3G26A

Crystal structure of the c-terminal domain of the rous sarcoma virus capsid protein: mutant a184c
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
77
structure length
77
Chain Sequence
AGPWADIMQGPSESFVDFANRLIKAVEGSDLPPSCRAPVIIDCFRQKSQPDIQQLIRTAPSTLTTPGEIIKYVLDRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Gag polyprotein
publication title Proton-linked dimerization of a retroviral capsid protein initiates capsid assembly
pubmed doi rcsb
source organism Rous sarcoma virus
molecule tags Viral protein
total genus 25
structure length 77
sequence length 77
ec nomenclature ec 3.4.23.-:
pdb deposition date 2009-01-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3g26A00
3DS4A 3P05A 2JYLA 1BAJA 5HGLA 2M8LA 3VRLC 4U0CA 3H47A 1AUMA 4XFZA 2L6EA 3G1IA 2XV6A 4XRQA 1EIAA 3DS5A 5HGNA 3G29A 2BUOA 3G26A 4U0BA 1E6JP 1A8OA 3G0VA 5I4TG 1D1DA 4COCA 3G1GA 4IPYA 4QNBA 2KODA 2M8PA 4WYMA 1A43A 4XFXA 3DTJA 3MGEA 4XFYA 5HGMA 2ONTA 2EIAA 3DPHA 4XROA 3G21A 4PH1A 3DS2A 2JO0A 1EOQA 2JYGA 3DS3A 3H4EA 4M0IA 5HGOA 5JPAA 4U0EA 1QRJA 5DCKA 2XT1A 4U0DA 4PH0A 3NTEA 2M8NA 3DS1A 3DS0A 3LRYA 4U0FA 4U0AA 3G28A 2LF4A 2XXMA 4COPA
chains in the Genus database with same CATH superfamily
2L0QA 4BPFA 2WPTA 2KW2A 3G6EP 2ERHA 2VSQA 5I4TG 3G0VA 1VQ9P 2MR8A 2N5HA 1K8AQ 2CGQA 7CEIA 2MR7A 2GDWA 2N98A 2P9XA 2FACA 2GZJA 3B5IA 1IMQA 4BPGA 2CG5B 1M6EX 2GZGA 3M1MA 3CCRP 2M5RA 2PEQA 3G1GA 2PNGA 2M8PA 4QNBA 1JJ2O 3MGEA 2QA4P 2QEXP 2FQ1A 1T8KA 1VQKP 3DS2A 2KR5A 3EJEA 3H0DA 4H2XC 2NO8A 4GR6A 4U0FA 4H2WC 2BHVA 1VQ6P 2PEJA 1Q81Q 2K5XA 1DV5A 4NEOA 2K2QA 1VQ7P 1RO0A 2QNWA 4IZ6A 5BS1A 3E2DA 2Z44A 1KLPA 4XFZA 3I55P 2XV6A 4XRQA 1VQ4P 3CCVP 5CZDB 5HGMA 2PY8A 2L4BA 3CCEP 1VQ5P 3GKLC 2JYGA 5JPAA 1K73Q 2FQ0A 1ACPA 1E0HA 1X3OA 4GR2A 2K93A 2KOQA 2X2BA 2JU2A 1YJWP 3DPHA 5KP7B 1VQNP 3B4QA 1YHQP 2AF8A 4PH1A 1EOQA 2KORA 1VQLP 2CNRA 2FHSC 4PH0A 2EHSA 1W2BO 1ZNVA 1HY8A 1VKUA 1FR2A 1A8OA 2KOSA 3WBHA 3CCMP 4MRTC 2VLOA 3G21A 4PXHB 3CD6P 1YI2P 4U0DA 2PEIA 3LRYA 4COPA 2DNWA 1BAJA 3GJNA 2L6EA 1L0IA 2LTEA 1VQPP 4WYMA 1F80D 2LMLA 2Z46A 1Z6MA 1M6NA 2JB0A 2JAZA 1Q82Q 5DCKA 2GZFA 2GDXA 1QVGO 3Q20A 5HGLA 3GZMA 3H47A 1KC8Q 4BPHA 1RO2A 4IPYA 4XFYA 2FVFA 1NQ4A 2VLQA 3CCSP 2EFJA 4UHPB 3EJDA 2AFEA 2JQ4A 2MY5A 2XT1A 2K0YA 2N6ZA 3CMEP 3DS1A 1L0HA 2JYLA 2K0XA 2PENA 1AYIA 3G29A 1E6JP 2E1MA 5BS2A 2N6YA 2GDYA 2KGAA 2XZ0D 2VLPA 2JO0A 3EJBA 2OTLP 4U0AA 2LF4A 2Z45A 2N50A 3VRLC 5HV8A 1N8RQ 4COCA 2KODA 1GXHA 4XFXA 4CA3A 2DGYA 3HZQA 4DG9A 2LKIA 1CEIA 2GZIA 3DS3A 2GZEA 2KG8A 1VQ8P 2OTJP 5F2NA 1Q86Q 1M74A 3DS4A 2JGPA 2M8LA 1S72P 2ROQA 2MVVA 1M1KQ 1IUQA 3DTJA 3GZLA 2EIAA 2FVEA 2PEKA 4HKGA 3I56P 3H4EA 5EJDA 2KG9A 1GPJA 1QRJA 1DNYA 1GXGA 3U43A 1IMPA 5EW5E 2K92A 3P05A 2VLNA 4U0CA 1UNKA 2CQ8A 2JBGA 1EIAA 3G26A 4U0BA 3CC2P 1KD1Q 3CCJP 1NJIQ 3OW2O 2EG5A 3G4SP 1VQOP 5KP8B 2M8NA 2KG6A 5HGOA 2AVAA 2LL8A 1VHNA 2PEMA 3G1IA 1YJ9P 5HGNA 1K9MQ 3CCLP 2ONTA 1BXIA 4XROA 3CC7P 3CE7A 2KGEA 2LPKA 4U0EA 2KWLA 3G28A 2OARA 1YITP 1M90Q 2BUOA 2KGDA 2KOOA 1KQSO 1YJNP 1AF8A 3CPWO 4H2YC 1RNIA 4QKOA 4M0IA 3CCQP 2GYKA 3HYBA 3CCUP 2AFDA 1OR5A 3DS0A 1HQBA 2FADA 2MVUA 4R0MA 3CXCO 1AUMA 2LOLA 2N5IA 3CMAP 2LIWA 3NY7B 2CWOA 1D1DA 5F2KA 1ZMBA 2MD9A 1A43A 2K0DX 3LMOA 4PWVB 2JU1A 2L9FA 1YIJP 2K94A 5KP6B 3NTEA 1EMVA 2MF4A 3RG6C 5F2OA 2XXMA 1QVFO 1K30A 1UJZA 2KOPA 2LIUA 2FAEA 3DS5A 2FVAA 1MZ8A 4F37A 2EHTA 2L22A 3G71P 2PEOA 2FQ2A 1Q7YQ 3RG2A 2KGCA 2XZ1C 5HVCA 1VQMP 3CC4P
chains in the Genus database with same CATH topology
2JYLA 2PENA 2PEMA 3G1IA 1YJ9P 3G6EP 5HGNA 3G29A 1YJWP 1E6JP 5I4TG 3G0VA 1VQ9P 2E1MA 5BS2A 1K9MQ 3CCLP 2ONTA 3DPHA 1K8AQ 1VQNP 4XROA 3CC7P 1YHQP 4PH1A 2JO0A 1EOQA 1VQLP 1JJ2O 4U0EA 2OTLP 2P9XA 4PH0A 4U0AA 3G28A 2LF4A 1W2BO 2Z45A 2OARA 3VRLC 3B5IA 1YITP 1M90Q 2BUOA 1A8OA 1M6EX 3M1MA 1N8RQ 4COCA 2PEQA 3G1GA 4QNBA 3WBHA 2KODA 2M8PA 3CCMP 3CCRP 4XFXA 3MGEA 2DGYA 1KQSO 1YJNP 2QA4P 3HZQA 3G21A 2QEXP 3CPWO 1RNIA 1VQKP 3DS2A 3DS3A 4M0IA 3CCQP 3H0DA 3CD6P 1YI2P 3HYBA 4U0DA 3CCUP 1VQ8P 4GR6A 2OTJP 2PEIA 5F2NA 4U0FA 3DS0A 3LRYA 4COPA 1Q86Q 1M74A 3DS4A 1BAJA 2M8LA 3CXCO 1S72P 1AUMA 2L6EA 2BHVA 1VQ6P 3CMAP 1VQPP 2PEJA 2CWOA 1Q81Q 5F2KA 1M1KQ 1ZMBA 1D1DA 4WYMA 1A43A 1IUQA 3DTJA 1RO0A 1VQ7P 2EIAA 2Z46A 2PEKA 3I56P 1M6NA 1YIJP 3H4EA 5BS1A 3E2DA 1Q82Q 1QRJA 5DCKA 3NTEA 3RG6C 2Z44A 5F2OA 2XXMA 1QVFO 1QVGO 3P05A 3Q20A 1K30A 5HGLA 4U0CA 3H47A 4XFZA 3I55P 2XV6A 1KC8Q 4XRQA 1EIAA 3DS5A 1VQ4P 3G26A 4U0BA 3CCVP 3CC2P 1KD1Q 1RO2A 3CCJP 4IPYA 5HGMA 4XFYA 1NJIQ 2PY8A 3CCSP 3OW2O 3CCEP 2EFJA 2EG5A 3G71P 2PEOA 1VQ5P 3G4SP 1VQOP 2JYGA 5JPAA 1Q7YQ 2XT1A 1K73Q 1VQMP 3CMEP 2M8NA 3DS1A 5HGOA 3CC4P 4GR2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DS4 A;  3P05 A;  2JYL A;  1BAJ A;  5HGL A;  2M8L A;  3VRL C;  4U0C A;  3H47 A;  1AUM A;  4XFZ A;  2L6E A;  3G1I A;  2XV6 A;  4XRQ A;  1EIA A;  3DS5 A;  5HGN A;  3G29 A;  2BUO A;  3G26 A;  4U0B A;  1E6J P;  1A8O A;  3G0V A;  5I4T G;  1D1D A;  4COC A;  3G1G A;  4IPY A;  4QNB A;  2KOD A;  2M8P A;  4WYM A;  1A43 A;  4XFX A;  3DTJ A;  3MGE A;  4XFY A;  5HGM A;  2ONT A;  2EIA A;  3DPH A;  4XRO A;  3G21 A;  4PH1 A;  3DS2 A;  2JO0 A;  1EOQ A;  2JYG A;  3DS3 A;  3H4E A;  4M0I A;  5HGO A;  5JPA A;  4U0E A;  1QRJ A;  5DCK A;  2XT1 A;  4U0D A;  4PH0 A;  3NTE A;  2M8N A;  3DS1 A;  3DS0 A;  3LRY A;  4U0F A;  4U0A A;  3G28 A;  2LF4 A;  2XXM A;  4COP A; 
#chains in the Genus database with same CATH topology
 2L0Q A;  4BPF A;  2WPT A;  2KW2 A;  3G6E P;  2ERH A;  2VSQ A;  5I4T G;  3G0V A;  1VQ9 P;  2MR8 A;  2N5H A;  1K8A Q;  2CGQ A;  7CEI A;  2MR7 A;  2GDW A;  2N98 A;  2P9X A;  2FAC A;  2GZJ A;  3B5I A;  1IMQ A;  4BPG A;  2CG5 B;  1M6E X;  2GZG A;  3M1M A;  3CCR P;  2M5R A;  2PEQ A;  3G1G A;  2PNG A;  2M8P A;  4QNB A;  1JJ2 O;  3MGE A;  2QA4 P;  2QEX P;  2FQ1 A;  1T8K A;  1VQK P;  3DS2 A;  2KR5 A;  3EJE A;  3H0D A;  4H2X C;  2NO8 A;  4GR6 A;  4U0F A;  4H2W C;  2BHV A;  1VQ6 P;  2PEJ A;  1Q81 Q;  2K5X A;  1DV5 A;  4NEO A;  2K2Q A;  1VQ7 P;  1RO0 A;  2QNW A;  4IZ6 A;  5BS1 A;  3E2D A;  2Z44 A;  1KLP A;  4XFZ A;  3I55 P;  2XV6 A;  4XRQ A;  1VQ4 P;  3CCV P;  5CZD B;  5HGM A;  2PY8 A;  2L4B A;  3CCE P;  1VQ5 P;  3GKL C;  2JYG A;  5JPA A;  1K73 Q;  2FQ0 A;  1ACP A;  1E0H A;  1X3O A;  4GR2 A;  2K93 A;  2KOQ A;  2X2B A;  2JU2 A;  1YJW P;  3DPH A;  5KP7 B;  1VQN P;  3B4Q A;  1YHQ P;  2AF8 A;  4PH1 A;  1EOQ A;  2KOR A;  1VQL P;  2CNR A;  2FHS C;  4PH0 A;  2EHS A;  1W2B O;  1ZNV A;  1HY8 A;  1VKU A;  1FR2 A;  1A8O A;  2KOS A;  3WBH A;  3CCM P;  4MRT C;  2VLO A;  3G21 A;  4PXH B;  3CD6 P;  1YI2 P;  4U0D A;  2PEI A;  3LRY A;  4COP A;  2DNW A;  1BAJ A;  3GJN A;  2L6E A;  1L0I A;  2LTE A;  1VQP P;  4WYM A;  1F80 D;  2LML A;  2Z46 A;  1Z6M A;  1M6N A;  2JB0 A;  2JAZ A;  1Q82 Q;  5DCK A;  2GZF A;  2GDX A;  1QVG O;  3Q20 A;  5HGL A;  3GZM A;  3H47 A;  1KC8 Q;  4BPH A;  1RO2 A;  4IPY A;  4XFY A;  2FVF A;  1NQ4 A;  2VLQ A;  3CCS P;  2EFJ A;  4UHP B;  3EJD A;  2AFE A;  2JQ4 A;  2MY5 A;  2XT1 A;  2K0Y A;  2N6Z A;  3CME P;  3DS1 A;  1L0H A;  2JYL A;  2K0X A;  2PEN A;  1AYI A;  3G29 A;  1E6J P;  2E1M A;  5BS2 A;  2N6Y A;  2GDY A;  2KGA A;  2XZ0 D;  2VLP A;  2JO0 A;  3EJB A;  2OTL P;  4U0A A;  2LF4 A;  2Z45 A;  2N50 A;  3VRL C;  5HV8 A;  1N8R Q;  4COC A;  2KOD A;  1GXH A;  4XFX A;  4CA3 A;  2DGY A;  3HZQ A;  4DG9 A;  2LKI A;  1CEI A;  2GZI A;  3DS3 A;  2GZE A;  2KG8 A;  1VQ8 P;  2OTJ P;  5F2N A;  1Q86 Q;  1M74 A;  3DS4 A;  2JGP A;  2M8L A;  1S72 P;  2ROQ A;  2MVV A;  1M1K Q;  1IUQ A;  3DTJ A;  3GZL A;  2EIA A;  2FVE A;  2PEK A;  4HKG A;  3I56 P;  3H4E A;  5EJD A;  2KG9 A;  1GPJ A;  1QRJ A;  1DNY A;  1GXG A;  3U43 A;  1IMP A;  5EW5 E;  2K92 A;  3P05 A;  2VLN A;  4U0C A;  1UNK A;  2CQ8 A;  2JBG A;  1EIA A;  3G26 A;  4U0B A;  3CC2 P;  1KD1 Q;  3CCJ P;  1NJI Q;  3OW2 O;  2EG5 A;  3G4S P;  1VQO P;  5KP8 B;  2M8N A;  2KG6 A;  5HGO A;  2AVA A;  2LL8 A;  1VHN A;  2PEM A;  3G1I A;  1YJ9 P;  5HGN A;  1K9M Q;  3CCL P;  2ONT A;  1BXI A;  4XRO A;  3CC7 P;  3CE7 A;  2KGE A;  2LPK A;  4U0E A;  2KWL A;  3G28 A;  2OAR A;  1YIT P;  1M90 Q;  2BUO A;  2KGD A;  2KOO A;  1KQS O;  1YJN P;  1AF8 A;  3CPW O;  4H2Y C;  1RNI A;  4QKO A;  4M0I A;  3CCQ P;  2GYK A;  3HYB A;  3CCU P;  2AFD A;  1OR5 A;  3DS0 A;  1HQB A;  2FAD A;  2MVU A;  4R0M A;  3CXC O;  1AUM A;  2LOL A;  2N5I A;  3CMA P;  2LIW A;  3NY7 B;  2CWO A;  1D1D A;  5F2K A;  1ZMB A;  2MD9 A;  1A43 A;  2K0D X;  3LMO A;  4PWV B;  2JU1 A;  2L9F A;  1YIJ P;  2K94 A;  5KP6 B;  3NTE A;  1EMV A;  2MF4 A;  3RG6 C;  5F2O A;  2XXM A;  1QVF O;  1K30 A;  1UJZ A;  2KOP A;  2LIU A;  2FAE A;  3DS5 A;  2FVA A;  1MZ8 A;  4F37 A;  2EHT A;  2L22 A;  3G71 P;  2PEO A;  2FQ2 A;  1Q7Y Q;  3RG2 A;  2KGC A;  2XZ1 C;  5HVC A;  1VQM P;  3CC4 P; 
#chains in the Genus database with same CATH homology
 2JYL A;  2PEN A;  2PEM A;  3G1I A;  1YJ9 P;  3G6E P;  5HGN A;  3G29 A;  1YJW P;  1E6J P;  5I4T G;  3G0V A;  1VQ9 P;  2E1M A;  5BS2 A;  1K9M Q;  3CCL P;  2ONT A;  3DPH A;  1K8A Q;  1VQN P;  4XRO A;  3CC7 P;  1YHQ P;  4PH1 A;  2JO0 A;  1EOQ A;  1VQL P;  1JJ2 O;  4U0E A;  2OTL P;  2P9X A;  4PH0 A;  4U0A A;  3G28 A;  2LF4 A;  1W2B O;  2Z45 A;  2OAR A;  3VRL C;  3B5I A;  1YIT P;  1M90 Q;  2BUO A;  1A8O A;  1M6E X;  3M1M A;  1N8R Q;  4COC A;  2PEQ A;  3G1G A;  4QNB A;  3WBH A;  2KOD A;  2M8P A;  3CCM P;  3CCR P;  4XFX A;  3MGE A;  2DGY A;  1KQS O;  1YJN P;  2QA4 P;  3HZQ A;  3G21 A;  2QEX P;  3CPW O;  1RNI A;  1VQK P;  3DS2 A;  3DS3 A;  4M0I A;  3CCQ P;  3H0D A;  3CD6 P;  1YI2 P;  3HYB A;  4U0D A;  3CCU P;  1VQ8 P;  4GR6 A;  2OTJ P;  2PEI A;  5F2N A;  4U0F A;  3DS0 A;  3LRY A;  4COP A;  1Q86 Q;  1M74 A;  3DS4 A;  1BAJ A;  2M8L A;  3CXC O;  1S72 P;  1AUM A;  2L6E A;  2BHV A;  1VQ6 P;  3CMA P;  1VQP P;  2PEJ A;  2CWO A;  1Q81 Q;  5F2K A;  1M1K Q;  1ZMB A;  1D1D A;  4WYM A;  1A43 A;  1IUQ A;  3DTJ A;  1RO0 A;  1VQ7 P;  2EIA A;  2Z46 A;  2PEK A;  3I56 P;  1M6N A;  1YIJ P;  3H4E A;  5BS1 A;  3E2D A;  1Q82 Q;  1QRJ A;  5DCK A;  3NTE A;  3RG6 C;  2Z44 A;  5F2O A;  2XXM A;  1QVF O;  1QVG O;  3P05 A;  3Q20 A;  1K30 A;  5HGL A;  4U0C A;  3H47 A;  4XFZ A;  3I55 P;  2XV6 A;  1KC8 Q;  4XRQ A;  1EIA A;  3DS5 A;  1VQ4 P;  3G26 A;  4U0B A;  3CCV P;  3CC2 P;  1KD1 Q;  1RO2 A;  3CCJ P;  4IPY A;  5HGM A;  4XFY A;  1NJI Q;  2PY8 A;  3CCS P;  3OW2 O;  3CCE P;  2EFJ A;  2EG5 A;  3G71 P;  2PEO A;  1VQ5 P;  3G4S P;  1VQO P;  2JYG A;  5JPA A;  1Q7Y Q;  2XT1 A;  1K73 Q;  1VQM P;  3CME P;  2M8N A;  3DS1 A;  5HGO A;  3CC4 P;  4GR2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...