5CBN A;  2E5Y A;  3FGA D;  5CCG D;  3IF4 A;  3B4Q A;  1EZV E;  3H1K D;  1VQ8 P;  5APU A;  2AFD A;  2K93 A;  1NTZ J;  2J5U A;  3V2R A;  3L75 J;  2FQ1 A;  3L74 D;  2FBW C;  2WVR A;  2E75 C;  3CLQ A;  2KW2 A;  2ZXE B;  1BGY J;  1YIJ P;  3FWN A;  1CW5 A;  1VQ5 P;  1LTJ C;  1Q7Y Q;  1F80 D;  1JCC A;  2L9F A;  4N78 E;  1MFZ A;  2K1A A;  1QVF O;  1YJ9 P;  1SQQ J;  3H1J G;  2W8Z A;  5JPA A;  1MUU A;  4I7Z B;  1GK4 A;  4H0L C;  1YJW P;  3KPE A;  1YQ4 C;  1GL2 D;  2FXM A;  3EFG A;  3TNU A;  4QNB A;  1ZR2 A;  2KOR A;  1G2C B;  5I4T G;  2OYI B;  5TIS E;  1DD4 A;  3RL0 g; 
#chains in the Genus database with same CATH homology
 3CCM P;  2Z45 A;  4XFX A;  3I55 P;  2PEI A;  1YHQ P;  2OTJ P;  2PEQ A;  1BAJ A;  2M8L A;  5F2O A;  3CMA P;  3CXC O;  2OTL P;  2DGY A;  3G0V A;  1YI2 P;  4XFZ A;  3RG6 C;  1RO2 A;  2PEN A;  1YJN P;  1K9M Q;  5HGL A;  2PEM A;  2PEO A;  4XRO A;  2P9X A;  3DPH A;  1RO0 A;  1ZMB A;  2M8N A;  3G29 A;  4PH0 A;  3G26 A;  3CCR P;  1M6N A;  1Q86 Q;  5F2K A;  3HZQ A;  5HGN A;  1JJ2 O;  3DS4 A;  3H4E A;  3G28 A;  2LF4 A;  3DS0 A;  3DS3 A;  3B5I A;  3DS1 A;  1VQP P;  2JYL A;  3NTE A;  3VRL C;  1VQK P;  3CCQ P;  3CME P;  1VQO P;  3WBH A;  1IUQ A;  2L6E A;  1PEM A;  1AUM A;  2JO0 A;  4U0F A;  3G71 P;  1VQ6 P;  2QEX P;  1Q81 Q;  4U0C A;  1PEU A;  5BS1 A;  1PEQ A;  4PH1 A;  3DS2 A;  1S72 P;  3CPW O;  3CC7 P;  2BHV A;  2KOD A;  2QA4 P;  3HYB A;  3OW2 O;  1KQS O;  2BQ1 E;  2Z44 A;  3CC2 P;  2XT1 A;  4U0A A;  1M90 Q;  1KD1 Q;  1KC8 Q;  2PEK A;  2ONT A;  2XXM A;  5HGO A;  1VQN P;  4U0E A;  1Q82 Q;  1M74 A;  1K73 Q;  3H47 A;  4COP A;  5BS2 A;  1VQ8 P;  4GR6 A;  3G4S P;  3CCU P;  4U0B A;  1RNI A;  1K8A Q;  1VQL P;  1EIA A;  1VQM P;  3E2D A;  5HGM A;  4XFY A;  5F2N A;  5DCK A;  2JYG A;  3Q20 A;  1NJI Q;  2EIA A;  1VQ4 P;  1YIJ P;  3G21 A;  2Z46 A;  3CCL P;  1VQ5 P;  1Q7Y Q;  3M1M A;  1QVG O;  3CCE P;  1D1D A;  4COC A;  3DS5 A;  1QVF O;  1YJ9 P;  1W2B O;  1VQ9 P;  1M6E X;  3G6E P;  3CCS P;  4XRQ A;  3I56 P;  1K30 A;  2E1M A;  4M0I A;  3CD6 P;  2BUO A;  2EG5 A;  2M8P A;  3LRY A;  5JPA A;  1PEO A;  2PEJ A;  4GR2 A;  4IPY A;  1VQ7 P;  1YJW P;  1M1K Q;  1N8R Q;  3MGE A;  3CCJ P;  2PY8 A;  2OAR A;  4U0D A;  4QNB A;  1A8O A;  3G1G A;  3CCV P;  2EFJ A;  3P05 A;  5I4T G;  3H0D A;  3CC4 P;  1EOQ A;  3DTJ A;  4WYM A;  1A43 A;  2CWO A;  1YIT P;  1E6J P;  2XV6 A;  3G1I A;  1QRJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...