3G26A

Crystal structure of the c-terminal domain of the rous sarcoma virus capsid protein: mutant a184c
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
77
structure length
77
Chain Sequence
AGPWADIMQGPSESFVDFANRLIKAVEGSDLPPSCRAPVIIDCFRQKSQPDIQQLIRTAPSTLTTPGEIIKYVLDRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein
molecule keywords Gag polyprotein
publication title Proton-linked dimerization of a retroviral capsid protein initiates capsid assembly
pubmed doi rcsb
source organism Rous sarcoma virus
total genus 25
structure length 77
sequence length 77
ec nomenclature ec 3.4.23.-:
pdb deposition date 2009-01-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3g26A00
2EIAA 2ONTA 4WYMA 3G1IA 3VRLC 3G29A 3G26A 3DS1A 4QNBA 3DS0A 4XFZA 3G28A 5DCKA 1QRJA 3H4EA 4XROA 3NTEA 1AUMA 5I4TG 4U0AA 1EOQA 2L6EA 3H47A 2JYLA 2M8LA 3DS4A 4COCA 5HGNA 2XV6A 4XFXA 4PH1A 1BAJA 3DS3A 4U0CA 3MGEA 5HGMA 1A43A 4XFYA 4U0FA 2KODA 2M8NA 3DS2A 3DS5A 4XRQA 1A8OA 4U0DA 5HGOA 3G21A 1D1DA 2JO0A 2LF4A 2JYGA 4U0BA 2BUOA 4IPYA 4U0EA 4PH0A 2XT1A 3LRYA 3P05A 4M0IA 4COPA 3G1GA 2XXMA 5JPAA 3DPHA 5HGLA 1EIAA 3DTJA 1E6JP 2M8PA 3G0VA
chains in the Genus database with same CATH superfamily
3VRLC 1M1KQ 3H4EA 3NTEA 1ZNVA 1VQ9P 3CCJP 4XFXA 2JU2A 2CWOA 2PEOA 1VKUA 2KG9A 3OW2O 2FAEA 2PEKA 2JU1A 2KG8A 1ZMBA 2KGDA 3CMAP 2K5XA 2KGAA 3G6EP 2FVAA 5HVCA 3DS0A 1K9MQ 4PH1A 4XFYA 1QVGO 1YIJP 1OR5A 4M0IA 3I55P 3GJNA 1E6JP 2GDWA 4R0MA 5CZDB 2OTJP 1VQPP 2WPTA 1NQ4A 2AF8A 1VQOP 1DV5A 2MY5A 3H47A 1IUQA 1VQLP 4NEOA 2KOSA 1RO2A 3B5IA 2VLPA 3CPWO 1NJIQ 2X2BA 1M6NA 1VQMP 2M8PA 1X3OA 2MVVA 2VLOA 2LPKA 3U43A 1YHQP 1VQ8P 3DS3A 4H2XC 1N8RQ 1KD1Q 3HZQA 2JO0A 1Z6MA 3RG6C 3G4SP 2PY8A 3G1IA 4IZ6A 1W2BO 2QEXP 3G71P 1A43A 3EJDA 3DS5A 2JAZA 1UNKA 2GYKA 2K93A 1VQ4P 4DG9A 4COCA 2GZJA 5JPAA 3CCQP 1VQKP 1YJNP 2OARA 2GDXA 1BXIA 2KG6A 1RO0A 5DCKA 2GZEA 2K92A 5I4TG 2LKIA 2KGEA 2L6EA 2JYLA 5EW5E 1BAJA 2AFEA 5F2OA 2FHSC 3CD6P 3CCSP 2P9XA 4U0DA 1D1DA 1ACPA 2VLQA 5HV8A 2BHVA 3CCEP 3P05A 3G1GA 1KC8Q 2CG5B 1E0HA 3DPHA 5HGLA 2Z44A 2KOPA 3G29A 4QNBA 4XROA 2LL8A 1VHNA 2LTEA 2XZ1C 2GZFA 2FVFA 1YITP 1T8KA 2N50A 3MGEA 2EG5A 2PEMA 4PWVB 3G28A 1S72P 2Z46A 1VQNP 4U0CA 2QNWA 2KODA 2M5RA 3DS2A 1VQ5P 2FQ1A 5HGOA 2JYGA 2DNWA 3CCLP 4COPA 1EMVA 2LIWA 3HYBA 5EJDA 2N5HA 4F37A 1Q81Q 1UJZA 3CXCO 1IMQA 1QRJA 1YJ9P 1AUMA 1GXGA 2CGQA 5HGMA 1K30A 2PEJA 2GDYA 1VQ6P 1K8AQ 3CCUP 2EHSA 3CCRP 3EJBA 2GZGA 2XXMA 3CE7A 2GZIA 2DGYA 3H0DA 3CCVP 2AVAA 2JGPA 2KW2A 3EJEA 5KP6B 2N5IA 4GR6A 2XV6A 2KOOA 1GPJA 1RNIA 7CEIA 2ROQA 4XRQA 1IMPA 1MZ8A 4U0BA 3LMOA 2XT1A 2N6ZA 2FQ0A 1F80D 4BPFA 4GR2A 2L22A 2VSQA 3DS1A 4BPHA 1EOQA 2EHTA 4QKOA 2VLNA 2EFJA 1M6EX 2JB0A 2E1MA 2JBGA 1JJ2O 1GXHA 3CC4P 4PH0A 1M74A 3DTJA 4HKGA 3CMEP 2N98A 2Z45A 3I56P 2M8LA 2XZ0D 1YJWP 4BPGA 2CNRA 2NO8A 1CEIA 3GZLA 2PENA 3G21A 2QA4P 2LF4A 2LIUA 5BS1A 2MF4A 3WBHA 4IPYA 5KP8B 5KP7B 2OTLP 2LOLA 1Q86Q 3G0VA 2ONTA 4WYMA 1YI2P 2PNGA 1KLPA 1L0HA 4H2YC 4XFZA 2MR7A 3GZMA 3GKLC 3DS4A 2KORA 2ERHA 1Q82Q 2FVEA 2L0QA 5BS2A 2KOQA 1KQSO 3G26A 3CC2P 3B4QA 3Q20A 1K73Q 1HY8A 2K2QA 2K0DX 1FR2A 2PEIA 3M1MA 1AYIA 1QVFO 2M8NA 2K0XA 4UHPB 5F2KA 1A8OA 1M90Q 3RG2A 3CC7P 3LRYA 1AF8A 2LMLA 4H2WC 2EIAA 4CA3A 2K0YA 1VQ7P 2CQ8A 4U0AA 5F2NA 2L4BA 4U0FA 2JQ4A 2KWLA 2FADA 2K94A 2KGCA 4PXHB 2FQ2A 2AFDA 2N6YA 1EIAA 3NY7B 2KR5A 1DNYA 2PEQA 5HGNA 1L0IA 1HQBA 3E2DA 4MRTC 1Q7YQ 2L9FA 2MVUA 2MR8A 2BUOA 4U0EA 3CCMP 2FACA 2MD9A
chains in the Genus database with same CATH topology
2ONTA 4WYMA 3VRLC 3G1IA 1YI2P 1Q81Q 4XFZA 3CXCO 1M1KQ 1QRJA 3H4EA 1YJ9P 3NTEA 2QEXP 1AUMA 3G71P 1W2BO 1VQ9P 3DS4A 3CCJP 4XFXA 5HGMA 2CWOA 1A43A 1Q82Q 1K30A 3DS5A 2PEJA 2PEOA 3OW2O 5BS2A 1VQ6P 1K8AQ 2PEKA 3CCUP 3CMAP 1ZMBA 3CCRP 1VQ4P 2XXMA 1KQSO 4COCA 2DGYA 5JPAA 3G6EP 3CCQP 1VQKP 3H0DA 2OARA 1YJNP 1RO0A 3CCVP 3G26A 3DS0A 5DCKA 3CC2P 5I4TG 3Q20A 2L6EA 1K73Q 2JYLA 1K9MQ 4GR6A 2XV6A 4PH1A 1BAJA 2PEIA 4XFYA 5F2OA 3M1MA 1QVFO 1RNIA 2M8NA 1QVGO 3CD6P 4XRQA 3CCSP 2P9XA 5F2KA 1A8OA 4U0DA 1M90Q 1YIJP 1D1DA 4U0BA 3CC7P 2BHVA 3CCEP 2XT1A 3LRYA 3P05A 4M0IA 3I55P 3G1GA 1KC8Q 3DPHA 5HGLA 1E6JP 2EIAA 2Z44A 3G29A 4GR2A 2OTJP 1VQPP 3DS1A 4QNBA 4XROA 1VQ7P 1VQOP 4U0AA 1EOQA 3H47A 5F2NA 1IUQA 2EFJA 1VQLP 1M6EX 1RO2A 4U0FA 3B5IA 2E1MA 1JJ2O 1YITP 3CC4P 4PH0A 3CPWO 1NJIQ 1M74A 1M6NA 1VQMP 1EIAA 3MGEA 3DTJA 2M8PA 2EG5A 3CMEP 2Z45A 3I56P 2PEMA 2PEQA 3G28A 1S72P 2Z46A 2M8LA 5HGNA 1YHQP 1VQ8P 3DS3A 3E2DA 1YJWP 4U0CA 1VQNP 2KODA 1N8RQ 1KD1Q 3HZQA 3DS2A 1Q7YQ 1VQ5P 2PENA 5HGOA 3G21A 2QA4P 2JO0A 2LF4A 5BS1A 2JYGA 3WBHA 3RG6C 2BUOA 4IPYA 4U0EA 3CCLP 4COPA 3CCMP 3G4SP 2OTLP 2PY8A 1Q86Q 3HYBA 3G0VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EIA A;  2ONT A;  4WYM A;  3G1I A;  3VRL C;  3G29 A;  3G26 A;  3DS1 A;  4QNB A;  3DS0 A;  4XFZ A;  3G28 A;  5DCK A;  1QRJ A;  3H4E A;  4XRO A;  3NTE A;  1AUM A;  5I4T G;  4U0A A;  1EOQ A;  2L6E A;  3H47 A;  2JYL A;  2M8L A;  3DS4 A;  4COC A;  5HGN A;  2XV6 A;  4XFX A;  4PH1 A;  1BAJ A;  3DS3 A;  4U0C A;  3MGE A;  5HGM A;  1A43 A;  4XFY A;  4U0F A;  2KOD A;  2M8N A;  3DS2 A;  3DS5 A;  4XRQ A;  1A8O A;  4U0D A;  5HGO A;  3G21 A;  1D1D A;  2JO0 A;  2LF4 A;  2JYG A;  4U0B A;  2BUO A;  4IPY A;  4U0E A;  4PH0 A;  2XT1 A;  3LRY A;  3P05 A;  4M0I A;  4COP A;  3G1G A;  2XXM A;  5JPA A;  3DPH A;  5HGL A;  1EIA A;  3DTJ A;  1E6J P;  2M8P A;  3G0V A; 
#chains in the Genus database with same CATH topology
 3VRL C;  1M1K Q;  3H4E A;  3NTE A;  1ZNV A;  1VQ9 P;  3CCJ P;  4XFX A;  2JU2 A;  2CWO A;  2PEO A;  1VKU A;  2KG9 A;  3OW2 O;  2FAE A;  2PEK A;  2JU1 A;  2KG8 A;  1ZMB A;  2KGD A;  3CMA P;  2K5X A;  2KGA A;  3G6E P;  2FVA A;  5HVC A;  3DS0 A;  1K9M Q;  4PH1 A;  4XFY A;  1QVG O;  1YIJ P;  1OR5 A;  4M0I A;  3I55 P;  3GJN A;  1E6J P;  2GDW A;  4R0M A;  5CZD B;  2OTJ P;  1VQP P;  2WPT A;  1NQ4 A;  2AF8 A;  1VQO P;  1DV5 A;  2MY5 A;  3H47 A;  1IUQ A;  1VQL P;  4NEO A;  2KOS A;  1RO2 A;  3B5I A;  2VLP A;  3CPW O;  1NJI Q;  2X2B A;  1M6N A;  1VQM P;  2M8P A;  1X3O A;  2MVV A;  2VLO A;  2LPK A;  3U43 A;  1YHQ P;  1VQ8 P;  3DS3 A;  4H2X C;  1N8R Q;  1KD1 Q;  3HZQ A;  2JO0 A;  1Z6M A;  3RG6 C;  3G4S P;  2PY8 A;  3G1I A;  4IZ6 A;  1W2B O;  2QEX P;  3G71 P;  1A43 A;  3EJD A;  3DS5 A;  2JAZ A;  1UNK A;  2GYK A;  2K93 A;  1VQ4 P;  4DG9 A;  4COC A;  2GZJ A;  5JPA A;  3CCQ P;  1VQK P;  1YJN P;  2OAR A;  2GDX A;  1BXI A;  2KG6 A;  1RO0 A;  5DCK A;  2GZE A;  2K92 A;  5I4T G;  2LKI A;  2KGE A;  2L6E A;  2JYL A;  5EW5 E;  1BAJ A;  2AFE A;  5F2O A;  2FHS C;  3CD6 P;  3CCS P;  2P9X A;  4U0D A;  1D1D A;  1ACP A;  2VLQ A;  5HV8 A;  2BHV A;  3CCE P;  3P05 A;  3G1G A;  1KC8 Q;  2CG5 B;  1E0H A;  3DPH A;  5HGL A;  2Z44 A;  2KOP A;  3G29 A;  4QNB A;  4XRO A;  2LL8 A;  1VHN A;  2LTE A;  2XZ1 C;  2GZF A;  2FVF A;  1YIT P;  1T8K A;  2N50 A;  3MGE A;  2EG5 A;  2PEM A;  4PWV B;  3G28 A;  1S72 P;  2Z46 A;  1VQN P;  4U0C A;  2QNW A;  2KOD A;  2M5R A;  3DS2 A;  1VQ5 P;  2FQ1 A;  5HGO A;  2JYG A;  2DNW A;  3CCL P;  4COP A;  1EMV A;  2LIW A;  3HYB A;  5EJD A;  2N5H A;  4F37 A;  1Q81 Q;  1UJZ A;  3CXC O;  1IMQ A;  1QRJ A;  1YJ9 P;  1AUM A;  1GXG A;  2CGQ A;  5HGM A;  1K30 A;  2PEJ A;  2GDY A;  1VQ6 P;  1K8A Q;  3CCU P;  2EHS A;  3CCR P;  3EJB A;  2GZG A;  2XXM A;  3CE7 A;  2GZI A;  2DGY A;  3H0D A;  3CCV P;  2AVA A;  2JGP A;  2KW2 A;  3EJE A;  5KP6 B;  2N5I A;  4GR6 A;  2XV6 A;  2KOO A;  1GPJ A;  1RNI A;  7CEI A;  2ROQ A;  4XRQ A;  1IMP A;  1MZ8 A;  4U0B A;  3LMO A;  2XT1 A;  2N6Z A;  2FQ0 A;  1F80 D;  4BPF A;  4GR2 A;  2L22 A;  2VSQ A;  3DS1 A;  4BPH A;  1EOQ A;  2EHT A;  4QKO A;  2VLN A;  2EFJ A;  1M6E X;  2JB0 A;  2E1M A;  2JBG A;  1JJ2 O;  1GXH A;  3CC4 P;  4PH0 A;  1M74 A;  3DTJ A;  4HKG A;  3CME P;  2N98 A;  2Z45 A;  3I56 P;  2M8L A;  2XZ0 D;  1YJW P;  4BPG A;  2CNR A;  2NO8 A;  1CEI A;  3GZL A;  2PEN A;  3G21 A;  2QA4 P;  2LF4 A;  2LIU A;  5BS1 A;  2MF4 A;  3WBH A;  4IPY A;  5KP8 B;  5KP7 B;  2OTL P;  2LOL A;  1Q86 Q;  3G0V A;  2ONT A;  4WYM A;  1YI2 P;  2PNG A;  1KLP A;  1L0H A;  4H2Y C;  4XFZ A;  2MR7 A;  3GZM A;  3GKL C;  3DS4 A;  2KOR A;  2ERH A;  1Q82 Q;  2FVE A;  2L0Q A;  5BS2 A;  2KOQ A;  1KQS O;  3G26 A;  3CC2 P;  3B4Q A;  3Q20 A;  1K73 Q;  1HY8 A;  2K2Q A;  2K0D X;  1FR2 A;  2PEI A;  3M1M A;  1AYI A;  1QVF O;  2M8N A;  2K0X A;  4UHP B;  5F2K A;  1A8O A;  1M90 Q;  3RG2 A;  3CC7 P;  3LRY A;  1AF8 A;  2LML A;  4H2W C;  2EIA A;  4CA3 A;  2K0Y A;  1VQ7 P;  2CQ8 A;  4U0A A;  5F2N A;  2L4B A;  4U0F A;  2JQ4 A;  2KWL A;  2FAD A;  2K94 A;  2KGC A;  4PXH B;  2FQ2 A;  2AFD A;  2N6Y A;  1EIA A;  3NY7 B;  2KR5 A;  1DNY A;  2PEQ A;  5HGN A;  1L0I A;  1HQB A;  3E2D A;  4MRT C;  1Q7Y Q;  2L9F A;  2MVU A;  2MR8 A;  2BUO A;  4U0E A;  3CCM P;  2FAC A;  2MD9 A; 
#chains in the Genus database with same CATH homology
 2ONT A;  4WYM A;  3VRL C;  3G1I A;  1YI2 P;  1Q81 Q;  4XFZ A;  3CXC O;  1M1K Q;  1QRJ A;  3H4E A;  1YJ9 P;  3NTE A;  2QEX P;  1AUM A;  3G71 P;  1W2B O;  1VQ9 P;  3DS4 A;  3CCJ P;  4XFX A;  5HGM A;  2CWO A;  1A43 A;  1Q82 Q;  1K30 A;  3DS5 A;  2PEJ A;  2PEO A;  3OW2 O;  5BS2 A;  1VQ6 P;  1K8A Q;  2PEK A;  3CCU P;  3CMA P;  1ZMB A;  3CCR P;  1VQ4 P;  2XXM A;  1KQS O;  4COC A;  2DGY A;  5JPA A;  3G6E P;  3CCQ P;  1VQK P;  3H0D A;  2OAR A;  1YJN P;  1RO0 A;  3CCV P;  3G26 A;  3DS0 A;  5DCK A;  3CC2 P;  5I4T G;  3Q20 A;  2L6E A;  1K73 Q;  2JYL A;  1K9M Q;  4GR6 A;  2XV6 A;  4PH1 A;  1BAJ A;  2PEI A;  4XFY A;  5F2O A;  3M1M A;  1QVF O;  1RNI A;  2M8N A;  1QVG O;  3CD6 P;  4XRQ A;  3CCS P;  2P9X A;  5F2K A;  1A8O A;  4U0D A;  1M90 Q;  1YIJ P;  1D1D A;  4U0B A;  3CC7 P;  2BHV A;  3CCE P;  2XT1 A;  3LRY A;  3P05 A;  4M0I A;  3I55 P;  3G1G A;  1KC8 Q;  3DPH A;  5HGL A;  1E6J P;  2EIA A;  2Z44 A;  3G29 A;  4GR2 A;  2OTJ P;  1VQP P;  3DS1 A;  4QNB A;  4XRO A;  1VQ7 P;  1VQO P;  4U0A A;  1EOQ A;  3H47 A;  5F2N A;  1IUQ A;  2EFJ A;  1VQL P;  1M6E X;  1RO2 A;  4U0F A;  3B5I A;  2E1M A;  1JJ2 O;  1YIT P;  3CC4 P;  4PH0 A;  3CPW O;  1NJI Q;  1M74 A;  1M6N A;  1VQM P;  1EIA A;  3MGE A;  3DTJ A;  2M8P A;  2EG5 A;  3CME P;  2Z45 A;  3I56 P;  2PEM A;  2PEQ A;  3G28 A;  1S72 P;  2Z46 A;  2M8L A;  5HGN A;  1YHQ P;  1VQ8 P;  3DS3 A;  3E2D A;  1YJW P;  4U0C A;  1VQN P;  2KOD A;  1N8R Q;  1KD1 Q;  3HZQ A;  3DS2 A;  1Q7Y Q;  1VQ5 P;  2PEN A;  5HGO A;  3G21 A;  2QA4 P;  2JO0 A;  2LF4 A;  5BS1 A;  2JYG A;  3WBH A;  3RG6 C;  2BUO A;  4IPY A;  4U0E A;  3CCL P;  4COP A;  3CCM P;  3G4S P;  2OTL P;  2PY8 A;  1Q86 Q;  3HYB A;  3G0V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...