3G26A

Crystal structure of the c-terminal domain of the rous sarcoma virus capsid protein: mutant a184c
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
77
structure length
77
Chain Sequence
AGPWADIMQGPSESFVDFANRLIKAVEGSDLPPSCRAPVIIDCFRQKSQPDIQQLIRTAPSTLTTPGEIIKYVLDRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Proton-linked dimerization of a retroviral capsid protein initiates capsid assembly
pubmed doi rcsb
source organism Rous sarcoma virus
molecule tags Viral protein
molecule keywords Gag polyprotein
total genus 25
structure length 77
sequence length 77
ec nomenclature ec 3.4.23.-:
pdb deposition date 2009-01-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3g26A00
4XFZA 2BUOA 1A43A 4U0EA 2JYLA 2XXMA 3DS2A 4WYMA 4QNBA 5DCKA 1AUMA 3DS3A 4IPYA 5HGLA 3P05A 4COCA 5HGNA 4PH0A 4U0DA 5I4TG 3DS4A 4PH1A 1EOQA 1E6JP 2M8NA 2XT1A 1EIAA 3DS5A 3DS1A 2L6EA 3G28A 3DPHA 3G21A 3H47A 4U0BA 4M0IA 3G1IA 3NTEA 4XFYA 5HGMA 4XROA 1D1DA 2LF4A 1A8OA 3LRYA 5HGOA 1QRJA 3DS0A 2ONTA 2M8PA 3G29A 4U0FA 2M8LA 4U0CA 2JO0A 3VRLC 1BAJA 2JYGA 3DTJA 3H4EA 2EIAA 4XFXA 2KODA 3G0VA 4XRQA 3G1GA 4COPA 5JPAA 2XV6A 3G26A 3MGEA 4U0AA
chains in the Genus database with same CATH superfamily
1YIJP 4U0EA 2JYLA 2KOPA 5HGLA 1VQMP 1K8AQ 2EHSA 3WBHA 2XT1A 1GPJA 2FADA 1DNYA 2PEKA 3DS0A 2PEJA 3VRLC 2OTJP 2OTLP 3GKLC 4H2WC 3MGEA 2KOQA 2K0XA 3H0DA 4F37A 2K2QA 3CMAP 2LPKA 3GZMA 5HVCA 2KW2A 1YJNP 4HKGA 3I55P 2MD9A 1VQLP 2X2BA 1UJZA 4H2XC 1T8KA 2N6YA 5HV8A 2XXMA 3DS2A 1UNKA 3P05A 1M1KQ 2QNWA 2KWLA 2XZ0D 4U0DA 1ACPA 4U0BA 2MVUA 2L4BA 3B5IA 3EJEA 2CG5B 3B4QA 1Q86Q 2VLOA 2K5XA 5KP7B 2JGPA 2VLPA 5HGNA 3GZLA 3CCUP 1YI2P 1S72P 4PH1A 1BXIA 4XROA 1YITP 1KD1Q 2M8LA 4DG9A 2XV6A 2KR5A 4CA3A 2MR8A 4BPHA 2ROQA 2XZ1C 2GDYA 4QNBA 4IPYA 2GDXA 2L0QA 1VHNA 1QVGO 2N50A 1KC8Q 3DS5A 1EMVA 1VQ5P 2JQ4A 2K0YA 1VQKP 2GZEA 1Q81Q 4U0FA 2KOSA 2KODA 2KORA 2FQ0A 2N5HA 2FQ1A 1VQPP 1RNIA 4PH0A 2FVAA 1QVFO 2N6ZA 3RG2A 3CMEP 4IZ6A 2LIUA 5BS1A 3OW2O 3LMOA 1BAJA 3RG6C 3CCQP 3DTJA 1KLPA 1VQOP 1Q7YQ 3G6EP 1F80D 1AUMA 1MZ8A 2LKIA 2JU1A 3CPWO 1GXHA 3G71P 2GZFA 4NEOA 3G1IA 2NO8A 1FR2A 2JAZA 3CCLP 2KGAA 3U43A 1L0HA 1AYIA 2LTEA 2FQ2A 4COCA 3CC2P 2ERHA 1EOQA 2FVFA 7CEIA 2BHVA 3CCSP 4H2YC 2LF4A 1OR5A 1KQSO 2EIAA 2AFDA 1M6EX 3CCEP 3M1MA 1A43A 5F2NA 3Q20A 1X3OA 2GDWA 2GZGA 3DS4A 2M8NA 2DNWA 5BS2A 1ZNVA 3G21A 2K93A 2PY8A 3NTEA 4XFYA 2MR7A 2QEXP 1D1DA 5HGOA 1VQ6P 1N8RQ 4UHPB 1L0IA 2FVEA 1M74A 3G26A 3H47A 1K73Q 5KP8B 4MRTC 2JB0A 1HQBA 1Z6MA 5I4TG 2FAEA 3CCMP 1DV5A 2PEMA 5CZDB 3DS1A 2PEIA 2AF8A 3G28A 4BPFA 3LRYA 3GJNA 2MF4A 3G29A 2JO0A 2JYGA 1CEIA 2KGDA 2EFJA 2WPTA 1YHQP 1VQ7P 1M90Q 2N98A 2L6EA 4PXHB 4R0MA 3G4SP 3HYBA 1GXGA 1ZMBA 1NJIQ 1YJ9P 2KG6A 2KOOA 3CC4P 3EJDA 2MY5A 4XFXA 5JPAA 3G0VA 2FHSC 3I56P 1AF8A 1VQ9P 1NQ4A 2Z46A 1VKUA 2AVAA 2EHTA 2MVVA 4GR6A 1A8OA 2GZJA 2ONTA 1Q82Q 3CCVP 2PEQA 2FACA 3G1GA 3CXCO 2KG8A 3CD6P 2BUOA 2LOLA 3CCJP 3CC7P 3NY7B 1IMPA 2K92A 1W2BO 3DPHA 4M0IA 2PENA 1RO0A 2Z45A 3CE7A 5EW5E 5F2KA 5F2OA 2PEOA 2KGEA 1HY8A 2QA4P 1M6NA 2VSQA 3EJBA 5DCKA 2Z44A 2DGYA 2LMLA 2K94A 1IMQA 4PWVB 2KGCA 2GZIA 2KG9A 2N5IA 5KP6B 2CQ8A 1QRJA 2K0DX 2PNGA 4U0CA 1E0HA 4COPA 5EJDA 2AFEA 1VQ8P 2CWOA 1IUQA 3HZQA 2L9FA 1VQ4P 2CNRA 1K9MQ 2L22A 2JBGA 3CCRP 1K30A 1RO2A 1E6JP 1EIAA 2M5RA 5HGMA 2M8PA 2VLQA 3H4EA 2OARA 2E1MA 1JJ2O 1VQNP 4U0AA 2LIWA 2VLNA 4XFZA 4BPGA 2CGQA 4WYMA 3DS3A 2P9XA 4GR2A 2GYKA 4QKOA 1YJWP 2LL8A 4XRQA 2JU2A 2EG5A 3E2DA
chains in the Genus database with same CATH topology
2BUOA 1A43A 1YIJP 5F2NA 4U0EA 2JYLA 4QNBA 5HGLA 4IPYA 1VQMP 1K8AQ 3Q20A 3CCJP 1QVGO 3CC7P 3DS4A 3WBHA 1KC8Q 2M8NA 3DS5A 2XT1A 5BS2A 1W2BO 3DPHA 3G21A 2PY8A 4M0IA 2PENA 3NTEA 4XFYA 1VQ5P 1RO0A 2QEXP 1D1DA 2Z45A 1VQKP 5HGOA 1Q81Q 2PEKA 3DS0A 1N8RQ 1VQ6P 5F2KA 4U0FA 2PEJA 5F2OA 2PEOA 3VRLC 2OTJP 2KODA 2OTLP 1M74A 3G26A 3H47A 1K73Q 3MGEA 3H0DA 2QA4P 1M6NA 5DCKA 1VQPP 2Z44A 2DGYA 1RNIA 3CMAP 4PH0A 1QVFO 5I4TG 3CCMP 2PEMA 3DS1A 2PEIA 3G28A 3CMEP 5BS1A 1YJNP 3LRYA 3I55P 3OW2O 1VQLP 1QRJA 3G29A 4U0CA 2JO0A 1BAJA 3RG6C 2JYGA 3DTJA 4COPA 3CCQP 1VQOP 1Q7YQ 2EFJA 3G6EP 1VQ8P 3HZQA 1IUQA 2CWOA 1VQ4P 1YHQP 2XXMA 3DS2A 1K9MQ 1AUMA 1VQ7P 3P05A 3CCRP 1K30A 1M1KQ 1M90Q 4U0DA 1RO2A 1E6JP 1EIAA 3CPWO 3G71P 2L6EA 4U0BA 3G4SP 3G1IA 3HYBA 1ZMBA 1NJIQ 5HGMA 1YJ9P 3B5IA 3CC4P 2M8PA 4XFXA 3H4EA 2OARA 5JPAA 3G0VA 3CCLP 2E1MA 1Q86Q 1JJ2O 3I56P 1VQ9P 1VQNP 4U0AA 4XFZA 4WYMA 2Z46A 3DS3A 2P9XA 4COCA 3CC2P 4GR2A 5HGNA 3CCUP 1YI2P 1S72P 4PH1A 1EOQA 2BHVA 4GR6A 3CCSP 4XROA 2LF4A 1A8OA 1YITP 1KD1Q 1YJWP 2ONTA 1Q82Q 2M8LA 3CCVP 1KQSO 2PEQA 2EIAA 4XRQA 3G1GA 2EG5A 3CXCO 1M6EX 2XV6A 3E2DA 3CD6P 3CCEP 3M1MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XFZ A;  2BUO A;  1A43 A;  4U0E A;  2JYL A;  2XXM A;  3DS2 A;  4WYM A;  4QNB A;  5DCK A;  1AUM A;  3DS3 A;  4IPY A;  5HGL A;  3P05 A;  4COC A;  5HGN A;  4PH0 A;  4U0D A;  5I4T G;  3DS4 A;  4PH1 A;  1EOQ A;  1E6J P;  2M8N A;  2XT1 A;  1EIA A;  3DS5 A;  3DS1 A;  2L6E A;  3G28 A;  3DPH A;  3G21 A;  3H47 A;  4U0B A;  4M0I A;  3G1I A;  3NTE A;  4XFY A;  5HGM A;  4XRO A;  1D1D A;  2LF4 A;  1A8O A;  3LRY A;  5HGO A;  1QRJ A;  3DS0 A;  2ONT A;  2M8P A;  3G29 A;  4U0F A;  2M8L A;  4U0C A;  2JO0 A;  3VRL C;  1BAJ A;  2JYG A;  3DTJ A;  3H4E A;  2EIA A;  4XFX A;  2KOD A;  3G0V A;  4XRQ A;  3G1G A;  4COP A;  5JPA A;  2XV6 A;  3G26 A;  3MGE A;  4U0A A; 
#chains in the Genus database with same CATH topology
 1YIJ P;  4U0E A;  2JYL A;  2KOP A;  5HGL A;  1VQM P;  1K8A Q;  2EHS A;  3WBH A;  2XT1 A;  1GPJ A;  2FAD A;  1DNY A;  2PEK A;  3DS0 A;  2PEJ A;  3VRL C;  2OTJ P;  2OTL P;  3GKL C;  4H2W C;  3MGE A;  2KOQ A;  2K0X A;  3H0D A;  4F37 A;  2K2Q A;  3CMA P;  2LPK A;  3GZM A;  5HVC A;  2KW2 A;  1YJN P;  4HKG A;  3I55 P;  2MD9 A;  1VQL P;  2X2B A;  1UJZ A;  4H2X C;  1T8K A;  2N6Y A;  5HV8 A;  2XXM A;  3DS2 A;  1UNK A;  3P05 A;  1M1K Q;  2QNW A;  2KWL A;  2XZ0 D;  4U0D A;  1ACP A;  4U0B A;  2MVU A;  2L4B A;  3B5I A;  3EJE A;  2CG5 B;  3B4Q A;  1Q86 Q;  2VLO A;  2K5X A;  5KP7 B;  2JGP A;  2VLP A;  5HGN A;  3GZL A;  3CCU P;  1YI2 P;  1S72 P;  4PH1 A;  1BXI A;  4XRO A;  1YIT P;  1KD1 Q;  2M8L A;  4DG9 A;  2XV6 A;  2KR5 A;  4CA3 A;  2MR8 A;  4BPH A;  2ROQ A;  2XZ1 C;  2GDY A;  4QNB A;  4IPY A;  2GDX A;  2L0Q A;  1VHN A;  1QVG O;  2N50 A;  1KC8 Q;  3DS5 A;  1EMV A;  1VQ5 P;  2JQ4 A;  2K0Y A;  1VQK P;  2GZE A;  1Q81 Q;  4U0F A;  2KOS A;  2KOD A;  2KOR A;  2FQ0 A;  2N5H A;  2FQ1 A;  1VQP P;  1RNI A;  4PH0 A;  2FVA A;  1QVF O;  2N6Z A;  3RG2 A;  3CME P;  4IZ6 A;  2LIU A;  5BS1 A;  3OW2 O;  3LMO A;  1BAJ A;  3RG6 C;  3CCQ P;  3DTJ A;  1KLP A;  1VQO P;  1Q7Y Q;  3G6E P;  1F80 D;  1AUM A;  1MZ8 A;  2LKI A;  2JU1 A;  3CPW O;  1GXH A;  3G71 P;  2GZF A;  4NEO A;  3G1I A;  2NO8 A;  1FR2 A;  2JAZ A;  3CCL P;  2KGA A;  3U43 A;  1L0H A;  1AYI A;  2LTE A;  2FQ2 A;  4COC A;  3CC2 P;  2ERH A;  1EOQ A;  2FVF A;  7CEI A;  2BHV A;  3CCS P;  4H2Y C;  2LF4 A;  1OR5 A;  1KQS O;  2EIA A;  2AFD A;  1M6E X;  3CCE P;  3M1M A;  1A43 A;  5F2N A;  3Q20 A;  1X3O A;  2GDW A;  2GZG A;  3DS4 A;  2M8N A;  2DNW A;  5BS2 A;  1ZNV A;  3G21 A;  2K93 A;  2PY8 A;  3NTE A;  4XFY A;  2MR7 A;  2QEX P;  1D1D A;  5HGO A;  1VQ6 P;  1N8R Q;  4UHP B;  1L0I A;  2FVE A;  1M74 A;  3G26 A;  3H47 A;  1K73 Q;  5KP8 B;  4MRT C;  2JB0 A;  1HQB A;  1Z6M A;  5I4T G;  2FAE A;  3CCM P;  1DV5 A;  2PEM A;  5CZD B;  3DS1 A;  2PEI A;  2AF8 A;  3G28 A;  4BPF A;  3LRY A;  3GJN A;  2MF4 A;  3G29 A;  2JO0 A;  2JYG A;  1CEI A;  2KGD A;  2EFJ A;  2WPT A;  1YHQ P;  1VQ7 P;  1M90 Q;  2N98 A;  2L6E A;  4PXH B;  4R0M A;  3G4S P;  3HYB A;  1GXG A;  1ZMB A;  1NJI Q;  1YJ9 P;  2KG6 A;  2KOO A;  3CC4 P;  3EJD A;  2MY5 A;  4XFX A;  5JPA A;  3G0V A;  2FHS C;  3I56 P;  1AF8 A;  1VQ9 P;  1NQ4 A;  2Z46 A;  1VKU A;  2AVA A;  2EHT A;  2MVV A;  4GR6 A;  1A8O A;  2GZJ A;  2ONT A;  1Q82 Q;  3CCV P;  2PEQ A;  2FAC A;  3G1G A;  3CXC O;  2KG8 A;  3CD6 P;  2BUO A;  2LOL A;  3CCJ P;  3CC7 P;  3NY7 B;  1IMP A;  2K92 A;  1W2B O;  3DPH A;  4M0I A;  2PEN A;  1RO0 A;  2Z45 A;  3CE7 A;  5EW5 E;  5F2K A;  5F2O A;  2PEO A;  2KGE A;  1HY8 A;  2QA4 P;  1M6N A;  2VSQ A;  3EJB A;  5DCK A;  2Z44 A;  2DGY A;  2LML A;  2K94 A;  1IMQ A;  4PWV B;  2KGC A;  2GZI A;  2KG9 A;  2N5I A;  5KP6 B;  2CQ8 A;  1QRJ A;  2K0D X;  2PNG A;  4U0C A;  1E0H A;  4COP A;  5EJD A;  2AFE A;  1VQ8 P;  2CWO A;  1IUQ A;  3HZQ A;  2L9F A;  1VQ4 P;  2CNR A;  1K9M Q;  2L22 A;  2JBG A;  3CCR P;  1K30 A;  1RO2 A;  1E6J P;  1EIA A;  2M5R A;  5HGM A;  2M8P A;  2VLQ A;  3H4E A;  2OAR A;  2E1M A;  1JJ2 O;  1VQN P;  4U0A A;  2LIW A;  2VLN A;  4XFZ A;  4BPG A;  2CGQ A;  4WYM A;  3DS3 A;  2P9X A;  4GR2 A;  2GYK A;  4QKO A;  1YJW P;  2LL8 A;  4XRQ A;  2JU2 A;  2EG5 A;  3E2D A; 
#chains in the Genus database with same CATH homology
 2BUO A;  1A43 A;  1YIJ P;  5F2N A;  4U0E A;  2JYL A;  4QNB A;  5HGL A;  4IPY A;  1VQM P;  1K8A Q;  3Q20 A;  3CCJ P;  1QVG O;  3CC7 P;  3DS4 A;  3WBH A;  1KC8 Q;  2M8N A;  3DS5 A;  2XT1 A;  5BS2 A;  1W2B O;  3DPH A;  3G21 A;  2PY8 A;  4M0I A;  2PEN A;  3NTE A;  4XFY A;  1VQ5 P;  1RO0 A;  2QEX P;  1D1D A;  2Z45 A;  1VQK P;  5HGO A;  1Q81 Q;  2PEK A;  3DS0 A;  1N8R Q;  1VQ6 P;  5F2K A;  4U0F A;  2PEJ A;  5F2O A;  2PEO A;  3VRL C;  2OTJ P;  2KOD A;  2OTL P;  1M74 A;  3G26 A;  3H47 A;  1K73 Q;  3MGE A;  3H0D A;  2QA4 P;  1M6N A;  5DCK A;  1VQP P;  2Z44 A;  2DGY A;  1RNI A;  3CMA P;  4PH0 A;  1QVF O;  5I4T G;  3CCM P;  2PEM A;  3DS1 A;  2PEI A;  3G28 A;  3CME P;  5BS1 A;  1YJN P;  3LRY A;  3I55 P;  3OW2 O;  1VQL P;  1QRJ A;  3G29 A;  4U0C A;  2JO0 A;  1BAJ A;  3RG6 C;  2JYG A;  3DTJ A;  4COP A;  3CCQ P;  1VQO P;  1Q7Y Q;  2EFJ A;  3G6E P;  1VQ8 P;  3HZQ A;  1IUQ A;  2CWO A;  1VQ4 P;  1YHQ P;  2XXM A;  3DS2 A;  1K9M Q;  1AUM A;  1VQ7 P;  3P05 A;  3CCR P;  1K30 A;  1M1K Q;  1M90 Q;  4U0D A;  1RO2 A;  1E6J P;  1EIA A;  3CPW O;  3G71 P;  2L6E A;  4U0B A;  3G4S P;  3G1I A;  3HYB A;  1ZMB A;  1NJI Q;  5HGM A;  1YJ9 P;  3B5I A;  3CC4 P;  2M8P A;  4XFX A;  3H4E A;  2OAR A;  5JPA A;  3G0V A;  3CCL P;  2E1M A;  1Q86 Q;  1JJ2 O;  3I56 P;  1VQ9 P;  1VQN P;  4U0A A;  4XFZ A;  4WYM A;  2Z46 A;  3DS3 A;  2P9X A;  4COC A;  3CC2 P;  4GR2 A;  5HGN A;  3CCU P;  1YI2 P;  1S72 P;  4PH1 A;  1EOQ A;  2BHV A;  4GR6 A;  3CCS P;  4XRO A;  2LF4 A;  1A8O A;  1YIT P;  1KD1 Q;  1YJW P;  2ONT A;  1Q82 Q;  2M8L A;  3CCV P;  1KQS O;  2PEQ A;  2EIA A;  4XRQ A;  3G1G A;  2EG5 A;  3CXC O;  1M6E X;  2XV6 A;  3E2D A;  3CD6 P;  3CCE P;  3M1M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...