3G26A

Crystal structure of the c-terminal domain of the rous sarcoma virus capsid protein: mutant a184c
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
77
structure length
77
Chain Sequence
AGPWADIMQGPSESFVDFANRLIKAVEGSDLPPSCRAPVIIDCFRQKSQPDIQQLIRTAPSTLTTPGEIIKYVLDRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Gag polyprotein
publication title Proton-linked dimerization of a retroviral capsid protein initiates capsid assembly
pubmed doi rcsb
source organism Rous sarcoma virus
molecule tags Viral protein
total genus 25
structure length 77
sequence length 77
ec nomenclature ec 3.4.23.-:
pdb deposition date 2009-01-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3g26A00
1EOQA 4QNBA 4U0DA 4XRQA 3H4EA 2L6EA 3G1IA 5HGMA 2EIAA 3DS0A 1A8OA 4COPA 3DPHA 4U0EA 2KODA 3H47A 2JYGA 3G29A 4U0CA 4XROA 1A43A 1AUMA 2M8NA 3G0VA 4U0BA 4U0AA 4WYMA 3G28A 1E6JP 5HGOA 2M8PA 2BUOA 1BAJA 3DS3A 5I4TG 3VRLC 4IPYA 4PH1A 2XT1A 1QRJA 4XFYA 3P05A 2LF4A 3DTJA 4U0FA 2JYLA 5HGNA 2JO0A 3DS2A 2M8LA 3G26A 3G1GA 3DS5A 3NTEA 2ONTA 5HGLA 4PH0A 4M0IA 3MGEA 1D1DA 3G21A 5DCKA 5JPAA 2XXMA 3LRYA 4COCA 4XFZA 1EIAA 3DS1A 4XFXA 2XV6A 3DS4A
chains in the Genus database with same CATH superfamily
2JU2A 4U0DA 5BS2A 2P9XA 2GYKA 3GKLC 3GZMA 2JGPA 1YJ9P 1Q86Q 2LIWA 3CCUP 1VQOP 1N8RQ 3G1GA 1K30A 1DV5A 2ONTA 1UNKA 2L0QA 3G4SP 1JJ2O 2XXMA 2K5XA 3CCLP 4XRQA 2XZ1C 2PEJA 3E2DA 4U0EA 2WPTA 4GR2A 2JB0A 2GZEA 2M8PA 2VSQA 4IPYA 2MF4A 1KC8Q 2VLOA 1YITP 2K94A 3NY7B 1M6NA 1VQPP 1L0HA 3CMAP 2KGAA 2K93A 2FQ0A 4IZ6A 2QNWA 1VQNP 1ACPA 1MZ8A 4WYMA 2GZIA 5HGOA 2XZ0D 2LOLA 2MVVA 1VQ8P 1QRJA 2AF8A 2E1MA 3DTJA 5EW5E 4H2WC 2KORA 4UHPB 2LKIA 2GZGA 1VQLP 1VQKP 4U0BA 1KD1Q 3CCRP 3DS3A 1M74A 2KG6A 2GDYA 2KR5A 1QVGO 3CCEP 4PH0A 2PNGA 1OR5A 1VQ4P 3CMEP 2OTLP 2N6YA 2EIAA 4COPA 3CC2P 1VQ7P 2KODA 2FVEA 2GZJA 2KOQA 1Q81Q 1IMPA 3VRLC 1RO2A 2XT1A 1CEIA 2AVAA 2K92A 3RG2A 2QEXP 3G6EP 2CQ8A 2PEQA 2N5HA 3OW2O 2EFJA 5HVCA 1W2BO 1EIAA 4XFZA 3H4EA 2LMLA 2EG5A 2JYGA 3EJBA 1A43A 1AUMA 2CG5B 5KP8B 1DNYA 1VQ9P 2MY5A 2L4BA 2Z45A 3G71P 1KQSO 2K0XA 2AFDA 3CCSP 3CCJP 2LL8A 1NJIQ 2ROQA 2EHSA 4PH1A 1RO0A 2FHSC 5HV8A 2DGYA 1S72P 4R0MA 2N98A 1YIJP 1VQMP 3GZLA 1NQ4A 1YJNP 2ERHA 2Z44A 5HGNA 2JO0A 2MD9A 1M90Q 2VLPA 3LRYA 2L9FA 2XV6A 2L6EA 2PY8A 2JAZA 3CCQP 4BPHA 1QVFO 3CC7P 1E6JP 2K0YA 1FR2A 2Z46A 2MR7A 3EJDA 4PWVB 1IMQA 1GXHA 5HGLA 4M0IA 1BXIA 3G21A 3HYBA 2CNRA 1Q7YQ 3DS4A 2DNWA 3H47A 5EJDA 4XROA 2OARA 4U0AA 1BAJA 2PEMA 1HY8A 3P05A 2JBGA 2KG8A 1EMVA 2AFEA 2KGEA 2CGQA 3CCMP 1YJWP 4MRTC 2KGDA 2FVAA 1GPJA 3DPHA 4U0CA 4PXHB 2EHTA 3G0VA 1Z6MA 1UJZA 2K0DX 2QA4P 2KW2A 3H0DA 4GR6A 3EJEA 3HZQA 5F2OA 3NTEA 1M6EX 5DCKA 2GDXA 4XFXA 3B4QA 3DS0A 3I55P 1VHNA 7CEIA 1GXGA 2KOOA 5I4TG 4F37A 2CWOA 3CXCO 5F2KA 1E0HA 4DG9A 4CA3A 2MVUA 4H2XC 1YI2P 3I56P 2LTEA 1D1DA 5BS1A 4BPGA 2PEIA 1ZNVA 4NEOA 2BUOA 4XFYA 2K2QA 2JYLA 3RG6C 2FAEA 2KGCA 1Q82Q 5JPAA 2VLNA 1L0IA 2L22A 2N5IA 2GDWA 1RNIA 3CC4P 3G1IA 5CZDB 2OTJP 2KOSA 2M5RA 1VQ5P 4U0FA 4HKGA 3DS2A 3M1MA 2JU1A 3U43A 1T8KA 3DS1A 3B5IA 1EOQA 1VKUA 4QNBA 3LMOA 5HGMA 2GZFA 3CPWO 3G29A 1K8AQ 5KP6B 1KLPA 2M8NA 4BPFA 2FQ2A 2LIUA 2PEOA 2LF4A 3CE7A 1AYIA 2PEKA 1F80D 3G26A 3GJNA 1K73Q 4COCA 2N50A 1HQBA 2VLQA 2NO8A 5KP7B 1M1KQ 1X3OA 2FACA 1A8OA 1IUQA 1VQ6P 1K9MQ 3WBHA 2MR8A 3G28A 1ZMBA 3CCVP 2FADA 2JQ4A 2FQ1A 3Q20A 2M8LA 5F2NA 2KWLA 2KOPA 4QKOA 1YHQP 2KG9A 2LPKA 2N6ZA 4H2YC 3CD6P 1AF8A 2PENA 2BHVA 2X2BA 3DS5A 3MGEA 2FVFA
chains in the Genus database with same CATH topology
1RNIA 4U0DA 3CC4P 3G1IA 2EIAA 4COPA 5BS2A 2P9XA 1VQ7P 3CC2P 2KODA 3H47A 4XROA 2OARA 2OTJP 1Q81Q 4U0AA 1BAJA 1YJ9P 2PEMA 3VRLC 1RO2A 1Q86Q 2XT1A 3P05A 3CCUP 1VQ5P 4U0FA 1VQOP 2QEXP 3G6EP 3DS2A 1N8RQ 2PEQA 3G1GA 1K30A 3M1MA 2ONTA 3OW2O 2EFJA 1W2BO 3G4SP 3CCMP 1YJWP 2XXMA 1JJ2O 1EIAA 3DS1A 4XFZA 3B5IA 1EOQA 4QNBA 4XRQA 3CCLP 2PEJA 3E2DA 3H4EA 5HGMA 3DPHA 4U0EA 2EG5A 3CPWO 2JYGA 3G29A 4U0CA 1K8AQ 4GR2A 1A43A 1AUMA 2M8NA 3G0VA 2M8PA 4IPYA 2QA4P 1VQ9P 2PEOA 1KC8Q 3H0DA 2LF4A 2Z45A 4GR6A 3G71P 1YITP 3HZQA 1KQSO 1M6NA 3CCSP 2PEKA 3G26A 5F2OA 1K73Q 3CCJP 1VQPP 3NTEA 1M6EX 1NJIQ 5DCKA 4COCA 4PH1A 4XFXA 3CMAP 1RO0A 1M1KQ 2DGYA 1S72P 3DS0A 1A8OA 3I55P 1YIJP 1VQNP 1IUQA 1VQ6P 1K9MQ 4WYMA 3WBHA 1VQMP 3G28A 5HGOA 1ZMBA 5I4TG 3CCVP 3CXCO 2CWOA 1VQ8P 1QRJA 5F2KA 1YJNP 2E1MA 3DTJA 2Z44A 5HGNA 3Q20A 2JO0A 1YI2P 2M8LA 5F2NA 1M90Q 3I56P 1D1DA 3LRYA 5BS1A 2XV6A 2L6EA 2PY8A 1YHQP 3CCQP 1VQLP 1VQKP 1QVFO 4U0BA 2PEIA 3CC7P 1KD1Q 1E6JP 2BUOA 3CCRP 3DS3A 1M74A 3CD6P 2PENA 2Z46A 2BHVA 4XFYA 2JYLA 3RG6C 3CCEP 1QVGO 1Q82Q 3DS5A 5HGLA 4PH0A 4M0IA 3MGEA 3G21A 3HYBA 5JPAA 2OTLP 1VQ4P 3CMEP 1Q7YQ 3DS4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EOQ A;  4QNB A;  4U0D A;  4XRQ A;  3H4E A;  2L6E A;  3G1I A;  5HGM A;  2EIA A;  3DS0 A;  1A8O A;  4COP A;  3DPH A;  4U0E A;  2KOD A;  3H47 A;  2JYG A;  3G29 A;  4U0C A;  4XRO A;  1A43 A;  1AUM A;  2M8N A;  3G0V A;  4U0B A;  4U0A A;  4WYM A;  3G28 A;  1E6J P;  5HGO A;  2M8P A;  2BUO A;  1BAJ A;  3DS3 A;  5I4T G;  3VRL C;  4IPY A;  4PH1 A;  2XT1 A;  1QRJ A;  4XFY A;  3P05 A;  2LF4 A;  3DTJ A;  4U0F A;  2JYL A;  5HGN A;  2JO0 A;  3DS2 A;  2M8L A;  3G26 A;  3G1G A;  3DS5 A;  3NTE A;  2ONT A;  5HGL A;  4PH0 A;  4M0I A;  3MGE A;  1D1D A;  3G21 A;  5DCK A;  5JPA A;  2XXM A;  3LRY A;  4COC A;  4XFZ A;  1EIA A;  3DS1 A;  4XFX A;  2XV6 A;  3DS4 A; 
#chains in the Genus database with same CATH topology
 2JU2 A;  4U0D A;  5BS2 A;  2P9X A;  2GYK A;  3GKL C;  3GZM A;  2JGP A;  1YJ9 P;  1Q86 Q;  2LIW A;  3CCU P;  1VQO P;  1N8R Q;  3G1G A;  1K30 A;  1DV5 A;  2ONT A;  1UNK A;  2L0Q A;  3G4S P;  1JJ2 O;  2XXM A;  2K5X A;  3CCL P;  4XRQ A;  2XZ1 C;  2PEJ A;  3E2D A;  4U0E A;  2WPT A;  4GR2 A;  2JB0 A;  2GZE A;  2M8P A;  2VSQ A;  4IPY A;  2MF4 A;  1KC8 Q;  2VLO A;  1YIT P;  2K94 A;  3NY7 B;  1M6N A;  1VQP P;  1L0H A;  3CMA P;  2KGA A;  2K93 A;  2FQ0 A;  4IZ6 A;  2QNW A;  1VQN P;  1ACP A;  1MZ8 A;  4WYM A;  2GZI A;  5HGO A;  2XZ0 D;  2LOL A;  2MVV A;  1VQ8 P;  1QRJ A;  2AF8 A;  2E1M A;  3DTJ A;  5EW5 E;  4H2W C;  2KOR A;  4UHP B;  2LKI A;  2GZG A;  1VQL P;  1VQK P;  4U0B A;  1KD1 Q;  3CCR P;  3DS3 A;  1M74 A;  2KG6 A;  2GDY A;  2KR5 A;  1QVG O;  3CCE P;  4PH0 A;  2PNG A;  1OR5 A;  1VQ4 P;  3CME P;  2OTL P;  2N6Y A;  2EIA A;  4COP A;  3CC2 P;  1VQ7 P;  2KOD A;  2FVE A;  2GZJ A;  2KOQ A;  1Q81 Q;  1IMP A;  3VRL C;  1RO2 A;  2XT1 A;  1CEI A;  2AVA A;  2K92 A;  3RG2 A;  2QEX P;  3G6E P;  2CQ8 A;  2PEQ A;  2N5H A;  3OW2 O;  2EFJ A;  5HVC A;  1W2B O;  1EIA A;  4XFZ A;  3H4E A;  2LML A;  2EG5 A;  2JYG A;  3EJB A;  1A43 A;  1AUM A;  2CG5 B;  5KP8 B;  1DNY A;  1VQ9 P;  2MY5 A;  2L4B A;  2Z45 A;  3G71 P;  1KQS O;  2K0X A;  2AFD A;  3CCS P;  3CCJ P;  2LL8 A;  1NJI Q;  2ROQ A;  2EHS A;  4PH1 A;  1RO0 A;  2FHS C;  5HV8 A;  2DGY A;  1S72 P;  4R0M A;  2N98 A;  1YIJ P;  1VQM P;  3GZL A;  1NQ4 A;  1YJN P;  2ERH A;  2Z44 A;  5HGN A;  2JO0 A;  2MD9 A;  1M90 Q;  2VLP A;  3LRY A;  2L9F A;  2XV6 A;  2L6E A;  2PY8 A;  2JAZ A;  3CCQ P;  4BPH A;  1QVF O;  3CC7 P;  1E6J P;  2K0Y A;  1FR2 A;  2Z46 A;  2MR7 A;  3EJD A;  4PWV B;  1IMQ A;  1GXH A;  5HGL A;  4M0I A;  1BXI A;  3G21 A;  3HYB A;  2CNR A;  1Q7Y Q;  3DS4 A;  2DNW A;  3H47 A;  5EJD A;  4XRO A;  2OAR A;  4U0A A;  1BAJ A;  2PEM A;  1HY8 A;  3P05 A;  2JBG A;  2KG8 A;  1EMV A;  2AFE A;  2KGE A;  2CGQ A;  3CCM P;  1YJW P;  4MRT C;  2KGD A;  2FVA A;  1GPJ A;  3DPH A;  4U0C A;  4PXH B;  2EHT A;  3G0V A;  1Z6M A;  1UJZ A;  2K0D X;  2QA4 P;  2KW2 A;  3H0D A;  4GR6 A;  3EJE A;  3HZQ A;  5F2O A;  3NTE A;  1M6E X;  5DCK A;  2GDX A;  4XFX A;  3B4Q A;  3DS0 A;  3I55 P;  1VHN A;  7CEI A;  1GXG A;  2KOO A;  5I4T G;  4F37 A;  2CWO A;  3CXC O;  5F2K A;  1E0H A;  4DG9 A;  4CA3 A;  2MVU A;  4H2X C;  1YI2 P;  3I56 P;  2LTE A;  1D1D A;  5BS1 A;  4BPG A;  2PEI A;  1ZNV A;  4NEO A;  2BUO A;  4XFY A;  2K2Q A;  2JYL A;  3RG6 C;  2FAE A;  2KGC A;  1Q82 Q;  5JPA A;  2VLN A;  1L0I A;  2L22 A;  2N5I A;  2GDW A;  1RNI A;  3CC4 P;  3G1I A;  5CZD B;  2OTJ P;  2KOS A;  2M5R A;  1VQ5 P;  4U0F A;  4HKG A;  3DS2 A;  3M1M A;  2JU1 A;  3U43 A;  1T8K A;  3DS1 A;  3B5I A;  1EOQ A;  1VKU A;  4QNB A;  3LMO A;  5HGM A;  2GZF A;  3CPW O;  3G29 A;  1K8A Q;  5KP6 B;  1KLP A;  2M8N A;  4BPF A;  2FQ2 A;  2LIU A;  2PEO A;  2LF4 A;  3CE7 A;  1AYI A;  2PEK A;  1F80 D;  3G26 A;  3GJN A;  1K73 Q;  4COC A;  2N50 A;  1HQB A;  2VLQ A;  2NO8 A;  5KP7 B;  1M1K Q;  1X3O A;  2FAC A;  1A8O A;  1IUQ A;  1VQ6 P;  1K9M Q;  3WBH A;  2MR8 A;  3G28 A;  1ZMB A;  3CCV P;  2FAD A;  2JQ4 A;  2FQ1 A;  3Q20 A;  2M8L A;  5F2N A;  2KWL A;  2KOP A;  4QKO A;  1YHQ P;  2KG9 A;  2LPK A;  2N6Z A;  4H2Y C;  3CD6 P;  1AF8 A;  2PEN A;  2BHV A;  2X2B A;  3DS5 A;  3MGE A;  2FVF A; 
#chains in the Genus database with same CATH homology
 1RNI A;  4U0D A;  3CC4 P;  3G1I A;  2EIA A;  4COP A;  5BS2 A;  2P9X A;  1VQ7 P;  3CC2 P;  2KOD A;  3H47 A;  4XRO A;  2OAR A;  2OTJ P;  1Q81 Q;  4U0A A;  1BAJ A;  1YJ9 P;  2PEM A;  3VRL C;  1RO2 A;  1Q86 Q;  2XT1 A;  3P05 A;  3CCU P;  1VQ5 P;  4U0F A;  1VQO P;  2QEX P;  3G6E P;  3DS2 A;  1N8R Q;  2PEQ A;  3G1G A;  1K30 A;  3M1M A;  2ONT A;  3OW2 O;  2EFJ A;  1W2B O;  3G4S P;  3CCM P;  1YJW P;  2XXM A;  1JJ2 O;  1EIA A;  3DS1 A;  4XFZ A;  3B5I A;  1EOQ A;  4QNB A;  4XRQ A;  3CCL P;  2PEJ A;  3E2D A;  3H4E A;  5HGM A;  3DPH A;  4U0E A;  2EG5 A;  3CPW O;  2JYG A;  3G29 A;  4U0C A;  1K8A Q;  4GR2 A;  1A43 A;  1AUM A;  2M8N A;  3G0V A;  2M8P A;  4IPY A;  2QA4 P;  1VQ9 P;  2PEO A;  1KC8 Q;  3H0D A;  2LF4 A;  2Z45 A;  4GR6 A;  3G71 P;  1YIT P;  3HZQ A;  1KQS O;  1M6N A;  3CCS P;  2PEK A;  3G26 A;  5F2O A;  1K73 Q;  3CCJ P;  1VQP P;  3NTE A;  1M6E X;  1NJI Q;  5DCK A;  4COC A;  4PH1 A;  4XFX A;  3CMA P;  1RO0 A;  1M1K Q;  2DGY A;  1S72 P;  3DS0 A;  1A8O A;  3I55 P;  1YIJ P;  1VQN P;  1IUQ A;  1VQ6 P;  1K9M Q;  4WYM A;  3WBH A;  1VQM P;  3G28 A;  5HGO A;  1ZMB A;  5I4T G;  3CCV P;  3CXC O;  2CWO A;  1VQ8 P;  1QRJ A;  5F2K A;  1YJN P;  2E1M A;  3DTJ A;  2Z44 A;  5HGN A;  3Q20 A;  2JO0 A;  1YI2 P;  2M8L A;  5F2N A;  1M90 Q;  3I56 P;  1D1D A;  3LRY A;  5BS1 A;  2XV6 A;  2L6E A;  2PY8 A;  1YHQ P;  3CCQ P;  1VQL P;  1VQK P;  1QVF O;  4U0B A;  2PEI A;  3CC7 P;  1KD1 Q;  1E6J P;  2BUO A;  3CCR P;  3DS3 A;  1M74 A;  3CD6 P;  2PEN A;  2Z46 A;  2BHV A;  4XFY A;  2JYL A;  3RG6 C;  3CCE P;  1QVG O;  1Q82 Q;  3DS5 A;  5HGL A;  4PH0 A;  4M0I A;  3MGE A;  3G21 A;  3HYB A;  5JPA A;  2OTL P;  1VQ4 P;  3CME P;  1Q7Y Q;  3DS4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...