3G26A

Crystal structure of the c-terminal domain of the rous sarcoma virus capsid protein: mutant a184c
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
77
structure length
77
Chain Sequence
AGPWADIMQGPSESFVDFANRLIKAVEGSDLPPSCRAPVIIDCFRQKSQPDIQQLIRTAPSTLTTPGEIIKYVLDRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Proton-linked dimerization of a retroviral capsid protein initiates capsid assembly
pubmed doi rcsb
source organism Rous sarcoma virus
molecule tags Viral protein
molecule keywords Gag polyprotein
total genus 25
structure length 77
sequence length 77
ec nomenclature ec 3.4.23.-:
pdb deposition date 2009-01-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3g26A00
2XV6A 2EIAA 3VRLC 4XROA 4M0IA 3DS1A 4QNBA 2JYLA 2ONTA 4XFXA 5JPAA 4U0DA 2KODA 2XXMA 1BAJA 1EIAA 2LF4A 3NTEA 4WYMA 5DCKA 5HGNA 5HGOA 3DS2A 3P05A 4U0AA 2L6EA 5I4TG 3G29A 4IPYA 4XFYA 5HGMA 2BUOA 3DS3A 3H4EA 3G21A 3G28A 3MGEA 3DTJA 4COPA 1A43A 4U0CA 1E6JP 1AUMA 4PH1A 5HGLA 4XRQA 2XT1A 2M8NA 4U0BA 2JYGA 4PH0A 3DS4A 4XFZA 4U0EA 1QRJA 1A8OA 3DS0A 3LRYA 4U0FA 2M8LA 4COCA 1D1DA 3G26A 3DS5A 3DPHA 2M8PA 2JO0A 3H47A 3G1GA 1EOQA 3G0VA 3G1IA
chains in the Genus database with same CATH superfamily
2PEQA 3G4SP 1YJ9P 2ROQA 2GDYA 4BPHA 4H2WC 2FQ2A 2MR7A 2PEIA 2VLOA 4PH1A 2XT1A 3CCJP 2Z46A 1T8KA 1VQ5P 3CCMP 3G71P 2VSQA 4PH0A 3CE7A 3G1IA 2KG6A 2EIAA 2GZJA 1GPJA 1Q7YQ 2GZEA 2GZIA 2VLPA 3G6EP 2PEJA 4HKGA 1VHNA 2KGDA 2LKIA 2FVAA 2JB0A 3G29A 2JU2A 5KP8B 2MY5A 2QA4P 3G28A 2N50A 4U0CA 2FADA 2FHSC 5HV8A 2PEMA 3H0DA 2Z44A 3DPHA 4CA3A 1AYIA 3I55P 1YI2P 2VLNA 2XXMA 1BAJA 3I56P 3P05A 5I4TG 1UJZA 2JQ4A 2KOSA 1AUMA 1Q82Q 2M8NA 2KWLA 3GZMA 4UHPB 2XV6A 2KG9A 4M0IA 5CZDB 3EJDA 1YIJP 1AF8A 4H2YC 2M5RA 2LF4A 2WPTA 3B4QA 2EHSA 1S72P 1K73Q 4NEOA 2N5HA 3MGEA 3U43A 3CMEP 1VQ7P 1QRJA 3G26A 2JO0A 1EOQA 4BPGA 2E1MA 2JYLA 1IMPA 3E2DA 1GXHA 2K2QA 2VLQA 1HQBA 1K30A 1IUQA 2PEOA 5HVCA 1M6NA 1M6EX 2K0DX 2QEXP 2M8PA 3CCVP 1GXGA 1KD1Q 4U0DA 2CG5B 1RO2A 4PWVB 1NJIQ 3CCQP 2L9FA 1X3OA 2KOQA 1A43A 2CGQA 1ACPA 1M74A 2FACA 3EJEA 3VRLC 1VQOP 3GJNA 1Q81Q 2PNGA 1KQSO 2GDXA 3DS3A 2JGPA 3HYBA 1VQMP 4BPFA 1F80D 2JYGA 2LOLA 2DNWA 3CC4P 2OTLP 2MVVA 4QKOA 2KOOA 3LMOA 2GDWA 2LPKA 1VQPP 1EIAA 2AFEA 3NTEA 1DNYA 2BHVA 1YHQP 2FVEA 4IPYA 5HGMA 2BUOA 3G21A 1E0HA 3GKLC 1CEIA 3DS4A 4U0EA 3DS0A 1A8OA 3LRYA 2FAEA 1MZ8A 3WBHA 2XZ1C 3B5IA 2KW2A 5JPAA 2L4BA 3CCEP 2KODA 5HGNA 5F2OA 1ZNVA 4DG9A 2K92A 2LTEA 1M1KQ 4R0MA 2CQ8A 1E6JP 2MVUA 2CNRA 2K0YA 1K8AQ 2JU1A 2ERHA 1VQKP 3CC2P 1YJWP 1BXIA 2AFDA 4PXHB 3CCSP 7CEIA 1HY8A 3DS2A 2AVAA 2XZ0D 2L0QA 1Q86Q 1VKUA 3H4EA 1VQNP 2PENA 3RG6C 5HGLA 2M8LA 3CCLP 5BS2A 5EJDA 1N8RQ 2OTJP 3CPWO 2KORA 1VQLP 4IZ6A 2ONTA 1RNIA 3CCUP 3CD6P 4U0AA 5KP6B 3HZQA 2CWOA 3CXCO 3NY7B 4H2XC 1D1DA 3DS5A 2KGCA 3Q20A 2QNWA 2N6YA 3DS1A 4XFXA 1VQ6P 2N98A 1RO0A 1KLPA 5HGOA 1QVGO 4MRTC 3GZLA 4XFYA 3CCRP 1YITP 1K9MQ 2KGEA 2JAZA 2KGAA 3CMAP 3M1MA 4COPA 2KOPA 2X2BA 4GR6A 2K93A 2KR5A 4XROA 1M90Q 5KP7B 2FQ1A 2K94A 2PEKA 1DV5A 1NQ4A 2FVFA 2N5IA 2AF8A 1FR2A 4F37A 2OARA 4QNBA 3OW2O 2GYKA 3CC7P 5F2KA 1L0HA 1JJ2O 1EMVA 3DTJA 2EHTA 2L22A 2P9XA 1VQ8P 1VQ9P 2MR8A 2GZGA 5BS1A 3G1GA 1KC8Q 2K0XA 2LIUA 1Z6MA 5DCKA 5F2NA 3RG2A 2L6EA 2LIWA 2LMLA 2NO8A 1VQ4P 1ZMBA 2LL8A 4GR2A 4U0BA 2DGYA 2EFJA 2JBGA 4COCA 4U0FA 1QVFO 5EW5E 2MF4A 3G0VA 2GZFA 1L0IA 2KG8A 3H47A 2EG5A 1UNKA 4WYMA 3EJBA 2FQ0A 2MD9A 2N6ZA 4XRQA 4XFZA 1YJNP 1OR5A 2K5XA 1IMQA 2Z45A 1W2BO 2PY8A
chains in the Genus database with same CATH topology
3B5IA 4XROA 2PEQA 3G4SP 2E1MA 2JYLA 5JPAA 1YJ9P 3CCEP 2KODA 5HGNA 1M90Q 5F2OA 3E2DA 1K30A 1M1KQ 2PEIA 1IUQA 2PEOA 1E6JP 1M6NA 2PEKA 4PH1A 1M6EX 2XT1A 3CCJP 1K8AQ 2Z46A 1VQ5P 2QEXP 2M8PA 3CCMP 3G71P 3CCVP 4PH0A 1VQKP 3CC2P 3G1IA 2EIAA 1YJWP 1Q7YQ 2OARA 4QNBA 3G6EP 1KD1Q 4U0DA 3CCSP 2PEJA 1RO2A 3OW2O 3DS2A 3CC7P 1NJIQ 5F2KA 1JJ2O 3G29A 3CCQP 1Q86Q 3H4EA 3G28A 2QA4P 3DTJA 1A43A 4U0CA 2PENA 1VQNP 3RG6C 5HGLA 2P9XA 1VQ8P 1VQ9P 2M8LA 2PEMA 5BS2A 3CCLP 3H0DA 1M74A 2Z44A 3DPHA 5BS1A 3G1GA 1N8RQ 2OTJP 3CPWO 1KC8Q 3VRLC 3I55P 1YI2P 1VQOP 1VQLP 2ONTA 1Q81Q 1RNIA 3CCUP 2XXMA 1BAJA 3CD6P 5DCKA 5F2NA 3I56P 1KQSO 3P05A 4U0AA 2L6EA 5I4TG 1VQ4P 3DS3A 1ZMBA 3HYBA 3HZQA 2CWOA 1AUMA 1VQMP 4GR2A 3CXCO 1Q82Q 2M8NA 4U0BA 2DGYA 2EFJA 2JYGA 4COCA 4U0FA 3CC4P 1D1DA 2OTLP 3DS5A 1QVFO 3G0VA 3Q20A 2XV6A 4M0IA 3DS1A 4XFXA 1YIJP 1VQPP 1VQ6P 2EG5A 1EIAA 1RO0A 2LF4A 3NTEA 4WYMA 5HGOA 1QVGO 2BHVA 1YHQP 1EOQA 1S72P 1K73Q 4IPYA 4XFYA 5HGMA 2BUOA 3G21A 3MGEA 3CCRP 1YITP 1W2BO 1K9MQ 3CMEP 4XRQA 3DS4A 1VQ7P 4XFZA 4U0EA 1YJNP 1QRJA 1A8OA 3DS0A 3LRYA 3CMAP 3M1MA 3G26A 2Z45A 2JO0A 3H47A 4COPA 3WBHA 4GR6A 2PY8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XV6 A;  2EIA A;  3VRL C;  4XRO A;  4M0I A;  3DS1 A;  4QNB A;  2JYL A;  2ONT A;  4XFX A;  5JPA A;  4U0D A;  2KOD A;  2XXM A;  1BAJ A;  1EIA A;  2LF4 A;  3NTE A;  4WYM A;  5DCK A;  5HGN A;  5HGO A;  3DS2 A;  3P05 A;  4U0A A;  2L6E A;  5I4T G;  3G29 A;  4IPY A;  4XFY A;  5HGM A;  2BUO A;  3DS3 A;  3H4E A;  3G21 A;  3G28 A;  3MGE A;  3DTJ A;  4COP A;  1A43 A;  4U0C A;  1E6J P;  1AUM A;  4PH1 A;  5HGL A;  4XRQ A;  2XT1 A;  2M8N A;  4U0B A;  2JYG A;  4PH0 A;  3DS4 A;  4XFZ A;  4U0E A;  1QRJ A;  1A8O A;  3DS0 A;  3LRY A;  4U0F A;  2M8L A;  4COC A;  1D1D A;  3G26 A;  3DS5 A;  3DPH A;  2M8P A;  2JO0 A;  3H47 A;  3G1G A;  1EOQ A;  3G0V A;  3G1I A; 
#chains in the Genus database with same CATH topology
 2PEQ A;  3G4S P;  1YJ9 P;  2ROQ A;  2GDY A;  4BPH A;  4H2W C;  2FQ2 A;  2MR7 A;  2PEI A;  2VLO A;  4PH1 A;  2XT1 A;  3CCJ P;  2Z46 A;  1T8K A;  1VQ5 P;  3CCM P;  3G71 P;  2VSQ A;  4PH0 A;  3CE7 A;  3G1I A;  2KG6 A;  2EIA A;  2GZJ A;  1GPJ A;  1Q7Y Q;  2GZE A;  2GZI A;  2VLP A;  3G6E P;  2PEJ A;  4HKG A;  1VHN A;  2KGD A;  2LKI A;  2FVA A;  2JB0 A;  3G29 A;  2JU2 A;  5KP8 B;  2MY5 A;  2QA4 P;  3G28 A;  2N50 A;  4U0C A;  2FAD A;  2FHS C;  5HV8 A;  2PEM A;  3H0D A;  2Z44 A;  3DPH A;  4CA3 A;  1AYI A;  3I55 P;  1YI2 P;  2VLN A;  2XXM A;  1BAJ A;  3I56 P;  3P05 A;  5I4T G;  1UJZ A;  2JQ4 A;  2KOS A;  1AUM A;  1Q82 Q;  2M8N A;  2KWL A;  3GZM A;  4UHP B;  2XV6 A;  2KG9 A;  4M0I A;  5CZD B;  3EJD A;  1YIJ P;  1AF8 A;  4H2Y C;  2M5R A;  2LF4 A;  2WPT A;  3B4Q A;  2EHS A;  1S72 P;  1K73 Q;  4NEO A;  2N5H A;  3MGE A;  3U43 A;  3CME P;  1VQ7 P;  1QRJ A;  3G26 A;  2JO0 A;  1EOQ A;  4BPG A;  2E1M A;  2JYL A;  1IMP A;  3E2D A;  1GXH A;  2K2Q A;  2VLQ A;  1HQB A;  1K30 A;  1IUQ A;  2PEO A;  5HVC A;  1M6N A;  1M6E X;  2K0D X;  2QEX P;  2M8P A;  3CCV P;  1GXG A;  1KD1 Q;  4U0D A;  2CG5 B;  1RO2 A;  4PWV B;  1NJI Q;  3CCQ P;  2L9F A;  1X3O A;  2KOQ A;  1A43 A;  2CGQ A;  1ACP A;  1M74 A;  2FAC A;  3EJE A;  3VRL C;  1VQO P;  3GJN A;  1Q81 Q;  2PNG A;  1KQS O;  2GDX A;  3DS3 A;  2JGP A;  3HYB A;  1VQM P;  4BPF A;  1F80 D;  2JYG A;  2LOL A;  2DNW A;  3CC4 P;  2OTL P;  2MVV A;  4QKO A;  2KOO A;  3LMO A;  2GDW A;  2LPK A;  1VQP P;  1EIA A;  2AFE A;  3NTE A;  1DNY A;  2BHV A;  1YHQ P;  2FVE A;  4IPY A;  5HGM A;  2BUO A;  3G21 A;  1E0H A;  3GKL C;  1CEI A;  3DS4 A;  4U0E A;  3DS0 A;  1A8O A;  3LRY A;  2FAE A;  1MZ8 A;  3WBH A;  2XZ1 C;  3B5I A;  2KW2 A;  5JPA A;  2L4B A;  3CCE P;  2KOD A;  5HGN A;  5F2O A;  1ZNV A;  4DG9 A;  2K92 A;  2LTE A;  1M1K Q;  4R0M A;  2CQ8 A;  1E6J P;  2MVU A;  2CNR A;  2K0Y A;  1K8A Q;  2JU1 A;  2ERH A;  1VQK P;  3CC2 P;  1YJW P;  1BXI A;  2AFD A;  4PXH B;  3CCS P;  7CEI A;  1HY8 A;  3DS2 A;  2AVA A;  2XZ0 D;  2L0Q A;  1Q86 Q;  1VKU A;  3H4E A;  1VQN P;  2PEN A;  3RG6 C;  5HGL A;  2M8L A;  3CCL P;  5BS2 A;  5EJD A;  1N8R Q;  2OTJ P;  3CPW O;  2KOR A;  1VQL P;  4IZ6 A;  2ONT A;  1RNI A;  3CCU P;  3CD6 P;  4U0A A;  5KP6 B;  3HZQ A;  2CWO A;  3CXC O;  3NY7 B;  4H2X C;  1D1D A;  3DS5 A;  2KGC A;  3Q20 A;  2QNW A;  2N6Y A;  3DS1 A;  4XFX A;  1VQ6 P;  2N98 A;  1RO0 A;  1KLP A;  5HGO A;  1QVG O;  4MRT C;  3GZL A;  4XFY A;  3CCR P;  1YIT P;  1K9M Q;  2KGE A;  2JAZ A;  2KGA A;  3CMA P;  3M1M A;  4COP A;  2KOP A;  2X2B A;  4GR6 A;  2K93 A;  2KR5 A;  4XRO A;  1M90 Q;  5KP7 B;  2FQ1 A;  2K94 A;  2PEK A;  1DV5 A;  1NQ4 A;  2FVF A;  2N5I A;  2AF8 A;  1FR2 A;  4F37 A;  2OAR A;  4QNB A;  3OW2 O;  2GYK A;  3CC7 P;  5F2K A;  1L0H A;  1JJ2 O;  1EMV A;  3DTJ A;  2EHT A;  2L22 A;  2P9X A;  1VQ8 P;  1VQ9 P;  2MR8 A;  2GZG A;  5BS1 A;  3G1G A;  1KC8 Q;  2K0X A;  2LIU A;  1Z6M A;  5DCK A;  5F2N A;  3RG2 A;  2L6E A;  2LIW A;  2LML A;  2NO8 A;  1VQ4 P;  1ZMB A;  2LL8 A;  4GR2 A;  4U0B A;  2DGY A;  2EFJ A;  2JBG A;  4COC A;  4U0F A;  1QVF O;  5EW5 E;  2MF4 A;  3G0V A;  2GZF A;  1L0I A;  2KG8 A;  3H47 A;  2EG5 A;  1UNK A;  4WYM A;  3EJB A;  2FQ0 A;  2MD9 A;  2N6Z A;  4XRQ A;  4XFZ A;  1YJN P;  1OR5 A;  2K5X A;  1IMQ A;  2Z45 A;  1W2B O;  2PY8 A; 
#chains in the Genus database with same CATH homology
 3B5I A;  4XRO A;  2PEQ A;  3G4S P;  2E1M A;  2JYL A;  5JPA A;  1YJ9 P;  3CCE P;  2KOD A;  5HGN A;  1M90 Q;  5F2O A;  3E2D A;  1K30 A;  1M1K Q;  2PEI A;  1IUQ A;  2PEO A;  1E6J P;  1M6N A;  2PEK A;  4PH1 A;  1M6E X;  2XT1 A;  3CCJ P;  1K8A Q;  2Z46 A;  1VQ5 P;  2QEX P;  2M8P A;  3CCM P;  3G71 P;  3CCV P;  4PH0 A;  1VQK P;  3CC2 P;  3G1I A;  2EIA A;  1YJW P;  1Q7Y Q;  2OAR A;  4QNB A;  3G6E P;  1KD1 Q;  4U0D A;  3CCS P;  2PEJ A;  1RO2 A;  3OW2 O;  3DS2 A;  3CC7 P;  1NJI Q;  5F2K A;  1JJ2 O;  3G29 A;  3CCQ P;  1Q86 Q;  3H4E A;  3G28 A;  2QA4 P;  3DTJ A;  1A43 A;  4U0C A;  2PEN A;  1VQN P;  3RG6 C;  5HGL A;  2P9X A;  1VQ8 P;  1VQ9 P;  2M8L A;  2PEM A;  5BS2 A;  3CCL P;  3H0D A;  1M74 A;  2Z44 A;  3DPH A;  5BS1 A;  3G1G A;  1N8R Q;  2OTJ P;  3CPW O;  1KC8 Q;  3VRL C;  3I55 P;  1YI2 P;  1VQO P;  1VQL P;  2ONT A;  1Q81 Q;  1RNI A;  3CCU P;  2XXM A;  1BAJ A;  3CD6 P;  5DCK A;  5F2N A;  3I56 P;  1KQS O;  3P05 A;  4U0A A;  2L6E A;  5I4T G;  1VQ4 P;  3DS3 A;  1ZMB A;  3HYB A;  3HZQ A;  2CWO A;  1AUM A;  1VQM P;  4GR2 A;  3CXC O;  1Q82 Q;  2M8N A;  4U0B A;  2DGY A;  2EFJ A;  2JYG A;  4COC A;  4U0F A;  3CC4 P;  1D1D A;  2OTL P;  3DS5 A;  1QVF O;  3G0V A;  3Q20 A;  2XV6 A;  4M0I A;  3DS1 A;  4XFX A;  1YIJ P;  1VQP P;  1VQ6 P;  2EG5 A;  1EIA A;  1RO0 A;  2LF4 A;  3NTE A;  4WYM A;  5HGO A;  1QVG O;  2BHV A;  1YHQ P;  1EOQ A;  1S72 P;  1K73 Q;  4IPY A;  4XFY A;  5HGM A;  2BUO A;  3G21 A;  3MGE A;  3CCR P;  1YIT P;  1W2B O;  1K9M Q;  3CME P;  4XRQ A;  3DS4 A;  1VQ7 P;  4XFZ A;  4U0E A;  1YJN P;  1QRJ A;  1A8O A;  3DS0 A;  3LRY A;  3CMA P;  3M1M A;  3G26 A;  2Z45 A;  2JO0 A;  3H47 A;  4COP A;  3WBH A;  4GR6 A;  2PY8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...