1M1KQ

Co-crystal structure of azithromycin bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAKGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structures of four macrolide antibiotics bound to the large ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S RRNA
total genus 48
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2002-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1m1kQ02
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1m1kQ01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1m1kQ03
3I56P 1KD1Q 1VQNP 3CD6P 1VQ7P 1VQ4P 1YJ9P 1KQSO 1VQKP 1Q81Q 3CMEP 2QA4P 3CMAP 1Q82Q 1YITP 3G6EP 1YI2P 1YJNP 3OW2O 1JJ2O 2OTJP 1Q7YQ 1VQPP 1VQOP 3G71P 3CCMP 3CCQP 1W2BO 3CC2P 1VQ9P 1QVFO 1KC8Q 1VQ5P 1N8RQ 2QEXP 3CCVP 1K9MQ 1M90Q 1VQ8P 3CPWO 1QVGO 1Q86Q 1VQMP 3CXCO 1VQLP 1K73Q 1M1KQ 1VQ6P 1YHQP 2OTLP 1K8AQ 3G4SP 3CCUP 1YIJP 3CCJP 3CCSP 3CC4P 3CCEP 3CCLP 3I55P 3CCRP 1NJIQ 1YJWP 3CC7P 1S72P
chains in the Genus database with same CATH superfamily
3L74D 1L0NJ 2E75D 4KHXA 1SQQG 1NWQA 4K3AA 1JOCA 2KLVA 2YKOA 5KAIH 3VMYA 3EJEA 1NTMD 1S1CX 1KQFB 4U0EA 1VQMP 2KNCA 1PGJA 1HTLC 4NPDA 1FOSE 2YKPA 4H2YC 4GODA 2N5IA 5HGNA 3Q3DA 2FFDC 3WBHA 3Q2YA 2WSEJ 2B9BA 5AW4B 2KS1B 1IMPA 3K5BA 2AXCA 2M8PA 3L70E 2JU1A 2Q9IA 1CEIA 3H1HG 4UB6H 1IUQA 5E79H 1PIXA 1PFIA 3H25A 1SQXG 3G6EP 1MFTA 1SQVG 4GT1A 3FXEA 3HRNA 1J1DC 3CWBG 1LTJA 5APQA 1NTMJ 1MKMA 2N1TC 4WB4A 2W6BA 2M8NA 3MZWB 2KYVA 3A0HE 1PL5A 1ZN5A 3AE5C 2A45I 1VF5B 3H1HD 4L76A 2J58A 4JYBA 1Q81Q 3A0HH 2R3CA 3H1ID 4DJGA 1ZRTD 2B87A 1EDJA 2WITA 3HD7B 4N78D 1T8KA 5B5EH 4L75A 4YXWH 2N5HA 1GL2B 3CL3D 1LP1A 1U57A 1YHQP 2POHA 2MVUA 3A5TA 4Y99B 1DEEG 2KGCA 1FU1A 3B71A 2H89C 1SQVJ 1JJ2O 1SQPG 1M8OB 2V4HA 2O01H 2VLQA 5F2OA 2BHVA 1N73B 1KMIZ 2RKLA 3AEDC 3G28A 4RO0A 3L73J 1NTZJ 2KXPB 2XV5A 3C1LA 3FX0A 1S4XA 2E75C 2JP3A 2WZ7A 2L5GB 4UHPB 2O1JA 1VQ4P 1LTBC 3N4XA 5BU5A 2PRRA 3HUSA 1MZ9A 5KLIC 1SQQJ 1OFCX 2KOOA 2KNCB 2M3EA 1SQXD 1H89A 4H2XC 3BASA 4HYTB 1QRJA 1W5CE 3EFGA 1HY8A 3HUSC 1VQKP 3V2PA 2QRXA 1EOQA 3H1HE 2GUSA 3H1KJ 1GZLA 1KZUB 3V4QA 1ZR4A 2JO0A 1SQXE 4I2LC 2YNYA 1HGZA 2QM7A 3CCLP 1NTKK 1JNMA 3CC7P 5B5EE 2JKVA 1BGYE 2XT1A 1DH3A 1XTCC 2C9NY 3CLQA 1KYOH 5E79E 1Z56A 1NTKG 2N1TA 3KZIH 4UB8E 3KPEA 1G2CB 1PP9J 2ZXEB 5KP6B 2OGUA 2PEKA 4YPCA 2KWLA 3FGAD 3VTPC 2IPPA 1KTMA 3O6QB 3SFDC 1IFPA 3GKLC 4KT0J 4GR6A 1TU3F 1H0TA 2Q3EA 1MFZA 3KQGA 5TISE 1M57D 2PENA 4W7YA 3AEEC 2LIWA 4ZNCA 2MR8A 2NPSD 2KOPA 2K93A 2WSFJ 2JYGA 2WQYC 1SQPE 2JWAA 2FQ2A 1SQVK 2E74D 1NQ4A 4N78E 2QG4A 3HTKB 1PPJD 3PRJA 2L9FA 3WU2E 1DD3A 1E5WA 1GL2C 1L2PA 3L74E 5AW8B 3CMAP 4BRYA 3BCCE 4PV1B 3DS0A 4BPHA 4BWNA 2Z45A 3C8VA 1LJ2A 4AUWA 1QLED 3SWFA 1UIIA 2YXQB 5BU8B 1SQVE 2Y9YA 3GLMA 3CX5E 1SQBK 3B5ND 2KIKA 4U3FG 1NTKE 1SFCA 3WU2H 3EWKA 2K92A 4DOJA 1SQPJ 5APSA 1EZVI 3IR9A 2PY8A 1NVOA 2CNRA 1JCDA 1FJKA 1IC2A 3VOPA 1PGQA 4JYCA 3NFQA 4DCKA 3CWBD 1YQ4C 1SQBE 4XROA 2FYUE 1NTKJ 4PD4H 3DS5A 1N8RQ 3EQ2A 4OGQC 2GZJA 5AVVB 1EXIA 1NTME 3L75G 4O9BA 3LIEA 1NYHA 3TGUG 1X22A 5KP8B 3G3ZA 1BE3G 2N1TB 2FYZA 3FWLA 1U7MA 3H1JD 1QVFO 2Z5HA 5TISH 3KDPB 2AFDA 3T97A 5KJ7A 3RL0B 5AVUB 1QEXA 2FKWB 3H1HJ 2WPRA 3OW2O 2H8PD 2OQQA 2OYOA 3B5NC 1NH4A 1HJ0A 1YTZT 1LTJB 1SQXK 3B4SA 3P8MC 1Q2NA 2R5DA 4ZKPA 1OX3A 1GU4A 1GW4A 2E74B 2BCCD 1H88A 2QSIA 2PEOA 1YBKA 3L73E 3G9RA 1A02F 3VP9A 2WSSH 2C9LY 1BE3D 1JMMA 3CCRP 3V2QA 3I56P 3GMAA 2C0WA 3L36A 3U59A 5AVZB 2P1JA 2ZT9D 2CPSA 3VN0A 3H4EA 4GR2A 3CCQP 1N7SD 1SFCC 3A2AA 3H1KE 4QMAA 1DX7A 1N7SA 2KOGA 4HB1A 2V7QH 4IFDK 5BVZA 1SQPK 4LC1A 2FY8A 1A02J 3L72E 5AVYB 1UNKA 1KFMA 1YI2P 4NPFX 5GTIE 3HE4A 3BVHA 1W2BO 1DIPA 2XZ1C 1M90Q 1GK4A 3GZLA 4TT3H 3H1LE 1URQB 3JSVC 1YIJP 5KAIE 2KB7P 1WMKA 2GA1A 3H32A 2Y0DA 2CGQA 2WWWA 2IYOA 3UIAA 4EOTA 1GXHA 3MIWA 2WSCJ 5CJ0A 2ZVOB 2W90A 4RESB 1NTMG 2ONTA 3L75E 4PXHB 4XE5B 2YXRB 3MP7B 2LR2A 4U0DA 2K9JB 2LKMA 1T6AA 4I6MC 1KV4A 1FZEA 3E7KA 3L4FA 1LWUC 2I1KA 3Q1MA 3S4RA 3TNUA 2KZIA 1FDMA 4PJ0H 2QJKB 1AJYA 1AYIA 1KB9D 2JWDA 3PHLA 1FC2C 2OYIB 1JTHA 1G1JA 3BRVB 2KS1A 2WMMA 2QJKC 2LIUA 1A43A 1OVRA 2ROQA 3CCUP 3DS2A 3Q5SA 2CPBA 5CMZA 2XDJA 4U3FJ 2QA4P 1L0NE 5KLVG 1GL2D 3H6PA 1KLPA 4RKUJ 2OTJP 5KLIB 1CW5A 3DPHA 3JCUE 1EZVG 4DZOA 1ZXGA 2WT7B 2KODA 1K73Q 2E75B 1EDLA 1K8AQ 2LKIA 1FZCB 3BCCG 1JY3P 2FFDB 1NAFA 1H8AA 4JF7A 4N6JA 2H88C 1QX8A 3DS4A 2WPQA 2GDXA 1RE3A 2B87B 2GDYA 2E42A 2FYUJ 3GG2A 4XA4A 4U0AA 1IO4A 3CXHI 1X9VA 3L71D 2XXMA 3B4QA 1P84H 3R4YA 2R44A 2N6YA 1KD1Q 1ZR2A 1RO0A 2AXTE 1YJ9P 1WT6A 5CBOA 3R2PA 3M0DC 2I8DA 4C7NA 1KN7A 2JEEA 1KB9H 1URQA 1SQQE 1JB0J 1QVGO 1SLQA 1PEMA 3RG2A 2GZGA 1JCCA 2G3AA 1M56D 4IOIH 1PZQA 5F2NA 2K88A 2WPTA 3L71G 2WSEH 2QNWA 2BCCE 2AFEA 4IFMA 3EJBA 3AEBC 1EZVE 4DT0A 3H1LG 5HGOA 1PEQA 1ZP0C 5HGLA 4H44B 2A45H 3AE3C 1NTMK 4PV1C 5AW3B 2Y0CA 3RGUA 2MJZA 5JPAA 1LTJC 1BCCJ 1JTHB 1QGKB 3MHVA 3M0AA 1M74A 1VQ8P 1LTIC 3G21A 2CWOA 1KILC 3L75J 2A06D 2K1AA 1DV5A 1FDIA 4BRYB 3CD6P 3P32A 1FOSF 1CSBA 3AEAC 2HFED 3G71P 4EDFA 1LP1B 1KILD 1HGVA 1KILE 2M8LA 3M1MA 3SFEC 2IBZD 3AEFC 1L0IA 1Q90D 2FFDA 3PJSK 4QNBA 4L74A 2KOQA 1L4AD 2LTEA 5AW2B 2JBGA 1L4AA 4K35A 5KP7B 2K3RA 3H1JJ 3G1GA 3MUDC 2A06E 1EQ7A 2KSJA 1Z6MA 4GOFA 1XTGB 2YO3A 3GHGB 1NO4A 5EW5E 2FVAA 1P84I 4HH2A 5I4TG 1LT1A 3H1JG 2QM8A 1NTKD 2JB0A 3JCUH 1W2EA 2FYNB 2KSEA 5APXA 1PPJG 2FXOA 2P67A 2MKVA 3CX5D 7CEIA 3W67A 1BSNA 3TGUJ 4MRTC 1LTGC 5KLVD 1VQ5P 2BCCG 5C39A 2A06G 1S2EA 1LT9C 2HYNA 1BSHA 2KGEA 1JY2P 1SQQK 2AF8A 3EJDA 1EZVD 2NPSA 2XZRA 1N7LA 1N86A 3BCCD 1PGPA 3TGUE 2IBZG 4GKGA 3P8CE 1M7LA 2N1TD 1ZW0A 4TLFA 2P7JA 2HPCB 2KI7B 2MD9A 3VMAA 5H2FH 1SQPD 2KK7A 1JY2N 4W80A 1S5LX 1BXIA 2K0DX 2C0XA 2G8YA 2K2QA 2GDWA 4DG9A 3GF7A 1IFNA 2KG9A 3L72J 1AUMA 2WPSA 1M1JC 4XRQA 3H32B 5AW6B 1KB9I 4U0CA 1YTZI 1G2CA 4ASWA 1OW6A 3U1CA 4B86A 3O6QA 1S9KD 2K37A 4PWVB 1NU1G 3NMDA 3RK3E 2H43A 2K9YA 3GHGC 4PH0A 1IFMA 3D71A 1A8OA 2BCCJ 1K9MQ 1IK7A 1T2KC 2CG5B 2E5YA 4IL6E 2XV6A 5HGMA 4H13D 2UWJE 2BASA 1VPCA 1M1JB 1VQNP 4JBZA 2KOSA 1RHZB 2RN0A 1FJPA 3L37A 3QWOC 5B66H 2V7QJ 1JM0A 2ZFCA 4XFYA 5TJHA 2CQ8A 4CA3A 3LW5J 3CXCO 2WPVB 2KGDA 2PNGA 2WT7A 2L4BA 1OIPA 1ACPA 1UIXA 1CI6A 2MY5A 2KZJA 1RE4A 2SPZA 1L0LE 1RQUA 2PGDA 3L73G 2EHTA 2E76D 3B8EB 2VRSA 2ZJSE 5DJUB 2VLPA 4ZMDA 1S72P 1JY3O 3L70J 3PP5A 1L0LJ 5CCGC 2YIUB 2DNWA 4PV1D 1SQXJ 2IZ1A 3HUSB 2OYHA 1BCCG 3A7OA 2BUOA 2NRGA 1HWTC 3RK2C 1HUCA 3CE7A 1ZRTE 1IZNB 1FBMA 2ZT9C 1NU1E 1JMBA 2W6JH 3MTUE 1FS0E 2EHSA 3GF3A 5BS2A 2QE7H 1FZFA 2Z4EA 3VYIA 3NTEA 3E1IA 1AQTA 1OVVA 1KYOE 2KUBA 4XFXA 2M5AA 3ITKA 3USSA 3QH9A 4PD4D 4L73A 2LL8A 3LW5H 3G1IA 4H0LD 4I7ZB 5KKZB 1OR5A 2OYIC 1YQ3C 1KC8Q 3L70D 4GIFA 1FDOA 2KW2A 1AF8A 3VP8A 1RF0C 2W27A 1GPJA 2JGPA 3L74J 1BAJA 3CCEP 3DTJA 3FXDA 5GTHH 4GDOA 1S5LH 3TSIA 1BDCA 3V5BA 3OAKA 1RH5B 3TNUB 5APUA 1N73A 4H0LB 1SQBG 1P84E 2B88A 3CPWO 1AA0A 3VMXA 5CCHA 2PEMA 2VLOA 1EMVA 2AEMA 2YKQA 5EFWB 3IF4A 3CCSP 4WY4B 2LXCB 1BCCD 2FAEA 2AVAA 1T3JA 3RK2B 4I7ZC 5KKZC 1FZAA 2M0BA 1N7SB 3CX5I 3D70A 3HD7A 2GYKA 3V2RA 3U43A 3KHUA 1NTZE 1FZBA 3IFMA 2M5RA 1NKZB 1T8ZA 5CCGD 4AQRD 1FZCA 2BQ1E 1KQSO 5CCGA 1Q82Q 3VMZA 1SS1A 3H1IJ 4N3YB 1L0LG 1OW7A 2E43A 4Y28J 3NXSA 4R4LA 2ZYAA 1SFCB 3DS3A 3CC4P 1OVUA 2IBZI 2Q5UA 3NY7B 1SQBD 1NOHA 2QVAA 4W7ZA 3MD0A 1RE4C 3PLNA 2N9YB 2X2BA 2OARA 1FZCC 3S9OA 4COPA 3I5CA 2AXTH 1FE6A 2HPCA 4LLHA 3LIDA 1FZGA 2Q6QA 3HD7C 1J1EC 1JEKA 1FR2A 3I55P 1YJWP 3SSUA 4PD4E 3AE6C 1SQVD 1KYOI 2FYUK 4U3FE 3CX5H 4NEOA 2GZIA 2ZT9B 3HYBA 5AW1B 1NTZD 5CCHD 2PEIA 1NU1D 3IN6A 2Q7CA 4IPYA 2IDBA 1J2JB 1K30A 2W6AA 1BCCE 2LMLA 2MVVA 1PPJE 3G29A 3GHGA 3L72G 2OTKE 1VQPP 2R5BA 4NPEA 4IL6X 1N2DC 3MUDA 1RF1B 1EC5A 1AQ5A 5AVTB 4WY4D 1P84D 2N98A 4XFZA 1U7JA 1E79H 2GUVA 3E2DA 1M1JA 1YYCA 3Q20A 4C46A 1LGHB 2ZYGA 1ZOYC 2HODB 2YIUC 1VF5C 2KP8A 3E1RA 1GK6A 1Y9BA 1BGYD 2R32A 2DGYA 2P10A 3EFFK 1PP9G 1KYOD 4UB6E 1LT9B 2Z46A 5CZDB 2EFJA 3IAOA 1IMQA 3RK2D 2IZ0A 1VQLP 3M06A 1L0LK 3PH0A 4Y99C 2QJYB 4Z1MH 3M91A 2P2UA 2EG5A 2N9BA 1YJNP 1VL2A 2PP6A 1PV3A 2YMYA 1UJZA 1LTSC 2PAJA 2K0XA 3AEGC 1KFNA 2IFNA 4BPFA 5B66E 3MGEA 2RH0A 1M6EX 5AW7B 3WUVA 2E76B 3RK3D 2FQ0A 2JR8A 4COCA 4QKOA 3M0DA 4OVNF 2ZVNB 3KXDA 3CCMP 1T2KD 3GZMA 2FYNC 1RF1C 2Z5IA 4IFFA 1VHNA 2JU2A 1L0LD 1LWUB 3B5NB 2FYUG 3P7KA 4AYCA 2K9JA 2JO1A 4EYYQ 2HG5D 2M5AB 5EJDA 3A0BE 4IL6H 1RF1A 1RF0A 1BDDA 1NHLA 1E0HA 2JYLA 2WTYA 2E5TA 3G4SP 3BATA 3P05A 3SWKA 3H1IE 3AE7C 5APYA 2FVFA 5KLVJ 5F2KA 4WBAA 2AEFA 2XNDH 1ZMBA 2JDIH 1BGYJ 3CI9A 3S1KA 5L8RJ 3D6YA 2E74C 3KYQA 1L0NG 3HZQA 3DS1A 2MR7A 1D7MA 1GW3A 3L74G 4H44D 4WYMA 2Y0EA 3WMM0 5HV8A 1E6JP 2L6EA 1R5LA 1HH0A 1SQBJ 5CHXA 2FADA 2P9XA 1VQ9P 1PEUA 1S9KE 2OYHC 3TK1A 1LTTC 5DJTB 4H2WC 3M9HA 3L70G 4PH1A 3KZIE 4UB8H 2JJLA 4HKZH 1USEA 3LRYA 4U0BA 3G26A 2NZ2A 3CXHH 5AVQB 1AFOA 4PD4I 1CI6B 3M9BA 1HF9A 3RK3C 1PEOA 2D2CD 5KTBA 1G1IA 1EDKA 4XFJA 1N73C 3CWBJ 2NPSC 4U7JA 3FWNA 4MN4C 1X3OA 1JY2O 1ZV8A 3CCJP 1URQD 1R5SA 3P8CD 1L4AC 1RE3C 2Y9ZA 1WRGA 1JO5A 2HLOA 1BE3J 3TGUD 2B89A 2W8ZA 1AVOA 1M6NA 2OYIA 1PP9D 1RY3A 3T97B 3NTNA 2Z44A 3ABVC 4H13B 5K5GB 2VSQA 1R8EA 5KLVE 5KAFE 1IFJA 2K5XA 4D6TG 2N50A 2NO8A 4M0IA 1NU1J 4EI2A 2FHSC 3M9QA 4CPGA 1KILA 4RJTA 1KORA 2L0QA 3H47A 2PFXA 1AV1A 1GL2A 1IFDA 1SP4A 2J5UA 3BRTB 1GMJA 3HE5A 1K05A 3G0VA 3W68A 5KLVK 1PGOA 2VLNA 4GOEA 5KJ7D 1Y47A 4BPGA 2KORA 2YO2A 1X0TA 1DD4A 5APWA 1IK9A 2IBZE 2LXBA 2LOLA 3RL0C 1JUNA 4PJ0E 3CXHE 1SQQD 2M3BA 3Q5PA 1VF5D 5BS1A 1J1DB 2KR5A 4YTPC 5AVRB 2BEQD 1MV8A 4C7RA 1EIAA 1KQGB 3GW6A 1LTAC 2ITAA 2ERHA 4D6TD 2P58A 2O01N 1M1KQ 3OA7A 2ZXXA 3GJNA 1QL2A 5HVCA 1VDFA 4EIJA 1VQ7P 2FVEA 1BGYG 1S3JA 1YITP 5AW5B 4A7PA 1L0NK 4HJGH 3MGNA 2BEZF 1OW8A 1AVYA 1FAVA 2KG8A 4YXDC 4R4MA 1J1EB 4H44C 2L91A 1L0ND 1RO2A 3WUTA 3V4WA 2NPSB 1HQBA 5CCHC 2O01J 2WVRA 1NGMB 2Q3IA 4ZKUA 2XZ0D 5M1BA 2Q1KA 4C7NB 2FBWC 2K0YA 2KG6A 5DCKA 1Q86Q 3JC22 2WSCH 4H0LC 1KB9E 1D1DA 2L22A 1H0TB 2MF4A 2QIWA 1USDA 1RNIA 1KILB 2EIAA 3WUUA 3AE1C 4IZ6A 2O1KA 3V6IA 1VQOP 3AE9C 3L71E 3HE5B 3CC2P 3VRLC 1S5LE 1LNQA 2ZAEB 1GD2E 2XKMA 2GZFA 4BXLA 1GTWA 5AVWB 2IX7C 1LWUA 3B5NA 5CJ4A 5H2FE 1ZNVA 3ZDMA 4JPZB 3U1AA 2KLUA 1NTZK 1HJBA 3RK3B 2IFMA 1RQVA 1EDIA 1T3UA 1F80D 1IJDB 5AVXB 2YMKA 2E1MA 3L35A 1Y8AA 1ZMEC 4WVZA 1VKUA 3CMEP 3L72D 4F37A 1L0HA 4LGDE 5AW0B 4H13C 2ZYDA 3RL0g 1GDTA 1X8YA 2KGAA 2HR3A 2JAZA 2CK3H 3H1KG 1KQLA 1QL1A 2IYPA 2W83C 3LMOA 3AE8C 2WSFH 1N7SC 4OH8B 2QEXP 1URQC 3RBZA 1NAYA 3L73D 2QJPB 3L75D 2K94A 3H0DA 3TF5A 3F89A 3SWYA 2I1JA 1IFIA 2HODA 3B5IA 2D2CC 4JQ0D 2FXPA 2XU6A 5KAFH 2M8RA 1Q7YQ 1HVVA 1OMIA 3D6ZA 3CCVP 2FXMA 1OXZA 2QJYC 1MZ8A 5GTHE 3HE4B 3H1LD 3II6A 3PTZA 1OWAA 4OWFA 3C9IA 2O3JA 2OTLP 1OZHA 2AEJA 3A0BH 4I1LA 2H7HA 1SFCD 3H1IG 1X79B 4HKGA 3AE4C 3AE2C 2GM4A 4WY4C 4M3LA 5APVA 4D6TE 3AECC 2XNXA 2E76C 1CZQA 3H1JE 3H1KD 3RL0D 4U3FD 1NJIQ 1JY3N 4WWIA 2PEJA 5AW9B 5KJ7C 1BE3E 3A3YB 1NKNA 3OJAB 1NU1K 3H1LJ 2D2CB 3CXHD 5AVSB 2FQ1A 2LF4A 3F5HA 2FYUD 3HTKA 4KJMA 1SVFA 1MUUA 1L4AB 5CBNA 4D6TJ 2QJPC 3L71J 2PEQA 3BCCJ 3CWBE 4U0FA 1GXGA 3HD7D 3O8ZA 2A45G 5APTA 3RG6C 1ZLLA 4OGQB 1NTZG 3N7NA 3Q5RA 1VQ6P 1K04A 2DW3A 5GTIH 2J59M 3V2NA 1GU5A 4WY4A 2FACA 1LT9A 3TYYA 3RBXA 2OYHB 2JQ4A 3TDKA 4ASVA 1EXJA 2N6ZA 1PP9E 2RMZA 1DEBA 2GZEA 2R3SA 4R0MA 1DNYA 2LPKA 4OGQD 1HBWA
chains in the Genus database with same CATH topology
1K30A 3LRYA 5BS1A 4GR6A 4U0BA 3G26A 3CD6P 1AUMA 4XRQA 2PENA 4COCA 3G29A 1YI2P 3DS4A 1JJ2O 1PEOA 1VQPP 4U0CA 1EIAA 3G71P 3CCMP 1W2BO 1QVFO 1M90Q 5F2OA 2BHVA 2M8LA 3M1MA 2JYGA 2BUOA 3G28A 4U0EA 1VQMP 4U0AA 1M1KQ 4XFZA 4QNBA 1YIJP 2XXMA 3CCJP 1NJIQ 2E1MA 1KD1Q 5HGNA 1RO0A 3G1GA 1VQ4P 1VQ7P 1YJ9P 1KQSO 2BQ1E 3CMEP 2PEJA 3CMAP 3WBHA 1Q82Q 1YITP 3E2DA 4PH0A 3DS0A 3OW2O 3Q20A 1M6NA 1A8OA 1K9MQ 2Z45A 2ONTA 5BS2A 2LF4A 1QVGO 3DS3A 2Z44A 2JYLA 5I4TG 1PEMA 2M8PA 3NTEA 3G4SP 4U0DA 1QRJA 2XV6A 3CC4P 5HGMA 3P05A 1IUQA 4XFXA 4M0IA 5F2NA 1RO2A 2PEQA 1VQNP 4U0FA 1VQKP 2DGYA 1EOQA 5F2KA 3G6EP 2OARA 3G1IA 1ZMBA 3H47A 3RG6C 2PEOA 4COPA 2Z46A 4XFYA 2EFJA 2JO0A 1VQ5P 2QEXP 1KC8Q 5HGOA 2PY8A 1PEQA 5DCKA 2M8NA 3G0VA 1Q86Q 3CXCO 1VQLP 5HGLA 3H0DA 1A43A 1VQ6P 1D1DA 3CCUP 1BAJA 3HZQA 3CCLP 3DS1A 3CCEP 3I55P 3DS2A 3CCRP 3CC7P 1YJWP 3DTJA 1RNIA 3I56P 4WYMA 2EIAA 2XT1A 3B5IA 1E6JP 1Q81Q 2QA4P 2EG5A 2L6EA 1YJNP 2OTJP 1Q7YQ 1VQOP 4XROA 3DPHA 3H4EA 4GR2A 3CCQP 5JPAA 2P9XA 3CC2P 1VQ9P 3VRLC 3DS5A 1N8RQ 3CCVP 1PEUA 3HYBA 1M74A 1VQ8P 3CPWO 2PEKA 3G21A 2PEMA 2KODA 2CWOA 1K73Q 3MGEA 1YHQP 2OTLP 1M6EX 2PEIA 1K8AQ 4PH1A 3CCSP 4IPYA 1S72P
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I56 P;  1KD1 Q;  1VQN P;  3CD6 P;  1VQ7 P;  1VQ4 P;  1YJ9 P;  1KQS O;  1VQK P;  1Q81 Q;  3CME P;  2QA4 P;  3CMA P;  1Q82 Q;  1YIT P;  3G6E P;  1YI2 P;  1YJN P;  3OW2 O;  1JJ2 O;  2OTJ P;  1Q7Y Q;  1VQP P;  1VQO P;  3G71 P;  3CCM P;  3CCQ P;  1W2B O;  3CC2 P;  1VQ9 P;  1QVF O;  1KC8 Q;  1VQ5 P;  1N8R Q;  2QEX P;  3CCV P;  1K9M Q;  1M90 Q;  1VQ8 P;  3CPW O;  1QVG O;  1Q86 Q;  1VQM P;  3CXC O;  1VQL P;  1K73 Q;  1M1K Q;  1VQ6 P;  1YHQ P;  2OTL P;  1K8A Q;  3G4S P;  3CCU P;  1YIJ P;  3CCJ P;  3CCS P;  3CC4 P;  3CCE P;  3CCL P;  3I55 P;  3CCR P;  1NJI Q;  1YJW P;  3CC7 P;  1S72 P; 
#chains in the Genus database with same CATH topology
 3L74 D;  1L0N J;  2E75 D;  4KHX A;  1SQQ G;  1NWQ A;  4K3A A;  1JOC A;  2KLV A;  2YKO A;  5KAI H;  3VMY A;  3EJE A;  1NTM D;  1S1C X;  1KQF B;  4U0E A;  1VQM P;  2KNC A;  1PGJ A;  1HTL C;  4NPD A;  1FOS E;  2YKP A;  4H2Y C;  4GOD A;  2N5I A;  5HGN A;  3Q3D A;  2FFD C;  3WBH A;  3Q2Y A;  2WSE J;  2B9B A;  5AW4 B;  2KS1 B;  1IMP A;  3K5B A;  2AXC A;  2M8P A;  3L70 E;  2JU1 A;  2Q9I A;  1CEI A;  3H1H G;  4UB6 H;  1IUQ A;  5E79 H;  1PIX A;  1PFI A;  3H25 A;  1SQX G;  3G6E P;  1MFT A;  1SQV G;  4GT1 A;  3FXE A;  3HRN A;  1J1D C;  3CWB G;  1LTJ A;  5APQ A;  1NTM J;  1MKM A;  2N1T C;  4WB4 A;  2W6B A;  2M8N A;  3MZW B;  2KYV A;  3A0H E;  1PL5 A;  1ZN5 A;  3AE5 C;  2A45 I;  1VF5 B;  3H1H D;  4L76 A;  2J58 A;  4JYB A;  1Q81 Q;  3A0H H;  2R3C A;  3H1I D;  4DJG A;  1ZRT D;  2B87 A;  1EDJ A;  2WIT A;  3HD7 B;  4N78 D;  1T8K A;  5B5E H;  4L75 A;  4YXW H;  2N5H A;  1GL2 B;  3CL3 D;  1LP1 A;  1U57 A;  1YHQ P;  2POH A;  2MVU A;  3A5T A;  4Y99 B;  1DEE G;  2KGC A;  1FU1 A;  3B71 A;  2H89 C;  1SQV J;  1JJ2 O;  1SQP G;  1M8O B;  2V4H A;  2O01 H;  2VLQ A;  5F2O A;  2BHV A;  1N73 B;  1KMI Z;  2RKL A;  3AED C;  3G28 A;  4RO0 A;  3L73 J;  1NTZ J;  2KXP B;  2XV5 A;  3C1L A;  3FX0 A;  1S4X A;  2E75 C;  2JP3 A;  2WZ7 A;  2L5G B;  4UHP B;  2O1J A;  1VQ4 P;  1LTB C;  3N4X A;  5BU5 A;  2PRR A;  3HUS A;  1MZ9 A;  5KLI C;  1SQQ J;  1OFC X;  2KOO A;  2KNC B;  2M3E A;  1SQX D;  1H89 A;  4H2X C;  3BAS A;  4HYT B;  1QRJ A;  1W5C E;  3EFG A;  1HY8 A;  3HUS C;  1VQK P;  3V2P A;  2QRX A;  1EOQ A;  3H1H E;  2GUS A;  3H1K J;  1GZL A;  1KZU B;  3V4Q A;  1ZR4 A;  2JO0 A;  1SQX E;  4I2L C;  2YNY A;  1HGZ A;  2QM7 A;  3CCL P;  1NTK K;  1JNM A;  3CC7 P;  5B5E E;  2JKV A;  1BGY E;  2XT1 A;  1DH3 A;  1XTC C;  2C9N Y;  3CLQ A;  1KYO H;  5E79 E;  1Z56 A;  1NTK G;  2N1T A;  3KZI H;  4UB8 E;  3KPE A;  1G2C B;  1PP9 J;  2ZXE B;  5KP6 B;  2OGU A;  2PEK A;  4YPC A;  2KWL A;  3FGA D;  3VTP C;  2IPP A;  1KTM A;  3O6Q B;  3SFD C;  1IFP A;  3GKL C;  4KT0 J;  4GR6 A;  1TU3 F;  1H0T A;  2Q3E A;  1MFZ A;  3KQG A;  5TIS E;  1M57 D;  2PEN A;  4W7Y A;  3AEE C;  2LIW A;  4ZNC A;  2MR8 A;  2NPS D;  2KOP A;  2K93 A;  2WSF J;  2JYG A;  2WQY C;  1SQP E;  2JWA A;  2FQ2 A;  1SQV K;  2E74 D;  1NQ4 A;  4N78 E;  2QG4 A;  3HTK B;  1PPJ D;  3PRJ A;  2L9F A;  3WU2 E;  1DD3 A;  1E5W A;  1GL2 C;  1L2P A;  3L74 E;  5AW8 B;  3CMA P;  4BRY A;  3BCC E;  4PV1 B;  3DS0 A;  4BPH A;  4BWN A;  2Z45 A;  3C8V A;  1LJ2 A;  4AUW A;  1QLE D;  3SWF A;  1UII A;  2YXQ B;  5BU8 B;  1SQV E;  2Y9Y A;  3GLM A;  3CX5 E;  1SQB K;  3B5N D;  2KIK A;  4U3F G;  1NTK E;  1SFC A;  3WU2 H;  3EWK A;  2K92 A;  4DOJ A;  1SQP J;  5APS A;  1EZV I;  3IR9 A;  2PY8 A;  1NVO A;  2CNR A;  1JCD A;  1FJK A;  1IC2 A;  3VOP A;  1PGQ A;  4JYC A;  3NFQ A;  4DCK A;  3CWB D;  1YQ4 C;  1SQB E;  4XRO A;  2FYU E;  1NTK J;  4PD4 H;  3DS5 A;  1N8R Q;  3EQ2 A;  4OGQ C;  2GZJ A;  5AVV B;  1EXI A;  1NTM E;  3L75 G;  4O9B A;  3LIE A;  1NYH A;  3TGU G;  1X22 A;  5KP8 B;  3G3Z A;  1BE3 G;  2N1T B;  2FYZ A;  3FWL A;  1U7M A;  3H1J D;  1QVF O;  2Z5H A;  5TIS H;  3KDP B;  2AFD A;  3T97 A;  5KJ7 A;  3RL0 B;  5AVU B;  1QEX A;  2FKW B;  3H1H J;  2WPR A;  3OW2 O;  2H8P D;  2OQQ A;  2OYO A;  3B5N C;  1NH4 A;  1HJ0 A;  1YTZ T;  1LTJ B;  1SQX K;  3B4S A;  3P8M C;  1Q2N A;  2R5D A;  4ZKP A;  1OX3 A;  1GU4 A;  1GW4 A;  2E74 B;  2BCC D;  1H88 A;  2QSI A;  2PEO A;  1YBK A;  3L73 E;  3G9R A;  1A02 F;  3VP9 A;  2WSS H;  2C9L Y;  1BE3 D;  1JMM A;  3CCR P;  3V2Q A;  3I56 P;  3GMA A;  2C0W A;  3L36 A;  3U59 A;  5AVZ B;  2P1J A;  2ZT9 D;  2CPS A;  3VN0 A;  3H4E A;  4GR2 A;  3CCQ P;  1N7S D;  1SFC C;  3A2A A;  3H1K E;  4QMA A;  1DX7 A;  1N7S A;  2KOG A;  4HB1 A;  2V7Q H;  4IFD K;  5BVZ A;  1SQP K;  4LC1 A;  2FY8 A;  1A02 J;  3L72 E;  5AVY B;  1UNK A;  1KFM A;  1YI2 P;  4NPF X;  5GTI E;  3HE4 A;  3BVH A;  1W2B O;  1DIP A;  2XZ1 C;  1M90 Q;  1GK4 A;  3GZL A;  4TT3 H;  3H1L E;  1URQ B;  3JSV C;  1YIJ P;  5KAI E;  2KB7 P;  1WMK A;  2GA1 A;  3H32 A;  2Y0D A;  2CGQ A;  2WWW A;  2IYO A;  3UIA A;  4EOT A;  1GXH A;  3MIW A;  2WSC J;  5CJ0 A;  2ZVO B;  2W90 A;  4RES B;  1NTM G;  2ONT A;  3L75 E;  4PXH B;  4XE5 B;  2YXR B;  3MP7 B;  2LR2 A;  4U0D A;  2K9J B;  2LKM A;  1T6A A;  4I6M C;  1KV4 A;  1FZE A;  3E7K A;  3L4F A;  1LWU C;  2I1K A;  3Q1M A;  3S4R A;  3TNU A;  2KZI A;  1FDM A;  4PJ0 H;  2QJK B;  1AJY A;  1AYI A;  1KB9 D;  2JWD A;  3PHL A;  1FC2 C;  2OYI B;  1JTH A;  1G1J A;  3BRV B;  2KS1 A;  2WMM A;  2QJK C;  2LIU A;  1A43 A;  1OVR A;  2ROQ A;  3CCU P;  3DS2 A;  3Q5S A;  2CPB A;  5CMZ A;  2XDJ A;  4U3F J;  2QA4 P;  1L0N E;  5KLV G;  1GL2 D;  3H6P A;  1KLP A;  4RKU J;  2OTJ P;  5KLI B;  1CW5 A;  3DPH A;  3JCU E;  1EZV G;  4DZO A;  1ZXG A;  2WT7 B;  2KOD A;  1K73 Q;  2E75 B;  1EDL A;  1K8A Q;  2LKI A;  1FZC B;  3BCC G;  1JY3 P;  2FFD B;  1NAF A;  1H8A A;  4JF7 A;  4N6J A;  2H88 C;  1QX8 A;  3DS4 A;  2WPQ A;  2GDX A;  1RE3 A;  2B87 B;  2GDY A;  2E42 A;  2FYU J;  3GG2 A;  4XA4 A;  4U0A A;  1IO4 A;  3CXH I;  1X9V A;  3L71 D;  2XXM A;  3B4Q A;  1P84 H;  3R4Y A;  2R44 A;  2N6Y A;  1KD1 Q;  1ZR2 A;  1RO0 A;  2AXT E;  1YJ9 P;  1WT6 A;  5CBO A;  3R2P A;  3M0D C;  2I8D A;  4C7N A;  1KN7 A;  2JEE A;  1KB9 H;  1URQ A;  1SQQ E;  1JB0 J;  1QVG O;  1SLQ A;  1PEM A;  3RG2 A;  2GZG A;  1JCC A;  2G3A A;  1M56 D;  4IOI H;  1PZQ A;  5F2N A;  2K88 A;  2WPT A;  3L71 G;  2WSE H;  2QNW A;  2BCC E;  2AFE A;  4IFM A;  3EJB A;  3AEB C;  1EZV E;  4DT0 A;  3H1L G;  5HGO A;  1PEQ A;  1ZP0 C;  5HGL A;  4H44 B;  2A45 H;  3AE3 C;  1NTM K;  4PV1 C;  5AW3 B;  2Y0C A;  3RGU A;  2MJZ A;  5JPA A;  1LTJ C;  1BCC J;  1JTH B;  1QGK B;  3MHV A;  3M0A A;  1M74 A;  1VQ8 P;  1LTI C;  3G21 A;  2CWO A;  1KIL C;  3L75 J;  2A06 D;  2K1A A;  1DV5 A;  1FDI A;  4BRY B;  3CD6 P;  3P32 A;  1FOS F;  1CSB A;  3AEA C;  2HFE D;  3G71 P;  4EDF A;  1LP1 B;  1KIL D;  1HGV A;  1KIL E;  2M8L A;  3M1M A;  3SFE C;  2IBZ D;  3AEF C;  1L0I A;  1Q90 D;  2FFD A;  3PJS K;  4QNB A;  4L74 A;  2KOQ A;  1L4A D;  2LTE A;  5AW2 B;  2JBG A;  1L4A A;  4K35 A;  5KP7 B;  2K3R A;  3H1J J;  3G1G A;  3MUD C;  2A06 E;  1EQ7 A;  2KSJ A;  1Z6M A;  4GOF A;  1XTG B;  2YO3 A;  3GHG B;  1NO4 A;  5EW5 E;  2FVA A;  1P84 I;  4HH2 A;  5I4T G;  1LT1 A;  3H1J G;  2QM8 A;  1NTK D;  2JB0 A;  3JCU H;  1W2E A;  2FYN B;  2KSE A;  5APX A;  1PPJ G;  2FXO A;  2P67 A;  2MKV A;  3CX5 D;  7CEI A;  3W67 A;  1BSN A;  3TGU J;  4MRT C;  1LTG C;  5KLV D;  1VQ5 P;  2BCC G;  5C39 A;  2A06 G;  1S2E A;  1LT9 C;  2HYN A;  1BSH A;  2KGE A;  1JY2 P;  1SQQ K;  2AF8 A;  3EJD A;  1EZV D;  2NPS A;  2XZR A;  1N7L A;  1N86 A;  3BCC D;  1PGP A;  3TGU E;  2IBZ G;  4GKG A;  3P8C E;  1M7L A;  2N1T D;  1ZW0 A;  4TLF A;  2P7J A;  2HPC B;  2KI7 B;  2MD9 A;  3VMA A;  5H2F H;  1SQP D;  2KK7 A;  1JY2 N;  4W80 A;  1S5L X;  1BXI A;  2K0D X;  2C0X A;  2G8Y A;  2K2Q A;  2GDW A;  4DG9 A;  3GF7 A;  1IFN A;  2KG9 A;  3L72 J;  1AUM A;  2WPS A;  1M1J C;  4XRQ A;  3H32 B;  5AW6 B;  1KB9 I;  4U0C A;  1YTZ I;  1G2C A;  4ASW A;  1OW6 A;  3U1C A;  4B86 A;  3O6Q A;  1S9K D;  2K37 A;  4PWV B;  1NU1 G;  3NMD A;  3RK3 E;  2H43 A;  2K9Y A;  3GHG C;  4PH0 A;  1IFM A;  3D71 A;  1A8O A;  2BCC J;  1K9M Q;  1IK7 A;  1T2K C;  2CG5 B;  2E5Y A;  4IL6 E;  2XV6 A;  5HGM A;  4H13 D;  2UWJ E;  2BAS A;  1VPC A;  1M1J B;  1VQN P;  4JBZ A;  2KOS A;  1RHZ B;  2RN0 A;  1FJP A;  3L37 A;  3QWO C;  5B66 H;  2V7Q J;  1JM0 A;  2ZFC A;  4XFY A;  5TJH A;  2CQ8 A;  4CA3 A;  3LW5 J;  3CXC O;  2WPV B;  2KGD A;  2PNG A;  2WT7 A;  2L4B A;  1OIP A;  1ACP A;  1UIX A;  1CI6 A;  2MY5 A;  2KZJ A;  1RE4 A;  2SPZ A;  1L0L E;  1RQU A;  2PGD A;  3L73 G;  2EHT A;  2E76 D;  3B8E B;  2VRS A;  2ZJS E;  5DJU B;  2VLP A;  4ZMD A;  1S72 P;  1JY3 O;  3L70 J;  3PP5 A;  1L0L J;  5CCG C;  2YIU B;  2DNW A;  4PV1 D;  1SQX J;  2IZ1 A;  3HUS B;  2OYH A;  1BCC G;  3A7O A;  2BUO A;  2NRG A;  1HWT C;  3RK2 C;  1HUC A;  3CE7 A;  1ZRT E;  1IZN B;  1FBM A;  2ZT9 C;  1NU1 E;  1JMB A;  2W6J H;  3MTU E;  1FS0 E;  2EHS A;  3GF3 A;  5BS2 A;  2QE7 H;  1FZF A;  2Z4E A;  3VYI A;  3NTE A;  3E1I A;  1AQT A;  1OVV A;  1KYO E;  2KUB A;  4XFX A;  2M5A A;  3ITK A;  3USS A;  3QH9 A;  4PD4 D;  4L73 A;  2LL8 A;  3LW5 H;  3G1I A;  4H0L D;  4I7Z B;  5KKZ B;  1OR5 A;  2OYI C;  1YQ3 C;  1KC8 Q;  3L70 D;  4GIF A;  1FDO A;  2KW2 A;  1AF8 A;  3VP8 A;  1RF0 C;  2W27 A;  1GPJ A;  2JGP A;  3L74 J;  1BAJ A;  3CCE P;  3DTJ A;  3FXD A;  5GTH H;  4GDO A;  1S5L H;  3TSI A;  1BDC A;  3V5B A;  3OAK A;  1RH5 B;  3TNU B;  5APU A;  1N73 A;  4H0L B;  1SQB G;  1P84 E;  2B88 A;  3CPW O;  1AA0 A;  3VMX A;  5CCH A;  2PEM A;  2VLO A;  1EMV A;  2AEM A;  2YKQ A;  5EFW B;  3IF4 A;  3CCS P;  4WY4 B;  2LXC B;  1BCC D;  2FAE A;  2AVA A;  1T3J A;  3RK2 B;  4I7Z C;  5KKZ C;  1FZA A;  2M0B A;  1N7S B;  3CX5 I;  3D70 A;  3HD7 A;  2GYK A;  3V2R A;  3U43 A;  3KHU A;  1NTZ E;  1FZB A;  3IFM A;  2M5R A;  1NKZ B;  1T8Z A;  5CCG D;  4AQR D;  1FZC A;  2BQ1 E;  1KQS O;  5CCG A;  1Q82 Q;  3VMZ A;  1SS1 A;  3H1I J;  4N3Y B;  1L0L G;  1OW7 A;  2E43 A;  4Y28 J;  3NXS A;  4R4L A;  2ZYA A;  1SFC B;  3DS3 A;  3CC4 P;  1OVU A;  2IBZ I;  2Q5U A;  3NY7 B;  1SQB D;  1NOH A;  2QVA A;  4W7Z A;  3MD0 A;  1RE4 C;  3PLN A;  2N9Y B;  2X2B A;  2OAR A;  1FZC C;  3S9O A;  4COP A;  3I5C A;  2AXT H;  1FE6 A;  2HPC A;  4LLH A;  3LID A;  1FZG A;  2Q6Q A;  3HD7 C;  1J1E C;  1JEK A;  1FR2 A;  3I55 P;  1YJW P;  3SSU A;  4PD4 E;  3AE6 C;  1SQV D;  1KYO I;  2FYU K;  4U3F E;  3CX5 H;  4NEO A;  2GZI A;  2ZT9 B;  3HYB A;  5AW1 B;  1NTZ D;  5CCH D;  2PEI A;  1NU1 D;  3IN6 A;  2Q7C A;  4IPY A;  2IDB A;  1J2J B;  1K30 A;  2W6A A;  1BCC E;  2LML A;  2MVV A;  1PPJ E;  3G29 A;  3GHG A;  3L72 G;  2OTK E;  1VQP P;  2R5B A;  4NPE A;  4IL6 X;  1N2D C;  3MUD A;  1RF1 B;  1EC5 A;  1AQ5 A;  5AVT B;  4WY4 D;  1P84 D;  2N98 A;  4XFZ A;  1U7J A;  1E79 H;  2GUV A;  3E2D A;  1M1J A;  1YYC A;  3Q20 A;  4C46 A;  1LGH B;  2ZYG A;  1ZOY C;  2HOD B;  2YIU C;  1VF5 C;  2KP8 A;  3E1R A;  1GK6 A;  1Y9B A;  1BGY D;  2R32 A;  2DGY A;  2P10 A;  3EFF K;  1PP9 G;  1KYO D;  4UB6 E;  1LT9 B;  2Z46 A;  5CZD B;  2EFJ A;  3IAO A;  1IMQ A;  3RK2 D;  2IZ0 A;  1VQL P;  3M06 A;  1L0L K;  3PH0 A;  4Y99 C;  2QJY B;  4Z1M H;  3M91 A;  2P2U A;  2EG5 A;  2N9B A;  1YJN P;  1VL2 A;  2PP6 A;  1PV3 A;  2YMY A;  1UJZ A;  1LTS C;  2PAJ A;  2K0X A;  3AEG C;  1KFN A;  2IFN A;  4BPF A;  5B66 E;  3MGE A;  2RH0 A;  1M6E X;  5AW7 B;  3WUV A;  2E76 B;  3RK3 D;  2FQ0 A;  2JR8 A;  4COC A;  4QKO A;  3M0D A;  4OVN F;  2ZVN B;  3KXD A;  3CCM P;  1T2K D;  3GZM A;  2FYN C;  1RF1 C;  2Z5I A;  4IFF A;  1VHN A;  2JU2 A;  1L0L D;  1LWU B;  3B5N B;  2FYU G;  3P7K A;  4AYC A;  2K9J A;  2JO1 A;  4EYY Q;  2HG5 D;  2M5A B;  5EJD A;  3A0B E;  4IL6 H;  1RF1 A;  1RF0 A;  1BDD A;  1NHL A;  1E0H A;  2JYL A;  2WTY A;  2E5T A;  3G4S P;  3BAT A;  3P05 A;  3SWK A;  3H1I E;  3AE7 C;  5APY A;  2FVF A;  5KLV J;  5F2K A;  4WBA A;  2AEF A;  2XND H;  1ZMB A;  2JDI H;  1BGY J;  3CI9 A;  3S1K A;  5L8R J;  3D6Y A;  2E74 C;  3KYQ A;  1L0N G;  3HZQ A;  3DS1 A;  2MR7 A;  1D7M A;  1GW3 A;  3L74 G;  4H44 D;  4WYM A;  2Y0E A;  3WMM 0;  5HV8 A;  1E6J P;  2L6E A;  1R5L A;  1HH0 A;  1SQB J;  5CHX A;  2FAD A;  2P9X A;  1VQ9 P;  1PEU A;  1S9K E;  2OYH C;  3TK1 A;  1LTT C;  5DJT B;  4H2W C;  3M9H A;  3L70 G;  4PH1 A;  3KZI E;  4UB8 H;  2JJL A;  4HKZ H;  1USE A;  3LRY A;  4U0B A;  3G26 A;  2NZ2 A;  3CXH H;  5AVQ B;  1AFO A;  4PD4 I;  1CI6 B;  3M9B A;  1HF9 A;  3RK3 C;  1PEO A;  2D2C D;  5KTB A;  1G1I A;  1EDK A;  4XFJ A;  1N73 C;  3CWB J;  2NPS C;  4U7J A;  3FWN A;  4MN4 C;  1X3O A;  1JY2 O;  1ZV8 A;  3CCJ P;  1URQ D;  1R5S A;  3P8C D;  1L4A C;  1RE3 C;  2Y9Z A;  1WRG A;  1JO5 A;  2HLO A;  1BE3 J;  3TGU D;  2B89 A;  2W8Z A;  1AVO A;  1M6N A;  2OYI A;  1PP9 D;  1RY3 A;  3T97 B;  3NTN A;  2Z44 A;  3ABV C;  4H13 B;  5K5G B;  2VSQ A;  1R8E A;  5KLV E;  5KAF E;  1IFJ A;  2K5X A;  4D6T G;  2N50 A;  2NO8 A;  4M0I A;  1NU1 J;  4EI2 A;  2FHS C;  3M9Q A;  4CPG A;  1KIL A;  4RJT A;  1KOR A;  2L0Q A;  3H47 A;  2PFX A;  1AV1 A;  1GL2 A;  1IFD A;  1SP4 A;  2J5U A;  3BRT B;  1GMJ A;  3HE5 A;  1K05 A;  3G0V A;  3W68 A;  5KLV K;  1PGO A;  2VLN A;  4GOE A;  5KJ7 D;  1Y47 A;  4BPG A;  2KOR A;  2YO2 A;  1X0T A;  1DD4 A;  5APW A;  1IK9 A;  2IBZ E;  2LXB A;  2LOL A;  3RL0 C;  1JUN A;  4PJ0 E;  3CXH E;  1SQQ D;  2M3B A;  3Q5P A;  1VF5 D;  5BS1 A;  1J1D B;  2KR5 A;  4YTP C;  5AVR B;  2BEQ D;  1MV8 A;  4C7R A;  1EIA A;  1KQG B;  3GW6 A;  1LTA C;  2ITA A;  2ERH A;  4D6T D;  2P58 A;  2O01 N;  1M1K Q;  3OA7 A;  2ZXX A;  3GJN A;  1QL2 A;  5HVC A;  1VDF A;  4EIJ A;  1VQ7 P;  2FVE A;  1BGY G;  1S3J A;  1YIT P;  5AW5 B;  4A7P A;  1L0N K;  4HJG H;  3MGN A;  2BEZ F;  1OW8 A;  1AVY A;  1FAV A;  2KG8 A;  4YXD C;  4R4M A;  1J1E B;  4H44 C;  2L91 A;  1L0N D;  1RO2 A;  3WUT A;  3V4W A;  2NPS B;  1HQB A;  5CCH C;  2O01 J;  2WVR A;  1NGM B;  2Q3I A;  4ZKU A;  2XZ0 D;  5M1B A;  2Q1K A;  4C7N B;  2FBW C;  2K0Y A;  2KG6 A;  5DCK A;  1Q86 Q;  3JC2 2;  2WSC H;  4H0L C;  1KB9 E;  1D1D A;  2L22 A;  1H0T B;  2MF4 A;  2QIW A;  1USD A;  1RNI A;  1KIL B;  2EIA A;  3WUU A;  3AE1 C;  4IZ6 A;  2O1K A;  3V6I A;  1VQO P;  3AE9 C;  3L71 E;  3HE5 B;  3CC2 P;  3VRL C;  1S5L E;  1LNQ A;  2ZAE B;  1GD2 E;  2XKM A;  2GZF A;  4BXL A;  1GTW A;  5AVW B;  2IX7 C;  1LWU A;  3B5N A;  5CJ4 A;  5H2F E;  1ZNV A;  3ZDM A;  4JPZ B;  3U1A A;  2KLU A;  1NTZ K;  1HJB A;  3RK3 B;  2IFM A;  1RQV A;  1EDI A;  1T3U A;  1F80 D;  1IJD B;  5AVX B;  2YMK A;  2E1M A;  3L35 A;  1Y8A A;  1ZME C;  4WVZ A;  1VKU A;  3CME P;  3L72 D;  4F37 A;  1L0H A;  4LGD E;  5AW0 B;  4H13 C;  2ZYD A;  3RL0 g;  1GDT A;  1X8Y A;  2KGA A;  2HR3 A;  2JAZ A;  2CK3 H;  3H1K G;  1KQL A;  1QL1 A;  2IYP A;  2W83 C;  3LMO A;  3AE8 C;  2WSF H;  1N7S C;  4OH8 B;  2QEX P;  1URQ C;  3RBZ A;  1NAY A;  3L73 D;  2QJP B;  3L75 D;  2K94 A;  3H0D A;  3TF5 A;  3F89 A;  3SWY A;  2I1J A;  1IFI A;  2HOD A;  3B5I A;  2D2C C;  4JQ0 D;  2FXP A;  2XU6 A;  5KAF H;  2M8R A;  1Q7Y Q;  1HVV A;  1OMI A;  3D6Z A;  3CCV P;  2FXM A;  1OXZ A;  2QJY C;  1MZ8 A;  5GTH E;  3HE4 B;  3H1L D;  3II6 A;  3PTZ A;  1OWA A;  4OWF A;  3C9I A;  2O3J A;  2OTL P;  1OZH A;  2AEJ A;  3A0B H;  4I1L A;  2H7H A;  1SFC D;  3H1I G;  1X79 B;  4HKG A;  3AE4 C;  3AE2 C;  2GM4 A;  4WY4 C;  4M3L A;  5APV A;  4D6T E;  3AEC C;  2XNX A;  2E76 C;  1CZQ A;  3H1J E;  3H1K D;  3RL0 D;  4U3F D;  1NJI Q;  1JY3 N;  4WWI A;  2PEJ A;  5AW9 B;  5KJ7 C;  1BE3 E;  3A3Y B;  1NKN A;  3OJA B;  1NU1 K;  3H1L J;  2D2C B;  3CXH D;  5AVS B;  2FQ1 A;  2LF4 A;  3F5H A;  2FYU D;  3HTK A;  4KJM A;  1SVF A;  1MUU A;  1L4A B;  5CBN A;  4D6T J;  2QJP C;  3L71 J;  2PEQ A;  3BCC J;  3CWB E;  4U0F A;  1GXG A;  3HD7 D;  3O8Z A;  2A45 G;  5APT A;  3RG6 C;  1ZLL A;  4OGQ B;  1NTZ G;  3N7N A;  3Q5R A;  1VQ6 P;  1K04 A;  2DW3 A;  5GTI H;  2J59 M;  3V2N A;  1GU5 A;  4WY4 A;  2FAC A;  1LT9 A;  3TYY A;  3RBX A;  2OYH B;  2JQ4 A;  3TDK A;  4ASV A;  1EXJ A;  2N6Z A;  1PP9 E;  2RMZ A;  1DEB A;  2GZE A;  2R3S A;  4R0M A;  1DNY A;  2LPK A;  4OGQ D;  1HBW A; 
#chains in the Genus database with same CATH homology
 1K30 A;  3LRY A;  5BS1 A;  4GR6 A;  4U0B A;  3G26 A;  3CD6 P;  1AUM A;  4XRQ A;  2PEN A;  4COC A;  3G29 A;  1YI2 P;  3DS4 A;  1JJ2 O;  1PEO A;  1VQP P;  4U0C A;  1EIA A;  3G71 P;  3CCM P;  1W2B O;  1QVF O;  1M90 Q;  5F2O A;  2BHV A;  2M8L A;  3M1M A;  2JYG A;  2BUO A;  3G28 A;  4U0E A;  1VQM P;  4U0A A;  1M1K Q;  4XFZ A;  4QNB A;  1YIJ P;  2XXM A;  3CCJ P;  1NJI Q;  2E1M A;  1KD1 Q;  5HGN A;  1RO0 A;  3G1G A;  1VQ4 P;  1VQ7 P;  1YJ9 P;  1KQS O;  2BQ1 E;  3CME P;  2PEJ A;  3CMA P;  3WBH A;  1Q82 Q;  1YIT P;  3E2D A;  4PH0 A;  3DS0 A;  3OW2 O;  3Q20 A;  1M6N A;  1A8O A;  1K9M Q;  2Z45 A;  2ONT A;  5BS2 A;  2LF4 A;  1QVG O;  3DS3 A;  2Z44 A;  2JYL A;  5I4T G;  1PEM A;  2M8P A;  3NTE A;  3G4S P;  4U0D A;  1QRJ A;  2XV6 A;  3CC4 P;  5HGM A;  3P05 A;  1IUQ A;  4XFX A;  4M0I A;  5F2N A;  1RO2 A;  2PEQ A;  1VQN P;  4U0F A;  1VQK P;  2DGY A;  1EOQ A;  5F2K A;  3G6E P;  2OAR A;  3G1I A;  1ZMB A;  3H47 A;  3RG6 C;  2PEO A;  4COP A;  2Z46 A;  4XFY A;  2EFJ A;  2JO0 A;  1VQ5 P;  2QEX P;  1KC8 Q;  5HGO A;  2PY8 A;  1PEQ A;  5DCK A;  2M8N A;  3G0V A;  1Q86 Q;  3CXC O;  1VQL P;  5HGL A;  3H0D A;  1A43 A;  1VQ6 P;  1D1D A;  3CCU P;  1BAJ A;  3HZQ A;  3CCL P;  3DS1 A;  3CCE P;  3I55 P;  3DS2 A;  3CCR P;  3CC7 P;  1YJW P;  3DTJ A;  1RNI A;  3I56 P;  4WYM A;  2EIA A;  2XT1 A;  3B5I A;  1E6J P;  1Q81 Q;  2QA4 P;  2EG5 A;  2L6E A;  1YJN P;  2OTJ P;  1Q7Y Q;  1VQO P;  4XRO A;  3DPH A;  3H4E A;  4GR2 A;  3CCQ P;  5JPA A;  2P9X A;  3CC2 P;  1VQ9 P;  3VRL C;  3DS5 A;  1N8R Q;  3CCV P;  1PEU A;  3HYB A;  1M74 A;  1VQ8 P;  3CPW O;  2PEK A;  3G21 A;  2PEM A;  2KOD A;  2CWO A;  1K73 Q;  3MGE A;  1YHQ P;  2OTL P;  1M6E X;  2PEI A;  1K8A Q;  4PH1 A;  3CCS P;  4IPY A;  1S72 P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...