1M1KQ

Co-crystal structure of azithromycin bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAKGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title The structures of four macrolide antibiotics bound to the large ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 48
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2002-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1m1kQ02
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1m1kQ01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1m1kQ03
2QEXP 3CCRP 1YJNP 3CD6P 3CCVP 3CCUP 3CCSP 1YJ9P 1Q86Q 1YIJP 1K73Q 1KQSO 3G4SP 1YHQP 1YI2P 1Q81Q 1KD1Q 1VQLP 3CC4P 1VQ8P 1M1KQ 1K9MQ 1KC8Q 1VQOP 1VQ4P 3OW2O 3I56P 3G71P 1S72P 2OTLP 1W2BO 3CPWO 1VQPP 1Q7YQ 1M90Q 1VQNP 3G6EP 1JJ2O 1QVGO 3CCQP 1VQ9P 1VQKP 1VQMP 1YITP 1Q82Q 1VQ7P 1QVFO 1VQ6P 3CC2P 1N8RQ 3CMAP 3CCEP 1YJWP 3CCLP 3CMEP 3CC7P 3I55P 3CCJP 3CXCO 1VQ5P 1K8AQ 1NJIQ 3CCMP 2QA4P 2OTJP
chains in the Genus database with same CATH superfamily
1YJNP 1NH4A 3CI9A 4PJ0E 2WSCJ 1SLQA 3WUTA 1NKZB 1SQQD 1QX8A 3A3YB 1JEKA 1NTMD 2K5XA 3HUSA 1A02J 1MUUA 4H2YC 2P7JA 2Y9YA 4YXWH 3SWKA 2WSFH 3A0HH 3TK1A 2ZXXA 4HJGH 1GXGA 2GZJA 1YJ9P 1FAVA 3G26A 1CI6A 1T8ZA 1LTTC 1RE4A 2WSEH 1FZAA 3N7NA 1FZCC 4C7RA 3NY7B 1HY8A 1VQKP 1KILA 4NEOA 1VKUA 2KOQA 5EW5E 2VLPA 1IFDA 4XFZA 1JTHA 2KI7B 2A45G 3CWBG 3IN6A 1G2CA 2FFDA 3CWBE 3GJNA 2DGYA 1NKNA 2WT7B 2YKQA 4WB4A 2KODA 3DS3A 3P8MC 3H32A 5M1BA 2FVEA 1Y47A 3AE7C 1OIPA 3TGUJ 3H1JG 3BATA 5KLVJ 4DT0A 2D2CD 3H1JE 1EZVE 1NYHA 2ERHA 1HF9A 1LT9A 5EJDA 1AA0A 4WWIA 2WPTA 2VLQA 1MKMA 4IPYA 2WPVB 1IMQA 2QJYC 1QEXA 2PY8A 3C8VA 1URQC 2EG5A 3M0DA 2J58A 4H13D 1M74A 2N5IA 2LMLA 3GHGA 1W2EA 1WT6A 3O8ZA 1Z56A 4HKGA 3MIWA 4W7ZA 1W5CE 1X0TA 3H1LG 1M57D 5CCGC 5HV8A 4PV1D 1J1EC 4WY4B 3HZQA 3AECC 2GUSA 1AVYA 1IK9A 1VQNP 1GTWA 5KTBA 4D6TD 1SQXK 3L70J 3E1RA 2OYHB 1IFIA 2FYUE 1FDMA 1LT1A 2KSJA 1RH5B 2MVVA 4H13B 2JYLA 2WMMA 3B5IA 3MUDC 2Y9ZA 2OYIA 3Q2YA 2KS1B 1JY2O 4KT0J 3PTZA 1KQFB 2E5YA 1T8KA 3V4QA 2GDXA 4LGDE 1ZRTD 3CL3D 5AW5B 1L2PA 5CHXA 2NRGA 3S1KA 4IFDK 2KLUA 3MGEA 2AVAA 1U57A 3LW5H 2K0DX 4U0FA 2FKWB 5KKZC 3EFFK 1VQ6P 4HB1A 2HR3A 1DD4A 4IL6H 2O1KA 4BPFA 1VPCA 3TNUB 3BASA 3H1KD 1YTZT 1L0LD 2FVFA 2WPSA 3L72J 2LKMA 2HODA 1SQBK 1KV4A 4L75A 1FOSE 2J59M 1K8AQ 3H1ID 4BRYA 1LTAC 3H1HD 1SQVJ 1ZLLA 1RQVA 3G9RA 1VQLP 2A06D 1U7MA 1FZCB 5B66H 4UHPB 1WRGA 2ZYAA 1NTKK 1H0TA 1E5WA 4F37A 4H2XC 3CCLP 4PD4I 1FZGA 1Q2NA 1JB0J 4XFYA 2KOOA 2GZEA 2FVAA 2OARA 2ZVOB 4U3FD 3Q1MA 1VQ4P 2O01J 3AEFC 1FOSF 1FDIA 2CG5B 5KLIC 3HTKA 3NXSA 3V2QA 3GZLA 2KSEA 2XZ0D 4Y99C 4JYCA 3DS0A 2WQYC 3RL0D 4JQ0D 1HWTC 2L4BA 3MTUE 4JYBA 4OH8B 2W83C 1GW3A 2Z45A 5F2NA 3Q3DA 2OQQA 3M06A 4GT1A 1JY3N 2NO8A 2BEQD 1G1JA 5TJHA 4DZOA 2Z5IA 1N73A 2GUVA 1SQBD 2QJYB 1KC8Q 1LTIC 1URQB 2XU6A 3AE5C 3HUSC 1JCCA 1S2EA 1WMKA 2I1KA 1SFCD 2KLVA 1JUNA 1FR2A 1QL1A 3H1JJ 2M8PA 4IFMA 4GKGA 1RF1A 3CCMP 2GZIA 2OTJP 2YXRB 1T6AA 4JPZB 2KWLA 1BAJA 4WYMA 1J1EB 3DS5A 1RE4C 2Z44A 5BS1A 1CZQA 1NAYA 1NTKD 4C46A 3RK3C 1UNKA 3U59A 2M8NA 1KILC 2YIUC 1A02F 2IBZG 1LWUA 2EFJA 2IBZE 2K93A 1KYOD 5EFWB 3HE5A 2M5AB 5I4TG 2FFDC 2NZ2A 1PZQA 3VTPC 3D6ZA 1PGQA 1X3OA 4ZMDA 1L4AD 5KLVG 1BSHA 2AFEA 5KLVE 2KG6A 1P84E 3EQ2A 1YITP 1YQ4C 4NPDA 3H1LJ 1NTZD 1OW7A 1UJZA 4GDOA 1NU1K 4QKOA 1ACPA 1M7LA 2KB7P 4NPEA 1SQQG 2WTYA 3L71D 4WVZA 1SFCA 4GOEA 4A7PA 2H88C 2YO3A 2QNWA 1S72P 2OTLP 1T3UA 1R5LA 3L4FA 2PEQA 5H2FH 5APUA 4EOTA 2E74D 3VYIA 1LT9C 5KKZB 2QSIA 3K5BA 1HGZA 2K9JB 5KAIH 3A5TA 2JU2A 2KNCA 4K3AA 1DV5A 5B5EH 3M0DC 2W8ZA 1SQPJ 2JB0A 5K5GB 3LRYA 3B5ND 3JSVC 4U0DA 2XV6A 1LP1A 3GHGC 1HVVA 1OX3A 3AEAC 3RGUA 1R5SA 4XFJA 1L4AA 3S9OA 2E75C 3L70G 3C1LA 3L70E 2B87A 3KZIE 4C7NB 3H25A 2HFED 4GR2A 2A45I 2HPCA 2ZVNB 1RO2A 2JJLA 3CC2P 1DIPA 1NTMK 2D2CC 5TISH 3NFQA 2OYIC 2KGCA 1E6JP 1X8YA 2W6BA 3NMDA 1NU1D 1FDOA 5KLIB 5KP8B 2Q3EA 1IFMA 2AXTH 2G8YA 4Y99B 3B5NA 2YNYA 1MZ9A 1KYOH 2K92A 2N98A 1NGMB 1BGYJ 4R4LA 1X22A 1HJBA 4I6MC 4PV1C 1BCCJ 3DS1A 1VQ5P 3L72E 4UB8H 2MY5A 2R44A 1S4XA 2WSFJ 1HGVA 1IC2A 3CLQA 2QG4A 3HUSB 3WU2E 2DNWA 2B88A 3U1AA 1E79H 3CXHE 1IO4A 1JOCA 2P2UA 1CI6B 5DJUB 4AQRD 1AYIA 3L74J 1LTJA 3M91A 3RK3B 5AW4B 2BCCD 1KILB 2YIUB 3PLNA 7CEIA 3VMZA 5KAFH 1JTHB 2YKOA 5GTHH 3KPEA 3CCUP 1MZ8A 3OJAB 2ZAEB 1KD1Q 1G2CB 3WUVA 3GKLC 1VF5D 2FFDB 2BUOA 3D71A 4Y28J 5AVWB 1JMMA 2H89C 3M9QA 4ZKUA 3L75D 4PD4D 1EXIA 3H32B 4XE5B 1L0ND 2H7HA 4DG9A 3G1GA 3LIDA 2V7QJ 4N6JA 3P8CE 1VQOP 1M6NA 1KFNA 3IAOA 4UB6E 1DNYA 3IFMA 2E75D 1S1CX 2Y0EA 3USSA 3VMYA 1LT9B 1KB9E 3CX5I 1EMVA 3WMM0 3V2PA 4OGQD 5CCHD 2WSCH 2LPKA 1DX7A 1D1DA 4GR6A 1SQXG 1N73C 4M0IA 3CC4P 3FWNA 1SQXE 4IZ6A 1Q7YQ 5BVZA 3VN0A 1USDA 3HD7D 3GHGB 1SQQJ 5APWA 2P67A 4IOIH 1RF1C 1ZXGA 3E7KA 2QIWA 2LOLA 2PGDA 2KP8A 3A0BE 1GU4A 3PHLA 1VL2A 4RO0A 3I56P 2RKLA 5APTA 2XT1A 1SVFA 3G21A 2M8LA 2FHSC 3RL0C 1L0LK 3AE2C 2N5HA 1LWUC 2D2CB 2WWWA 1IZNB 2BQ1E 4MRTC 1PPJD 4U0BA 2ZXEB 2OYIB 2CWOA 1S3JA 3H1LE 2PENA 5CCHA 4ZKPA 2I1JA 4CA3A 5APXA 2E42A 5AVVB 2GYKA 1M56D 3JCUH 1BE3D 3VMXA 3BCCD 1SFCC 1EDLA 1D7MA 3HD7A 2L6EA 1J2JB 1S5LH 5TISE 2K0YA 2JO0A 2E43A 3CE7A 1ZNVA 3Q20A 2QVAA 1SQPG 3ZDMA 4PV1B 2WSSH 4PD4H 1SQPE 2GA1A 1FJPA 1TU3F 2JWDA 1KTMA 2ZT9D 3M9BA 1OW6A 1IFNA 1RE3A 3S4RA 4L73A 5AVYB 3MGNA 2HODB 1AV1A 2V4HA 3EJEA 2PFXA 2VLOA 4RKUJ 2GM4A 1L4AC 3M9HA 4IFFA 5HGNA 3NTNA 2GZGA 4BRYB 2XXMA 2IBZI 3KDPB 4BWNA 3RK2D 4L74A 3Q5SA 3CX5E 1DEBA 1MFTA 2Q3IA 2NPSD 1EDKA 2R32A 1H0TB 4QMAA 1P84I 3L71G 1RHZB 1AQ5A 2PNGA 1NJIQ 3DTJA 5E79H 5GTIE 3U43A 1AUMA 2FYUK 2E74C 1K04A 4D6TJ 3L73G 3H0DA 3CWBD 2E1MA 3PP5A 2IYOA 3G3ZA 3L73E 2UWJE 4IL6X 4W80A 4JF7A 1OFCX 2KGAA 1VQ9P 1OXZA 3HTKB 2EHTA 2MD9A 4N78E 5AW3B 2ZFCA 5CMZA 2LR2A 1BGYG 3CXCO 1AF8A 3AE3C 1N7SD 1BGYE 4I2LC 3B5NC 1LGHB 2KYVA 1BCCG 2AEFA 3H1JD 1DEEG 3RBZA 2N9YB 1BCCE 1EZVD 3GF3A 1NO4A 3DS4A 1KMIZ 3B4QA 2PEIA 1EIAA 3KXDA 3A0HE 1PEUA 1ZW0A 3L37A 1S9KE 2MF4A 5APYA 5AVSB 2QE7H 1NTZK 1OWAA 1N73B 2NPSA 4ASVA 3W68A 4GODA 1OR5A 2FXOA 2IYPA 2BHVA 1VQPP 1L0HA 2K9YA 2IFMA 3L74G 3VRLC 1FC2C 3H1KJ 3L74E 1IFJA 1RF1B 1Q86Q 1NHLA 1U7JA 1KQSO 1HTLC 3TYYA 2N50A 1LTJC 4PJ0H 3H1IJ 1KQLA 1N7SA 1JM0A 1IFPA 3M0AA 4ZNCA 1QGKB 2JQ4A 1AQTA 1LTBC 1R8EA 3RL0B 3W67A 1GPJA 2FYUD 3I55P 1PGOA 1LWUB 1SQXJ 2VSQA 1AVOA 2LIUA 3HE5B 3TSIA 4LC1A 3O6QA 3PH0A 3UIAA 2POHA 5F2KA 4U3FJ 3D6YA 3RK3E 2P58A 3F89A 2MKVA 2QRXA 2K37A 1KILE 3HE4A 4I7ZC 5AW1B 1SFCB 3G29A 1BSNA 5AW6B 2A45H 3B8EB 5APSA 2I8DA 4CPGA 5BS2A 2LXBA 1Z6MA 3ABVC 3CCJP 3CXHI 1PL5A 4R4MA 1OW8A 1DH3A 3H47A 1JNMA 2KGDA 5KP7B 2KNCB 1M6EX 2JWAA 1LTGC 1NTMG 1SQQE 1NTME 2BCCG 2BEZF 1XTCC 2BCCE 2K0XA 1RQUA 1JY3O 2N1TD 1LP1B 1SQBJ 4M3LA 1VF5C 1UIXA 4B86A 3EJBA 5AVQB 2JKVA 1L4AB 2PAJA 2MR7A 3SWFA 2H43A 2B87B 3L75G 5KJ7C 2HPCB 3FWLA 2MJZA 3FGAD 2MR8A 2L9FA 2H8PD 1NTKJ 3TF5A 4YXDC 3PJSK 1FZFA 3CCSP 1SP4A 1K73Q 4COCA 3HYBA 2GZFA 2E74B 2QJKC 1PP9D 1DD3A 4OGQC 5CCHC 3GW6A 2SPZA 3DS2A 2KUBA 4IL6E 1AJYA 2OYOA 3GF7A 1KB9I 3V6IA 1HQBA 2OGUA 1GD2E 3T97A 3B5NB 4H44D 1FZBA 1OVVA 1NTZJ 2N1TA 3HD7C 2FQ1A 4QNBA 2Y0CA 3TDKA 1ZP0C 3L71J 5F2OA 3Q5RA 1VQ7P 2LIWA 4EDFA 2W6AA 3L73J 1QL2A 2JDIH 1L0NK 1GL2D 3E2DA 1JMBA 3RL0g 2M3EA 5B66E 1RE3C 2XDJA 3BRVB 1M90Q 2Q5UA 1OMIA 2WZ7A 4LLHA 1GK4A 1YTZI 2E76C 5AW9B 1GMJA 2PEKA 2P9XA 2KIKA 5DJTB 1USEA 3OW2O 1YQ3C 1F80D 1ZR2A 1LTJB 1OVRA 4JBZA 2Q9IA 4HYTB 4D6TG 4O9BA 2WSEJ 3G0VA 1QVFO 2BASA 4D6TE 5AVXB 4BPGA 4WBAA 5HGMA 1T3JA 3MP7B 1K05A 2FYNC 1PIXA 2ONTA 2CQ8A 4PXHB 2EIAA 5HGLA 1RO0A 2C9LY 2AEJA 3TGUD 2JAZA 5KLVD 1QVGO 1GXHA 1ZRTE 1P84D 3LIEA 1H8AA 5AVTB 3MZWB 1GL2A 2ZT9C 3NTEA 3OAKA 4BXLA 1NU1J 2FYZA 1T2KC 2LXCB 4I7ZB 1L0IA 2C9NY 2FXMA 1GZLA 1OZHA 5HVCA 1GK6A 3JC22 4W7YA 1YBKA 5KJ7D 3RK2C 2IPPA 3H1KG 4COPA 1L0LG 4EYYQ 1KYOI 2NPSC 3H1KE 2FACA 2K94A 1EOQA 1L0LE 2L5GB 3QH9A 1EC5A 2E5TA 4R0MA 2GDYA 2PEOA 1FS0E 3H1IG 2Q6QA 1ZV8A 3H1HG 3CC7P 1VF5B 4NPFX 3H1IE 1SQVK 1PGJA 2IX7C 3N4XA 1VHNA 3H1HE 5BU5A 3CCVP 2A06G 3G1IA 3AE1C 1BDCA 2A06E 3L70D 2QJPC 1N7LA 2FQ2A 3G71P 3IR9A 3GG2A 2CGQA 5HGOA 3I5CA 3VMAA 5BU8B 1N7SC 1JY2N 2JYGA 2N6ZA 3FX0A 1A43A 2MVUA 1RNIA 1NTMJ 3R2PA 3WUUA 4U0CA 1A8OA 4U3FG 1EZVG 2E75B 1CSBA 2BCCJ 4RESB 2KW2A 5DCKA 4U3FE 4BPHA 2WT7A 5H2FE 2QJKB 1X79B 2KZIA 5CBNA 2FADA 5KJ7A 4OGQB 2WPRA 3RG6C 2ZYGA 2V7QH 4WY4D 1KN7A 5KAIE 3CCEP 2PEJA 1IJDB 5B5EE 3L75J 2PRRA 1YHQP 1Q81Q 1JO5A 2G3AA 2O3JA 2KOSA 1L0NJ 4GOFA 3HD7B 3AEEC 1GW4A 2E76D 3B71A 3WBHA 2CPSA 3ITKA 2FY8A 1YJWP 1M1JC 4PWVB 1P84H 3LW5J 2YO2A 3F5HA 2QA4P 3EFGA 3G28A 2QEXP 3L72D 5AW8B 2X2BA 2XKMA 1SQBG 1HBWA 3BVHA 1SQBE 1PEMA 5C39A 1MV8A 4KHXA 2FYUG 1FBMA 1SQVD 1EDIA 5KP6B 1FJKA 4U0EA 2R5BA 3CXHD 4PH1A 2L91A 1QLED 1PEOA 2JGPA 2M0BA 2YXQB 5AW7B 2JO1A 3AE6C 1ZN5A 2E76B 2IZ1A 3E1IA 1NTKG 3AEGC 4XRQA 1RF0A 4WY4A 1NTKE 2KG9A 1NOHA 2CPBA 2RN0A 1JJ2O 1T2KD 1Q82Q 2OYHA 2AXTE 3VP8A 1CW5A 2WVRA 1FZEA 1S5LX 1HH0A 2IZ0A 1IMPA 2FYNB 1KYOE 2KS1A 2RMZA 2KOGA 1M1KQ 1CEIA 3MHVA 1UIIA 3KZIH 1NTZG 2VLNA 1BDDA 1NTZE 3BRTB 4UB8E 2DW3A 3CMAP 2ZT9B 1E0HA 3L71E 3GLMA 1NWQA 1X9VA 3AEBC 2ZYDA 2N6YA 2N1TC 2QM7A 3P8CD 2VRSA 1PFIA 2XNXA 4XA4A 2K3RA 1KLPA 1BE3J 3EJDA 1FU1A 1NAFA 3BCCJ 1KB9D 3L36A 3L35A 4Z1MH 3RK2B 3CCRP 3RG2A 2EHSA 3TNUA 1KZUB 1SQPK 2HLOA 4H2WC 2NPSB 1SQXD 1RY3A 1GDTA 1LTSC 5CJ0A 2W90A 1ZMEC 1VQMP 5L8RJ 4L76A 5KAFE 5GTHE 1NVOA 3CMEP 5CBOA 2KG8A 2R3CA 4H0LC 2FXPA 1PP9G 3IF4A 2IFNA 1PP9E 1JY2P 2QJPB 1FZCA 3V4WA 4DOJA 1KORA 2PP6A 1N7SB 1URQD 4H44C 2L22A 1PV3A 3WU2H 3P05A 2K2QA 3CXHH 1L0LJ 5CZDB 2LF4A 1J1DC 3G4SP 3P7KA 1G1IA 3H1LD 3Q5PA 5AVRB 1NU1G 5CCGD 1OVUA 2OTKE 2B9BA 3H1HJ 1NU1E 3O6QB 2R5DA 3CWBJ 1GL2C 2IDBA 2KK7A 1VDFA 1ZMBA 1ZR4A 2C0WA 1FE6A 5APVA 2O01H 2M8RA 3HE4B 2FBWC 2QM8A 1EQ7A 2GDWA 2P10A 1H89A 3RBXA 3FXEA 2Q7CA 2ROQA 3KYQA 2KZJA 4K35A 1M1JB 1SQPD 4HKZH 1M8OB 1BXIA 3R4YA 2R3SA 3V2RA 1VQ8P 1HJ0A 1URQA 2P1JA 2FAEA 1W2BO 3GMAA 2Z4EA 3A2AA 3KQGA 3CCQP 4UB6H 3V2NA 3VOPA 4GIFA 4I1LA 1KFMA 2YKPA 2O1JA 1M1JA 1KB9H 4YPCA 2XZRA 5CCGA 2KXPB 2YMYA 3TGUG 3H6PA 4PH0A 3TGUE 2AEMA 4AUWA 5AVZB 3AE9C 2YMKA 4EI2A 3CX5D 3A7OA 2K1AA 3JCUE 4DCKA 2FQ0A 1Q90D 4YTPC 3VP9A 3CD6P 2M5AA 3MUDA 1S5LE 2PEMA 2L0QA 2M5RA 2FYUJ 1Y9BA 3A0BH 3CPWO 3L73D 5AVUB 2HG5D 3V5BA 3L75E 4PD4E 1L0NG 3SFDC 4RJTA 1YYCA 4N78D 1L0NE 3AE4C 2K88A 3PRJA 3SWYA 3DPHA 1BGYD 3T97B 3SSUA 1EXJA 1KQGB 2N1TB 4U7JA 1BCCD 3P32A 5APQA 2WITA 4H0LD 2HYNA 3D70A 3FXDA 2O01N 3B4SA 1S9KD 2K9JA 5KLVK 4KJMA 2LKIA 1K30A 2CNRA 4HH2A 4TLFA 1N86A 2J5UA 2KGEA 2KOPA 3G6EP 2ITAA 3EWKA 1SQQK 2Y0DA 2AXCA 5E79E 2C0XA 4OVNF 3L74D 1Y8AA 3LMOA 1YIJP 4H0LB 2LL8A 1RF0C 4WY4C 1K9MQ 1LNQA 4C7NA 3QWOC 2Z5HA 4DJGA 3H4EA 4EIJA 1PEQA 4N3YB 1EZVI 1ZOYC 3AEDC 4TT3H 1MFZA 4AYCA 2OYHC 3AE8C 4H44B 1EDJA 3KHUA 1PPJG 2Q1KA 4H13C 2JP3A 1SS1A 3HRNA 2Z46A 4OWFA 1PPJE 1J1DB 1YI2P 4ASWA 4XFXA 2JEEA 1QRJA 2CK3H 2W27A 2RH0A 3II6A 2B89A 2KR5A 2ZJSE 3U1CA 2KORA 4XROA 2XNDH 1IK7A 3OA7A 2N9BA 5AW2B 1JY3P 1IUQA 2AF8A 1N8RQ 3L72G 3CX5H 1BE3G 1N2DC 1GL2B 3RK3D 1PP9J 1JCDA 2M3BA 3BCCG 1BE3E 1KILD 3M1MA 2IBZD 1LJ2A 3SFEC 2WPQA 3BCCE 4U0AA 5GTIH 1PGPA 2W6JH 3MD0A 1SQVG 1AFOA 1GU5A 2XV5A 4MN4C 2JBGA 1XTGB 5JPAA 1SQVE 5CJ4A 1HUCA 2JR8A 2LTEA 2XZ1C 3C9IA 5AW0B 3GZMA 2JU1A 1NQ4A 2AFDA 1H88A
chains in the Genus database with same CATH topology
1K30A 2QEXP 3CCRP 3H47A 1YJNP 1D1DA 4IPYA 4COPA 1M6EX 4GR6A 4M0IA 3CC4P 3E2DA 1VQ8P 2PY8A 1PEMA 1KC8Q 2EG5A 1EOQA 1W2BO 2BHVA 1VQPP 1M74A 3LRYA 1Q7YQ 1M90Q 3G6EP 3CCQP 1VQMP 4U0DA 2XV6A 4U0EA 2PEOA 3VRLC 4PH1A 2M8PA 1PEOA 3CMEP 3CC7P 1K8AQ 5HGNA 3CCMP 2OTJP 2PEKA 3CCVP 1YJ9P 2P9XA 3G26A 1Q86Q 1YIJP 3G1IA 1KQSO 2XXMA 1BAJA 4WYMA 4XRQA 1VQLP 3DS5A 1K9MQ 2Z44A 5BS1A 4PH0A 3OW2O 3I56P 3G71P 4GR2A 5HGOA 3H4EA 3HZQA 1PEQA 2XT1A 1RO2A 1VQNP 1JJ2O 3G21A 2M8NA 2M8LA 1VQKP 2JYGA 1Q82Q 3G0VA 1QVFO 3CC2P 1KD1Q 3CCLP 1A43A 3I55P 1RNIA 3P05A 4XFZA 2EFJA 5HGMA 4XFYA 1NJIQ 3DTJA 2BQ1E 3CD6P 1AUMA 2LF4A 4U0CA 3CCSP 3CCUP 1A8OA 2JYLA 2Z46A 3B5IA 1K73Q 4U0BA 2ONTA 3G4SP 5I4TG 1YI2P 4COCA 2CWOA 3HYBA 1QRJA 2OARA 2EIAA 2PEMA 4XFXA 2E1MA 2BUOA 5DCKA 5HGLA 2PENA 3H0DA 1M1KQ 2DGYA 1VQ4P 1E6JP 1RO0A 3CPWO 4XROA 3RG6C 2KODA 3DS2A 1QVGO 1VQ9P 3DS3A 1YITP 1IUQA 5F2KA 1N8RQ 3CMAP 3CCEP 3CXCO 1ZMBA 3G1GA 3NTEA 2PEJA 3M1MA 3DPHA 3DS0A 1YHQP 4U0AA 1Q81Q 3MGEA 3G29A 2L6EA 1VQOP 1M6NA 4QNBA 2OTLP 1S72P 3DS4A 5JPAA 2PEQA 2PEIA 1EIAA 2JO0A 4U0FA 5F2OA 3Q20A 3WBHA 5BS2A 1PEUA 2Z45A 5F2NA 1VQ7P 1VQ6P 1YJWP 3CCJP 3DS1A 1VQ5P 2QA4P 3G28A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QEX P;  3CCR P;  1YJN P;  3CD6 P;  3CCV P;  3CCU P;  3CCS P;  1YJ9 P;  1Q86 Q;  1YIJ P;  1K73 Q;  1KQS O;  3G4S P;  1YHQ P;  1YI2 P;  1Q81 Q;  1KD1 Q;  1VQL P;  3CC4 P;  1VQ8 P;  1M1K Q;  1K9M Q;  1KC8 Q;  1VQO P;  1VQ4 P;  3OW2 O;  3I56 P;  3G71 P;  1S72 P;  2OTL P;  1W2B O;  3CPW O;  1VQP P;  1Q7Y Q;  1M90 Q;  1VQN P;  3G6E P;  1JJ2 O;  1QVG O;  3CCQ P;  1VQ9 P;  1VQK P;  1VQM P;  1YIT P;  1Q82 Q;  1VQ7 P;  1QVF O;  1VQ6 P;  3CC2 P;  1N8R Q;  3CMA P;  3CCE P;  1YJW P;  3CCL P;  3CME P;  3CC7 P;  3I55 P;  3CCJ P;  3CXC O;  1VQ5 P;  1K8A Q;  1NJI Q;  3CCM P;  2QA4 P;  2OTJ P; 
#chains in the Genus database with same CATH topology
 1YJN P;  1NH4 A;  3CI9 A;  4PJ0 E;  2WSC J;  1SLQ A;  3WUT A;  1NKZ B;  1SQQ D;  1QX8 A;  3A3Y B;  1JEK A;  1NTM D;  2K5X A;  3HUS A;  1A02 J;  1MUU A;  4H2Y C;  2P7J A;  2Y9Y A;  4YXW H;  3SWK A;  2WSF H;  3A0H H;  3TK1 A;  2ZXX A;  4HJG H;  1GXG A;  2GZJ A;  1YJ9 P;  1FAV A;  3G26 A;  1CI6 A;  1T8Z A;  1LTT C;  1RE4 A;  2WSE H;  1FZA A;  3N7N A;  1FZC C;  4C7R A;  3NY7 B;  1HY8 A;  1VQK P;  1KIL A;  4NEO A;  1VKU A;  2KOQ A;  5EW5 E;  2VLP A;  1IFD A;  4XFZ A;  1JTH A;  2KI7 B;  2A45 G;  3CWB G;  3IN6 A;  1G2C A;  2FFD A;  3CWB E;  3GJN A;  2DGY A;  1NKN A;  2WT7 B;  2YKQ A;  4WB4 A;  2KOD A;  3DS3 A;  3P8M C;  3H32 A;  5M1B A;  2FVE A;  1Y47 A;  3AE7 C;  1OIP A;  3TGU J;  3H1J G;  3BAT A;  5KLV J;  4DT0 A;  2D2C D;  3H1J E;  1EZV E;  1NYH A;  2ERH A;  1HF9 A;  1LT9 A;  5EJD A;  1AA0 A;  4WWI A;  2WPT A;  2VLQ A;  1MKM A;  4IPY A;  2WPV B;  1IMQ A;  2QJY C;  1QEX A;  2PY8 A;  3C8V A;  1URQ C;  2EG5 A;  3M0D A;  2J58 A;  4H13 D;  1M74 A;  2N5I A;  2LML A;  3GHG A;  1W2E A;  1WT6 A;  3O8Z A;  1Z56 A;  4HKG A;  3MIW A;  4W7Z A;  1W5C E;  1X0T A;  3H1L G;  1M57 D;  5CCG C;  5HV8 A;  4PV1 D;  1J1E C;  4WY4 B;  3HZQ A;  3AEC C;  2GUS A;  1AVY A;  1IK9 A;  1VQN P;  1GTW A;  5KTB A;  4D6T D;  1SQX K;  3L70 J;  3E1R A;  2OYH B;  1IFI A;  2FYU E;  1FDM A;  1LT1 A;  2KSJ A;  1RH5 B;  2MVV A;  4H13 B;  2JYL A;  2WMM A;  3B5I A;  3MUD C;  2Y9Z A;  2OYI A;  3Q2Y A;  2KS1 B;  1JY2 O;  4KT0 J;  3PTZ A;  1KQF B;  2E5Y A;  1T8K A;  3V4Q A;  2GDX A;  4LGD E;  1ZRT D;  3CL3 D;  5AW5 B;  1L2P A;  5CHX A;  2NRG A;  3S1K A;  4IFD K;  2KLU A;  3MGE A;  2AVA A;  1U57 A;  3LW5 H;  2K0D X;  4U0F A;  2FKW B;  5KKZ C;  3EFF K;  1VQ6 P;  4HB1 A;  2HR3 A;  1DD4 A;  4IL6 H;  2O1K A;  4BPF A;  1VPC A;  3TNU B;  3BAS A;  3H1K D;  1YTZ T;  1L0L D;  2FVF A;  2WPS A;  3L72 J;  2LKM A;  2HOD A;  1SQB K;  1KV4 A;  4L75 A;  1FOS E;  2J59 M;  1K8A Q;  3H1I D;  4BRY A;  1LTA C;  3H1H D;  1SQV J;  1ZLL A;  1RQV A;  3G9R A;  1VQL P;  2A06 D;  1U7M A;  1FZC B;  5B66 H;  4UHP B;  1WRG A;  2ZYA A;  1NTK K;  1H0T A;  1E5W A;  4F37 A;  4H2X C;  3CCL P;  4PD4 I;  1FZG A;  1Q2N A;  1JB0 J;  4XFY A;  2KOO A;  2GZE A;  2FVA A;  2OAR A;  2ZVO B;  4U3F D;  3Q1M A;  1VQ4 P;  2O01 J;  3AEF C;  1FOS F;  1FDI A;  2CG5 B;  5KLI C;  3HTK A;  3NXS A;  3V2Q A;  3GZL A;  2KSE A;  2XZ0 D;  4Y99 C;  4JYC A;  3DS0 A;  2WQY C;  3RL0 D;  4JQ0 D;  1HWT C;  2L4B A;  3MTU E;  4JYB A;  4OH8 B;  2W83 C;  1GW3 A;  2Z45 A;  5F2N A;  3Q3D A;  2OQQ A;  3M06 A;  4GT1 A;  1JY3 N;  2NO8 A;  2BEQ D;  1G1J A;  5TJH A;  4DZO A;  2Z5I A;  1N73 A;  2GUV A;  1SQB D;  2QJY B;  1KC8 Q;  1LTI C;  1URQ B;  2XU6 A;  3AE5 C;  3HUS C;  1JCC A;  1S2E A;  1WMK A;  2I1K A;  1SFC D;  2KLV A;  1JUN A;  1FR2 A;  1QL1 A;  3H1J J;  2M8P A;  4IFM A;  4GKG A;  1RF1 A;  3CCM P;  2GZI A;  2OTJ P;  2YXR B;  1T6A A;  4JPZ B;  2KWL A;  1BAJ A;  4WYM A;  1J1E B;  3DS5 A;  1RE4 C;  2Z44 A;  5BS1 A;  1CZQ A;  1NAY A;  1NTK D;  4C46 A;  3RK3 C;  1UNK A;  3U59 A;  2M8N A;  1KIL C;  2YIU C;  1A02 F;  2IBZ G;  1LWU A;  2EFJ A;  2IBZ E;  2K93 A;  1KYO D;  5EFW B;  3HE5 A;  2M5A B;  5I4T G;  2FFD C;  2NZ2 A;  1PZQ A;  3VTP C;  3D6Z A;  1PGQ A;  1X3O A;  4ZMD A;  1L4A D;  5KLV G;  1BSH A;  2AFE A;  5KLV E;  2KG6 A;  1P84 E;  3EQ2 A;  1YIT P;  1YQ4 C;  4NPD A;  3H1L J;  1NTZ D;  1OW7 A;  1UJZ A;  4GDO A;  1NU1 K;  4QKO A;  1ACP A;  1M7L A;  2KB7 P;  4NPE A;  1SQQ G;  2WTY A;  3L71 D;  4WVZ A;  1SFC A;  4GOE A;  4A7P A;  2H88 C;  2YO3 A;  2QNW A;  1S72 P;  2OTL P;  1T3U A;  1R5L A;  3L4F A;  2PEQ A;  5H2F H;  5APU A;  4EOT A;  2E74 D;  3VYI A;  1LT9 C;  5KKZ B;  2QSI A;  3K5B A;  1HGZ A;  2K9J B;  5KAI H;  3A5T A;  2JU2 A;  2KNC A;  4K3A A;  1DV5 A;  5B5E H;  3M0D C;  2W8Z A;  1SQP J;  2JB0 A;  5K5G B;  3LRY A;  3B5N D;  3JSV C;  4U0D A;  2XV6 A;  1LP1 A;  3GHG C;  1HVV A;  1OX3 A;  3AEA C;  3RGU A;  1R5S A;  4XFJ A;  1L4A A;  3S9O A;  2E75 C;  3L70 G;  3C1L A;  3L70 E;  2B87 A;  3KZI E;  4C7N B;  3H25 A;  2HFE D;  4GR2 A;  2A45 I;  2HPC A;  2ZVN B;  1RO2 A;  2JJL A;  3CC2 P;  1DIP A;  1NTM K;  2D2C C;  5TIS H;  3NFQ A;  2OYI C;  2KGC A;  1E6J P;  1X8Y A;  2W6B A;  3NMD A;  1NU1 D;  1FDO A;  5KLI B;  5KP8 B;  2Q3E A;  1IFM A;  2AXT H;  2G8Y A;  4Y99 B;  3B5N A;  2YNY A;  1MZ9 A;  1KYO H;  2K92 A;  2N98 A;  1NGM B;  1BGY J;  4R4L A;  1X22 A;  1HJB A;  4I6M C;  4PV1 C;  1BCC J;  3DS1 A;  1VQ5 P;  3L72 E;  4UB8 H;  2MY5 A;  2R44 A;  1S4X A;  2WSF J;  1HGV A;  1IC2 A;  3CLQ A;  2QG4 A;  3HUS B;  3WU2 E;  2DNW A;  2B88 A;  3U1A A;  1E79 H;  3CXH E;  1IO4 A;  1JOC A;  2P2U A;  1CI6 B;  5DJU B;  4AQR D;  1AYI A;  3L74 J;  1LTJ A;  3M91 A;  3RK3 B;  5AW4 B;  2BCC D;  1KIL B;  2YIU B;  3PLN A;  7CEI A;  3VMZ A;  5KAF H;  1JTH B;  2YKO A;  5GTH H;  3KPE A;  3CCU P;  1MZ8 A;  3OJA B;  2ZAE B;  1KD1 Q;  1G2C B;  3WUV A;  3GKL C;  1VF5 D;  2FFD B;  2BUO A;  3D71 A;  4Y28 J;  5AVW B;  1JMM A;  2H89 C;  3M9Q A;  4ZKU A;  3L75 D;  4PD4 D;  1EXI A;  3H32 B;  4XE5 B;  1L0N D;  2H7H A;  4DG9 A;  3G1G A;  3LID A;  2V7Q J;  4N6J A;  3P8C E;  1VQO P;  1M6N A;  1KFN A;  3IAO A;  4UB6 E;  1DNY A;  3IFM A;  2E75 D;  1S1C X;  2Y0E A;  3USS A;  3VMY A;  1LT9 B;  1KB9 E;  3CX5 I;  1EMV A;  3WMM 0;  3V2P A;  4OGQ D;  5CCH D;  2WSC H;  2LPK A;  1DX7 A;  1D1D A;  4GR6 A;  1SQX G;  1N73 C;  4M0I A;  3CC4 P;  3FWN A;  1SQX E;  4IZ6 A;  1Q7Y Q;  5BVZ A;  3VN0 A;  1USD A;  3HD7 D;  3GHG B;  1SQQ J;  5APW A;  2P67 A;  4IOI H;  1RF1 C;  1ZXG A;  3E7K A;  2QIW A;  2LOL A;  2PGD A;  2KP8 A;  3A0B E;  1GU4 A;  3PHL A;  1VL2 A;  4RO0 A;  3I56 P;  2RKL A;  5APT A;  2XT1 A;  1SVF A;  3G21 A;  2M8L A;  2FHS C;  3RL0 C;  1L0L K;  3AE2 C;  2N5H A;  1LWU C;  2D2C B;  2WWW A;  1IZN B;  2BQ1 E;  4MRT C;  1PPJ D;  4U0B A;  2ZXE B;  2OYI B;  2CWO A;  1S3J A;  3H1L E;  2PEN A;  5CCH A;  4ZKP A;  2I1J A;  4CA3 A;  5APX A;  2E42 A;  5AVV B;  2GYK A;  1M56 D;  3JCU H;  1BE3 D;  3VMX A;  3BCC D;  1SFC C;  1EDL A;  1D7M A;  3HD7 A;  2L6E A;  1J2J B;  1S5L H;  5TIS E;  2K0Y A;  2JO0 A;  2E43 A;  3CE7 A;  1ZNV A;  3Q20 A;  2QVA A;  1SQP G;  3ZDM A;  4PV1 B;  2WSS H;  4PD4 H;  1SQP E;  2GA1 A;  1FJP A;  1TU3 F;  2JWD A;  1KTM A;  2ZT9 D;  3M9B A;  1OW6 A;  1IFN A;  1RE3 A;  3S4R A;  4L73 A;  5AVY B;  3MGN A;  2HOD B;  1AV1 A;  2V4H A;  3EJE A;  2PFX A;  2VLO A;  4RKU J;  2GM4 A;  1L4A C;  3M9H A;  4IFF A;  5HGN A;  3NTN A;  2GZG A;  4BRY B;  2XXM A;  2IBZ I;  3KDP B;  4BWN A;  3RK2 D;  4L74 A;  3Q5S A;  3CX5 E;  1DEB A;  1MFT A;  2Q3I A;  2NPS D;  1EDK A;  2R32 A;  1H0T B;  4QMA A;  1P84 I;  3L71 G;  1RHZ B;  1AQ5 A;  2PNG A;  1NJI Q;  3DTJ A;  5E79 H;  5GTI E;  3U43 A;  1AUM A;  2FYU K;  2E74 C;  1K04 A;  4D6T J;  3L73 G;  3H0D A;  3CWB D;  2E1M A;  3PP5 A;  2IYO A;  3G3Z A;  3L73 E;  2UWJ E;  4IL6 X;  4W80 A;  4JF7 A;  1OFC X;  2KGA A;  1VQ9 P;  1OXZ A;  3HTK B;  2EHT A;  2MD9 A;  4N78 E;  5AW3 B;  2ZFC A;  5CMZ A;  2LR2 A;  1BGY G;  3CXC O;  1AF8 A;  3AE3 C;  1N7S D;  1BGY E;  4I2L C;  3B5N C;  1LGH B;  2KYV A;  1BCC G;  2AEF A;  3H1J D;  1DEE G;  3RBZ A;  2N9Y B;  1BCC E;  1EZV D;  3GF3 A;  1NO4 A;  3DS4 A;  1KMI Z;  3B4Q A;  2PEI A;  1EIA A;  3KXD A;  3A0H E;  1PEU A;  1ZW0 A;  3L37 A;  1S9K E;  2MF4 A;  5APY A;  5AVS B;  2QE7 H;  1NTZ K;  1OWA A;  1N73 B;  2NPS A;  4ASV A;  3W68 A;  4GOD A;  1OR5 A;  2FXO A;  2IYP A;  2BHV A;  1VQP P;  1L0H A;  2K9Y A;  2IFM A;  3L74 G;  3VRL C;  1FC2 C;  3H1K J;  3L74 E;  1IFJ A;  1RF1 B;  1Q86 Q;  1NHL A;  1U7J A;  1KQS O;  1HTL C;  3TYY A;  2N50 A;  1LTJ C;  4PJ0 H;  3H1I J;  1KQL A;  1N7S A;  1JM0 A;  1IFP A;  3M0A A;  4ZNC A;  1QGK B;  2JQ4 A;  1AQT A;  1LTB C;  1R8E A;  3RL0 B;  3W67 A;  1GPJ A;  2FYU D;  3I55 P;  1PGO A;  1LWU B;  1SQX J;  2VSQ A;  1AVO A;  2LIU A;  3HE5 B;  3TSI A;  4LC1 A;  3O6Q A;  3PH0 A;  3UIA A;  2POH A;  5F2K A;  4U3F J;  3D6Y A;  3RK3 E;  2P58 A;  3F89 A;  2MKV A;  2QRX A;  2K37 A;  1KIL E;  3HE4 A;  4I7Z C;  5AW1 B;  1SFC B;  3G29 A;  1BSN A;  5AW6 B;  2A45 H;  3B8E B;  5APS A;  2I8D A;  4CPG A;  5BS2 A;  2LXB A;  1Z6M A;  3ABV C;  3CCJ P;  3CXH I;  1PL5 A;  4R4M A;  1OW8 A;  1DH3 A;  3H47 A;  1JNM A;  2KGD A;  5KP7 B;  2KNC B;  1M6E X;  2JWA A;  1LTG C;  1NTM G;  1SQQ E;  1NTM E;  2BCC G;  2BEZ F;  1XTC C;  2BCC E;  2K0X A;  1RQU A;  1JY3 O;  2N1T D;  1LP1 B;  1SQB J;  4M3L A;  1VF5 C;  1UIX A;  4B86 A;  3EJB A;  5AVQ B;  2JKV A;  1L4A B;  2PAJ A;  2MR7 A;  3SWF A;  2H43 A;  2B87 B;  3L75 G;  5KJ7 C;  2HPC B;  3FWL A;  2MJZ A;  3FGA D;  2MR8 A;  2L9F A;  2H8P D;  1NTK J;  3TF5 A;  4YXD C;  3PJS K;  1FZF A;  3CCS P;  1SP4 A;  1K73 Q;  4COC A;  3HYB A;  2GZF A;  2E74 B;  2QJK C;  1PP9 D;  1DD3 A;  4OGQ C;  5CCH C;  3GW6 A;  2SPZ A;  3DS2 A;  2KUB A;  4IL6 E;  1AJY A;  2OYO A;  3GF7 A;  1KB9 I;  3V6I A;  1HQB A;  2OGU A;  1GD2 E;  3T97 A;  3B5N B;  4H44 D;  1FZB A;  1OVV A;  1NTZ J;  2N1T A;  3HD7 C;  2FQ1 A;  4QNB A;  2Y0C A;  3TDK A;  1ZP0 C;  3L71 J;  5F2O A;  3Q5R A;  1VQ7 P;  2LIW A;  4EDF A;  2W6A A;  3L73 J;  1QL2 A;  2JDI H;  1L0N K;  1GL2 D;  3E2D A;  1JMB A;  3RL0 g;  2M3E A;  5B66 E;  1RE3 C;  2XDJ A;  3BRV B;  1M90 Q;  2Q5U A;  1OMI A;  2WZ7 A;  4LLH A;  1GK4 A;  1YTZ I;  2E76 C;  5AW9 B;  1GMJ A;  2PEK A;  2P9X A;  2KIK A;  5DJT B;  1USE A;  3OW2 O;  1YQ3 C;  1F80 D;  1ZR2 A;  1LTJ B;  1OVR A;  4JBZ A;  2Q9I A;  4HYT B;  4D6T G;  4O9B A;  2WSE J;  3G0V A;  1QVF O;  2BAS A;  4D6T E;  5AVX B;  4BPG A;  4WBA A;  5HGM A;  1T3J A;  3MP7 B;  1K05 A;  2FYN C;  1PIX A;  2ONT A;  2CQ8 A;  4PXH B;  2EIA A;  5HGL A;  1RO0 A;  2C9L Y;  2AEJ A;  3TGU D;  2JAZ A;  5KLV D;  1QVG O;  1GXH A;  1ZRT E;  1P84 D;  3LIE A;  1H8A A;  5AVT B;  3MZW B;  1GL2 A;  2ZT9 C;  3NTE A;  3OAK A;  4BXL A;  1NU1 J;  2FYZ A;  1T2K C;  2LXC B;  4I7Z B;  1L0I A;  2C9N Y;  2FXM A;  1GZL A;  1OZH A;  5HVC A;  1GK6 A;  3JC2 2;  4W7Y A;  1YBK A;  5KJ7 D;  3RK2 C;  2IPP A;  3H1K G;  4COP A;  1L0L G;  4EYY Q;  1KYO I;  2NPS C;  3H1K E;  2FAC A;  2K94 A;  1EOQ A;  1L0L E;  2L5G B;  3QH9 A;  1EC5 A;  2E5T A;  4R0M A;  2GDY A;  2PEO A;  1FS0 E;  3H1I G;  2Q6Q A;  1ZV8 A;  3H1H G;  3CC7 P;  1VF5 B;  4NPF X;  3H1I E;  1SQV K;  1PGJ A;  2IX7 C;  3N4X A;  1VHN A;  3H1H E;  5BU5 A;  3CCV P;  2A06 G;  3G1I A;  3AE1 C;  1BDC A;  2A06 E;  3L70 D;  2QJP C;  1N7L A;  2FQ2 A;  3G71 P;  3IR9 A;  3GG2 A;  2CGQ A;  5HGO A;  3I5C A;  3VMA A;  5BU8 B;  1N7S C;  1JY2 N;  2JYG A;  2N6Z A;  3FX0 A;  1A43 A;  2MVU A;  1RNI A;  1NTM J;  3R2P A;  3WUU A;  4U0C A;  1A8O A;  4U3F G;  1EZV G;  2E75 B;  1CSB A;  2BCC J;  4RES B;  2KW2 A;  5DCK A;  4U3F E;  4BPH A;  2WT7 A;  5H2F E;  2QJK B;  1X79 B;  2KZI A;  5CBN A;  2FAD A;  5KJ7 A;  4OGQ B;  2WPR A;  3RG6 C;  2ZYG A;  2V7Q H;  4WY4 D;  1KN7 A;  5KAI E;  3CCE P;  2PEJ A;  1IJD B;  5B5E E;  3L75 J;  2PRR A;  1YHQ P;  1Q81 Q;  1JO5 A;  2G3A A;  2O3J A;  2KOS A;  1L0N J;  4GOF A;  3HD7 B;  3AEE C;  1GW4 A;  2E76 D;  3B71 A;  3WBH A;  2CPS A;  3ITK A;  2FY8 A;  1YJW P;  1M1J C;  4PWV B;  1P84 H;  3LW5 J;  2YO2 A;  3F5H A;  2QA4 P;  3EFG A;  3G28 A;  2QEX P;  3L72 D;  5AW8 B;  2X2B A;  2XKM A;  1SQB G;  1HBW A;  3BVH A;  1SQB E;  1PEM A;  5C39 A;  1MV8 A;  4KHX A;  2FYU G;  1FBM A;  1SQV D;  1EDI A;  5KP6 B;  1FJK A;  4U0E A;  2R5B A;  3CXH D;  4PH1 A;  2L91 A;  1QLE D;  1PEO A;  2JGP A;  2M0B A;  2YXQ B;  5AW7 B;  2JO1 A;  3AE6 C;  1ZN5 A;  2E76 B;  2IZ1 A;  3E1I A;  1NTK G;  3AEG C;  4XRQ A;  1RF0 A;  4WY4 A;  1NTK E;  2KG9 A;  1NOH A;  2CPB A;  2RN0 A;  1JJ2 O;  1T2K D;  1Q82 Q;  2OYH A;  2AXT E;  3VP8 A;  1CW5 A;  2WVR A;  1FZE A;  1S5L X;  1HH0 A;  2IZ0 A;  1IMP A;  2FYN B;  1KYO E;  2KS1 A;  2RMZ A;  2KOG A;  1M1K Q;  1CEI A;  3MHV A;  1UII A;  3KZI H;  1NTZ G;  2VLN A;  1BDD A;  1NTZ E;  3BRT B;  4UB8 E;  2DW3 A;  3CMA P;  2ZT9 B;  1E0H A;  3L71 E;  3GLM A;  1NWQ A;  1X9V A;  3AEB C;  2ZYD A;  2N6Y A;  2N1T C;  2QM7 A;  3P8C D;  2VRS A;  1PFI A;  2XNX A;  4XA4 A;  2K3R A;  1KLP A;  1BE3 J;  3EJD A;  1FU1 A;  1NAF A;  3BCC J;  1KB9 D;  3L36 A;  3L35 A;  4Z1M H;  3RK2 B;  3CCR P;  3RG2 A;  2EHS A;  3TNU A;  1KZU B;  1SQP K;  2HLO A;  4H2W C;  2NPS B;  1SQX D;  1RY3 A;  1GDT A;  1LTS C;  5CJ0 A;  2W90 A;  1ZME C;  1VQM P;  5L8R J;  4L76 A;  5KAF E;  5GTH E;  1NVO A;  3CME P;  5CBO A;  2KG8 A;  2R3C A;  4H0L C;  2FXP A;  1PP9 G;  3IF4 A;  2IFN A;  1PP9 E;  1JY2 P;  2QJP B;  1FZC A;  3V4W A;  4DOJ A;  1KOR A;  2PP6 A;  1N7S B;  1URQ D;  4H44 C;  2L22 A;  1PV3 A;  3WU2 H;  3P05 A;  2K2Q A;  3CXH H;  1L0L J;  5CZD B;  2LF4 A;  1J1D C;  3G4S P;  3P7K A;  1G1I A;  3H1L D;  3Q5P A;  5AVR B;  1NU1 G;  5CCG D;  1OVU A;  2OTK E;  2B9B A;  3H1H J;  1NU1 E;  3O6Q B;  2R5D A;  3CWB J;  1GL2 C;  2IDB A;  2KK7 A;  1VDF A;  1ZMB A;  1ZR4 A;  2C0W A;  1FE6 A;  5APV A;  2O01 H;  2M8R A;  3HE4 B;  2FBW C;  2QM8 A;  1EQ7 A;  2GDW A;  2P10 A;  1H89 A;  3RBX A;  3FXE A;  2Q7C A;  2ROQ A;  3KYQ A;  2KZJ A;  4K35 A;  1M1J B;  1SQP D;  4HKZ H;  1M8O B;  1BXI A;  3R4Y A;  2R3S A;  3V2R A;  1VQ8 P;  1HJ0 A;  1URQ A;  2P1J A;  2FAE A;  1W2B O;  3GMA A;  2Z4E A;  3A2A A;  3KQG A;  3CCQ P;  4UB6 H;  3V2N A;  3VOP A;  4GIF A;  4I1L A;  1KFM A;  2YKP A;  2O1J A;  1M1J A;  1KB9 H;  4YPC A;  2XZR A;  5CCG A;  2KXP B;  2YMY A;  3TGU G;  3H6P A;  4PH0 A;  3TGU E;  2AEM A;  4AUW A;  5AVZ B;  3AE9 C;  2YMK A;  4EI2 A;  3CX5 D;  3A7O A;  2K1A A;  3JCU E;  4DCK A;  2FQ0 A;  1Q90 D;  4YTP C;  3VP9 A;  3CD6 P;  2M5A A;  3MUD A;  1S5L E;  2PEM A;  2L0Q A;  2M5R A;  2FYU J;  1Y9B A;  3A0B H;  3CPW O;  3L73 D;  5AVU B;  2HG5 D;  3V5B A;  3L75 E;  4PD4 E;  1L0N G;  3SFD C;  4RJT A;  1YYC A;  4N78 D;  1L0N E;  3AE4 C;  2K88 A;  3PRJ A;  3SWY A;  3DPH A;  1BGY D;  3T97 B;  3SSU A;  1EXJ A;  1KQG B;  2N1T B;  4U7J A;  1BCC D;  3P32 A;  5APQ A;  2WIT A;  4H0L D;  2HYN A;  3D70 A;  3FXD A;  2O01 N;  3B4S A;  1S9K D;  2K9J A;  5KLV K;  4KJM A;  2LKI A;  1K30 A;  2CNR A;  4HH2 A;  4TLF A;  1N86 A;  2J5U A;  2KGE A;  2KOP A;  3G6E P;  2ITA A;  3EWK A;  1SQQ K;  2Y0D A;  2AXC A;  5E79 E;  2C0X A;  4OVN F;  3L74 D;  1Y8A A;  3LMO A;  1YIJ P;  4H0L B;  2LL8 A;  1RF0 C;  4WY4 C;  1K9M Q;  1LNQ A;  4C7N A;  3QWO C;  2Z5H A;  4DJG A;  3H4E A;  4EIJ A;  1PEQ A;  4N3Y B;  1EZV I;  1ZOY C;  3AED C;  4TT3 H;  1MFZ A;  4AYC A;  2OYH C;  3AE8 C;  4H44 B;  1EDJ A;  3KHU A;  1PPJ G;  2Q1K A;  4H13 C;  2JP3 A;  1SS1 A;  3HRN A;  2Z46 A;  4OWF A;  1PPJ E;  1J1D B;  1YI2 P;  4ASW A;  4XFX A;  2JEE A;  1QRJ A;  2CK3 H;  2W27 A;  2RH0 A;  3II6 A;  2B89 A;  2KR5 A;  2ZJS E;  3U1C A;  2KOR A;  4XRO A;  2XND H;  1IK7 A;  3OA7 A;  2N9B A;  5AW2 B;  1JY3 P;  1IUQ A;  2AF8 A;  1N8R Q;  3L72 G;  3CX5 H;  1BE3 G;  1N2D C;  1GL2 B;  3RK3 D;  1PP9 J;  1JCD A;  2M3B A;  3BCC G;  1BE3 E;  1KIL D;  3M1M A;  2IBZ D;  1LJ2 A;  3SFE C;  2WPQ A;  3BCC E;  4U0A A;  5GTI H;  1PGP A;  2W6J H;  3MD0 A;  1SQV G;  1AFO A;  1GU5 A;  2XV5 A;  4MN4 C;  2JBG A;  1XTG B;  5JPA A;  1SQV E;  5CJ4 A;  1HUC A;  2JR8 A;  2LTE A;  2XZ1 C;  3C9I A;  5AW0 B;  3GZM A;  2JU1 A;  1NQ4 A;  2AFD A;  1H88 A; 
#chains in the Genus database with same CATH homology
 1K30 A;  2QEX P;  3CCR P;  3H47 A;  1YJN P;  1D1D A;  4IPY A;  4COP A;  1M6E X;  4GR6 A;  4M0I A;  3CC4 P;  3E2D A;  1VQ8 P;  2PY8 A;  1PEM A;  1KC8 Q;  2EG5 A;  1EOQ A;  1W2B O;  2BHV A;  1VQP P;  1M74 A;  3LRY A;  1Q7Y Q;  1M90 Q;  3G6E P;  3CCQ P;  1VQM P;  4U0D A;  2XV6 A;  4U0E A;  2PEO A;  3VRL C;  4PH1 A;  2M8P A;  1PEO A;  3CME P;  3CC7 P;  1K8A Q;  5HGN A;  3CCM P;  2OTJ P;  2PEK A;  3CCV P;  1YJ9 P;  2P9X A;  3G26 A;  1Q86 Q;  1YIJ P;  3G1I A;  1KQS O;  2XXM A;  1BAJ A;  4WYM A;  4XRQ A;  1VQL P;  3DS5 A;  1K9M Q;  2Z44 A;  5BS1 A;  4PH0 A;  3OW2 O;  3I56 P;  3G71 P;  4GR2 A;  5HGO A;  3H4E A;  3HZQ A;  1PEQ A;  2XT1 A;  1RO2 A;  1VQN P;  1JJ2 O;  3G21 A;  2M8N A;  2M8L A;  1VQK P;  2JYG A;  1Q82 Q;  3G0V A;  1QVF O;  3CC2 P;  1KD1 Q;  3CCL P;  1A43 A;  3I55 P;  1RNI A;  3P05 A;  4XFZ A;  2EFJ A;  5HGM A;  4XFY A;  1NJI Q;  3DTJ A;  2BQ1 E;  3CD6 P;  1AUM A;  2LF4 A;  4U0C A;  3CCS P;  3CCU P;  1A8O A;  2JYL A;  2Z46 A;  3B5I A;  1K73 Q;  4U0B A;  2ONT A;  3G4S P;  5I4T G;  1YI2 P;  4COC A;  2CWO A;  3HYB A;  1QRJ A;  2OAR A;  2EIA A;  2PEM A;  4XFX A;  2E1M A;  2BUO A;  5DCK A;  5HGL A;  2PEN A;  3H0D A;  1M1K Q;  2DGY A;  1VQ4 P;  1E6J P;  1RO0 A;  3CPW O;  4XRO A;  3RG6 C;  2KOD A;  3DS2 A;  1QVG O;  1VQ9 P;  3DS3 A;  1YIT P;  1IUQ A;  5F2K A;  1N8R Q;  3CMA P;  3CCE P;  3CXC O;  1ZMB A;  3G1G A;  3NTE A;  2PEJ A;  3M1M A;  3DPH A;  3DS0 A;  1YHQ P;  4U0A A;  1Q81 Q;  3MGE A;  3G29 A;  2L6E A;  1VQO P;  1M6N A;  4QNB A;  2OTL P;  1S72 P;  3DS4 A;  5JPA A;  2PEQ A;  2PEI A;  1EIA A;  2JO0 A;  4U0F A;  5F2O A;  3Q20 A;  3WBH A;  5BS2 A;  1PEU A;  2Z45 A;  5F2N A;  1VQ7 P;  1VQ6 P;  1YJW P;  3CCJ P;  3DS1 A;  1VQ5 P;  2QA4 P;  3G28 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...