3DTJA

Hiv-1 capsid c-terminal domain mutant (e187a)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
73
structure length
73
Chain Sequence
SILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTATLLVQNANPDCKTILKALGPGATLEEMMTACQGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Residues in the HIV-1 Capsid Assembly Inhibitor Binding Site Are Essential for Maintaining the Assembly-competent Quaternary Structure of the Capsid Protein.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
molecule keywords HIV-1 capsid protein
total genus 27
structure length 73
sequence length 73
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-07-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3dtjA00
3DS3A 4PH1A 4U0AA 2M8NA 4U0EA 5DCKA 1D1DA 3MGEA 4IPYA 4XRQA 1EIAA 4XFXA 3G1GA 2JO0A 4U0DA 4U0BA 4COPA 5I4TG 2JYGA 4XROA 2BUOA 3G21A 1EOQA 2M8LA 4U0CA 4PH0A 2M8PA 4M0IA 3NTEA 3VRLC 3G1IA 4XFZA 3DS2A 5HGLA 3G0VA 1A43A 1QRJA 4U0FA 1AUMA 2EIAA 3G28A 2LF4A 5HGNA 2L6EA 3DTJA 3DS4A 5HGOA 1E6JP 3G29A 4XFYA 5JPAA 1BAJA 3H47A 3G26A 2XV6A 2KODA 3DS1A 2XT1A 2ONTA 3DS5A 4QNBA 4COCA 4WYMA 1A8OA 2JYLA 5HGMA 3H4EA 3P05A 3DS0A 3LRYA 2XXMA 3DPHA
chains in the Genus database with same CATH superfamily
2FVAA 4MRTC 1VKUA 3I56P 2GZIA 2VSQA 4U0DA 2CWOA 3CD6P 3G1IA 5HGLA 2OTJP 4R0MA 3CCUP 2CQ8A 2K2QA 1KD1Q 3G6EP 3LRYA 2MY5A 1KQSO 2ERHA 3E2DA 2MVUA 4PXHB 3GZMA 4XROA 3EJBA 1VQ5P 1VHNA 2JGPA 3DS2A 3G0VA 1QRJA 2GZEA 4BPHA 2MF4A 1CEIA 3HZQA 4CA3A 2FACA 3CE7A 1GXHA 1DV5A 4H2YC 4PWVB 2KOSA 1M6NA 2XZ1C 2E1MA 2FVEA 4IZ6A 2M8LA 2K0DX 3NTEA 3I55P 1S72P 4U0FA 2MVVA 5HGNA 2LIUA 4XFYA 2FQ1A 1QVFO 2GDYA 5HGMA 3H4EA 1HY8A 3DS3A 2M8NA 5HV8A 1K8AQ 2L4BA 2PEKA 2VLNA 2JO0A 2GZJA 2EHSA 1K30A 1VQMP 1Z6MA 1GXGA 1M90Q 2K5XA 3CC2P 5EW5E 2N98A 2MR7A 2AFEA 1YHQP 2L0QA 2PEIA 1X3OA 2M5RA 1YJ9P 5BS1A 3G1GA 2X2BA 2FADA 2BUOA 1W2BO 1A43A 1JJ2O 1K9MQ 3CCQP 2EHTA 2XT1A 2ONTA 2LOLA 2Z46A 1VQPP 2GYKA 1YI2P 1YJWP 3CXCO 2L9FA 4XFXA 1QVGO 2KG9A 5CZDB 2JBGA 3WBHA 2NO8A 3HYBA 1VQ7P 1YITP 2KG6A 3P05A 3B4QA 3RG6C 3DTJA 3CC4P 4U0AA 4U0EA 2QNWA 3CMAP 5F2KA 5F2NA 1EIAA 4U0BA 4U0CA 2K93A 3U43A 3CCSP 2CNRA 2VLQA 2KG8A 2EFJA 2KWLA 3CCJP 3B5IA 4GR2A 1DNYA 4F37A 2EG5A 1FR2A 1UJZA 2JU1A 1VQ6P 5BS2A 4WYMA 3CCMP 2CG5B 2LIWA 3EJEA 1A8OA 7CEIA 2VLOA 1HQBA 1RNIA 5DCKA 2JQ4A 2LPKA 2K0XA 1IMPA 2FAEA 2DGYA 1ZNVA 2PEOA 2PEJA 2KOOA 1Q81Q 1E6JP 3DS5A 2GZFA 1IUQA 3DPHA 2KOPA 4H2XC 3CCVP 1YIJP 1VQLP 2QEXP 1OR5A 3RG2A 1RO0A 4PH0A 3GZLA 2DNWA 1ZMBA 2EIAA 3G29A 2K92A 3CMEP 4GR6A 4QKOA 3GJNA 4BPGA 2KR5A 2ROQA 4DG9A 1UNKA 4H2WC 5HVCA 5EJDA 2FQ2A 2JU2A 2GDXA 1K73Q 3CC7P 2KW2A 1L0IA 1YJNP 2PEQA 3VRLC 1VQNP 3G28A 3DS4A 1BAJA 1BXIA 1GPJA 2FVFA 1N8RQ 1F80D 1VQ8P 2GDWA 1IMQA 5KP8B 3EJDA 1E0HA 5I4TG 2N5IA 2N6ZA 2XZ0D 1VQOP 2AFDA 2P9XA 1M6EX 2OTLP 1VQ4P 3G4SP 4COCA 2OARA 2XXMA 2LMLA 4BPFA 1L0HA 3OW2O 1AYIA 3M1MA 2KORA 4XRQA 4COPA 3CPWO 1EOQA 2M8PA 4UHPB 1AF8A 4XFZA 2JB0A 1AUMA 2LF4A 1VQ9P 1KC8Q 5JPAA 2L22A 2AF8A 1KLPA 3CCRP 2LL8A 5KP7B 1NQ4A 4NEOA 2KGAA 1Q7YQ 1VQKP 1RO2A 1M1KQ 2KOQA 4M0IA 3GKLC 1Q82Q 2CGQA 2K0YA 2KGCA 2XV6A 1NJIQ 3NY7B 4QNBA 1Q86Q 2JYLA 3DS0A 2PY8A 1T8KA 4HKGA 3CCEP 3CCLP 2PEMA 2PNGA 2LKIA 2Z44A 2FHSC 2BHVA 2AVAA 1EMVA 2JYGA 2N6YA 3G21A 2GZGA 2FQ0A 2K94A 2L6EA 2QA4P 3H47A 3LMOA 3G26A 2KGDA 3DS1A 2N50A 4PH1A 2KGEA 3G71P 2MD9A 5KP6B 1D1DA 3MGEA 4IPYA 2N5HA 2WPTA 2LTEA 1ACPA 1MZ8A 5HGOA 2PENA 3H0DA 2KODA 2Z45A 1M74A 2VLPA 2JAZA 5F2OA 3Q20A 2MR8A
chains in the Genus database with same CATH topology
2PEIA 1RNIA 5DCKA 3OW2O 3M1MA 4XRQA 3I56P 1YJ9P 5BS1A 3G1GA 4U0DA 4COPA 3CPWO 2DGYA 2CWOA 2BUOA 2PEOA 1EOQA 2PEJA 1W2BO 2M8PA 3CD6P 3G1IA 4XFZA 5HGLA 1A43A 1AUMA 2OTJP 2LF4A 1VQ9P 1Q81Q 1E6JP 1KC8Q 1JJ2O 5JPAA 1K9MQ 3CCQP 3CCUP 2XT1A 2ONTA 3DS5A 1KD1Q 3G6EP 1IUQA 3LRYA 2Z46A 1VQPP 3DPHA 3CCRP 1KQSO 3CCVP 1YI2P 1YJWP 1YIJP 3E2DA 3CXCO 1Q7YQ 4XFXA 1VQLP 1QVGO 2QEXP 1VQKP 1RO2A 4XROA 1RO0A 1M1KQ 4PH0A 4M0IA 1VQ5P 3DS2A 3G0VA 1ZMBA 1QRJA 3WBHA 1Q82Q 2EIAA 3HYBA 1VQ7P 3G29A 1YITP 2XV6A 3CMEP 1NJIQ 3HZQA 4QNBA 4GR6A 1Q86Q 2JYLA 3P05A 3DS0A 3RG6C 3DTJA 3CC4P 2PY8A 4U0AA 4U0EA 3CCLP 3CCEP 2PEMA 3CMAP 5F2KA 5F2NA 2Z44A 1K73Q 2BHVA 1EIAA 3CC7P 1M6NA 4U0BA 2JYGA 2E1MA 3G21A 2M8LA 2PEQA 4U0CA 1YJNP 3VRLC 1VQNP 3NTEA 3I55P 1S72P 4U0FA 3G28A 5HGNA 2L6EA 2QA4P 3DS4A 4XFYA 3CCSP 1BAJA 3H47A 3G26A 3DS1A 1QVFO 5HGMA 1N8RQ 3H4EA 2EFJA 3DS3A 4PH1A 2M8NA 3G71P 1K8AQ 1VQ8P 3CCJP 3B5IA 4GR2A 2PEKA 1D1DA 3MGEA 4IPYA 2JO0A 5I4TG 1VQOP 1K30A 1VQMP 2OARA 2EG5A 1M90Q 2P9XA 5HGOA 3CC2P 1M6EX 2PENA 3H0DA 2KODA 2Z45A 1VQ4P 1VQ6P 2OTLP 5BS2A 1M74A 3G4SP 4COCA 4WYMA 3CCMP 1A8OA 1YHQP 5F2OA 3Q20A 2XXMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DS3 A;  4PH1 A;  4U0A A;  2M8N A;  4U0E A;  5DCK A;  1D1D A;  3MGE A;  4IPY A;  4XRQ A;  1EIA A;  4XFX A;  3G1G A;  2JO0 A;  4U0D A;  4U0B A;  4COP A;  5I4T G;  2JYG A;  4XRO A;  2BUO A;  3G21 A;  1EOQ A;  2M8L A;  4U0C A;  4PH0 A;  2M8P A;  4M0I A;  3NTE A;  3VRL C;  3G1I A;  4XFZ A;  3DS2 A;  5HGL A;  3G0V A;  1A43 A;  1QRJ A;  4U0F A;  1AUM A;  2EIA A;  3G28 A;  2LF4 A;  5HGN A;  2L6E A;  3DTJ A;  3DS4 A;  5HGO A;  1E6J P;  3G29 A;  4XFY A;  5JPA A;  1BAJ A;  3H47 A;  3G26 A;  2XV6 A;  2KOD A;  3DS1 A;  2XT1 A;  2ONT A;  3DS5 A;  4QNB A;  4COC A;  4WYM A;  1A8O A;  2JYL A;  5HGM A;  3H4E A;  3P05 A;  3DS0 A;  3LRY A;  2XXM A;  3DPH A; 
#chains in the Genus database with same CATH topology
 2FVA A;  4MRT C;  1VKU A;  3I56 P;  2GZI A;  2VSQ A;  4U0D A;  2CWO A;  3CD6 P;  3G1I A;  5HGL A;  2OTJ P;  4R0M A;  3CCU P;  2CQ8 A;  2K2Q A;  1KD1 Q;  3G6E P;  3LRY A;  2MY5 A;  1KQS O;  2ERH A;  3E2D A;  2MVU A;  4PXH B;  3GZM A;  4XRO A;  3EJB A;  1VQ5 P;  1VHN A;  2JGP A;  3DS2 A;  3G0V A;  1QRJ A;  2GZE A;  4BPH A;  2MF4 A;  1CEI A;  3HZQ A;  4CA3 A;  2FAC A;  3CE7 A;  1GXH A;  1DV5 A;  4H2Y C;  4PWV B;  2KOS A;  1M6N A;  2XZ1 C;  2E1M A;  2FVE A;  4IZ6 A;  2M8L A;  2K0D X;  3NTE A;  3I55 P;  1S72 P;  4U0F A;  2MVV A;  5HGN A;  2LIU A;  4XFY A;  2FQ1 A;  1QVF O;  2GDY A;  5HGM A;  3H4E A;  1HY8 A;  3DS3 A;  2M8N A;  5HV8 A;  1K8A Q;  2L4B A;  2PEK A;  2VLN A;  2JO0 A;  2GZJ A;  2EHS A;  1K30 A;  1VQM P;  1Z6M A;  1GXG A;  1M90 Q;  2K5X A;  3CC2 P;  5EW5 E;  2N98 A;  2MR7 A;  2AFE A;  1YHQ P;  2L0Q A;  2PEI A;  1X3O A;  2M5R A;  1YJ9 P;  5BS1 A;  3G1G A;  2X2B A;  2FAD A;  2BUO A;  1W2B O;  1A43 A;  1JJ2 O;  1K9M Q;  3CCQ P;  2EHT A;  2XT1 A;  2ONT A;  2LOL A;  2Z46 A;  1VQP P;  2GYK A;  1YI2 P;  1YJW P;  3CXC O;  2L9F A;  4XFX A;  1QVG O;  2KG9 A;  5CZD B;  2JBG A;  3WBH A;  2NO8 A;  3HYB A;  1VQ7 P;  1YIT P;  2KG6 A;  3P05 A;  3B4Q A;  3RG6 C;  3DTJ A;  3CC4 P;  4U0A A;  4U0E A;  2QNW A;  3CMA P;  5F2K A;  5F2N A;  1EIA A;  4U0B A;  4U0C A;  2K93 A;  3U43 A;  3CCS P;  2CNR A;  2VLQ A;  2KG8 A;  2EFJ A;  2KWL A;  3CCJ P;  3B5I A;  4GR2 A;  1DNY A;  4F37 A;  2EG5 A;  1FR2 A;  1UJZ A;  2JU1 A;  1VQ6 P;  5BS2 A;  4WYM A;  3CCM P;  2CG5 B;  2LIW A;  3EJE A;  1A8O A;  7CEI A;  2VLO A;  1HQB A;  1RNI A;  5DCK A;  2JQ4 A;  2LPK A;  2K0X A;  1IMP A;  2FAE A;  2DGY A;  1ZNV A;  2PEO A;  2PEJ A;  2KOO A;  1Q81 Q;  1E6J P;  3DS5 A;  2GZF A;  1IUQ A;  3DPH A;  2KOP A;  4H2X C;  3CCV P;  1YIJ P;  1VQL P;  2QEX P;  1OR5 A;  3RG2 A;  1RO0 A;  4PH0 A;  3GZL A;  2DNW A;  1ZMB A;  2EIA A;  3G29 A;  2K92 A;  3CME P;  4GR6 A;  4QKO A;  3GJN A;  4BPG A;  2KR5 A;  2ROQ A;  4DG9 A;  1UNK A;  4H2W C;  5HVC A;  5EJD A;  2FQ2 A;  2JU2 A;  2GDX A;  1K73 Q;  3CC7 P;  2KW2 A;  1L0I A;  1YJN P;  2PEQ A;  3VRL C;  1VQN P;  3G28 A;  3DS4 A;  1BAJ A;  1BXI A;  1GPJ A;  2FVF A;  1N8R Q;  1F80 D;  1VQ8 P;  2GDW A;  1IMQ A;  5KP8 B;  3EJD A;  1E0H A;  5I4T G;  2N5I A;  2N6Z A;  2XZ0 D;  1VQO P;  2AFD A;  2P9X A;  1M6E X;  2OTL P;  1VQ4 P;  3G4S P;  4COC A;  2OAR A;  2XXM A;  2LML A;  4BPF A;  1L0H A;  3OW2 O;  1AYI A;  3M1M A;  2KOR A;  4XRQ A;  4COP A;  3CPW O;  1EOQ A;  2M8P A;  4UHP B;  1AF8 A;  4XFZ A;  2JB0 A;  1AUM A;  2LF4 A;  1VQ9 P;  1KC8 Q;  5JPA A;  2L22 A;  2AF8 A;  1KLP A;  3CCR P;  2LL8 A;  5KP7 B;  1NQ4 A;  4NEO A;  2KGA A;  1Q7Y Q;  1VQK P;  1RO2 A;  1M1K Q;  2KOQ A;  4M0I A;  3GKL C;  1Q82 Q;  2CGQ A;  2K0Y A;  2KGC A;  2XV6 A;  1NJI Q;  3NY7 B;  4QNB A;  1Q86 Q;  2JYL A;  3DS0 A;  2PY8 A;  1T8K A;  4HKG A;  3CCE P;  3CCL P;  2PEM A;  2PNG A;  2LKI A;  2Z44 A;  2FHS C;  2BHV A;  2AVA A;  1EMV A;  2JYG A;  2N6Y A;  3G21 A;  2GZG A;  2FQ0 A;  2K94 A;  2L6E A;  2QA4 P;  3H47 A;  3LMO A;  3G26 A;  2KGD A;  3DS1 A;  2N50 A;  4PH1 A;  2KGE A;  3G71 P;  2MD9 A;  5KP6 B;  1D1D A;  3MGE A;  4IPY A;  2N5H A;  2WPT A;  2LTE A;  1ACP A;  1MZ8 A;  5HGO A;  2PEN A;  3H0D A;  2KOD A;  2Z45 A;  1M74 A;  2VLP A;  2JAZ A;  5F2O A;  3Q20 A;  2MR8 A; 
#chains in the Genus database with same CATH homology
 2PEI A;  1RNI A;  5DCK A;  3OW2 O;  3M1M A;  4XRQ A;  3I56 P;  1YJ9 P;  5BS1 A;  3G1G A;  4U0D A;  4COP A;  3CPW O;  2DGY A;  2CWO A;  2BUO A;  2PEO A;  1EOQ A;  2PEJ A;  1W2B O;  2M8P A;  3CD6 P;  3G1I A;  4XFZ A;  5HGL A;  1A43 A;  1AUM A;  2OTJ P;  2LF4 A;  1VQ9 P;  1Q81 Q;  1E6J P;  1KC8 Q;  1JJ2 O;  5JPA A;  1K9M Q;  3CCQ P;  3CCU P;  2XT1 A;  2ONT A;  3DS5 A;  1KD1 Q;  3G6E P;  1IUQ A;  3LRY A;  2Z46 A;  1VQP P;  3DPH A;  3CCR P;  1KQS O;  3CCV P;  1YI2 P;  1YJW P;  1YIJ P;  3E2D A;  3CXC O;  1Q7Y Q;  4XFX A;  1VQL P;  1QVG O;  2QEX P;  1VQK P;  1RO2 A;  4XRO A;  1RO0 A;  1M1K Q;  4PH0 A;  4M0I A;  1VQ5 P;  3DS2 A;  3G0V A;  1ZMB A;  1QRJ A;  3WBH A;  1Q82 Q;  2EIA A;  3HYB A;  1VQ7 P;  3G29 A;  1YIT P;  2XV6 A;  3CME P;  1NJI Q;  3HZQ A;  4QNB A;  4GR6 A;  1Q86 Q;  2JYL A;  3P05 A;  3DS0 A;  3RG6 C;  3DTJ A;  3CC4 P;  2PY8 A;  4U0A A;  4U0E A;  3CCL P;  3CCE P;  2PEM A;  3CMA P;  5F2K A;  5F2N A;  2Z44 A;  1K73 Q;  2BHV A;  1EIA A;  3CC7 P;  1M6N A;  4U0B A;  2JYG A;  2E1M A;  3G21 A;  2M8L A;  2PEQ A;  4U0C A;  1YJN P;  3VRL C;  1VQN P;  3NTE A;  3I55 P;  1S72 P;  4U0F A;  3G28 A;  5HGN A;  2L6E A;  2QA4 P;  3DS4 A;  4XFY A;  3CCS P;  1BAJ A;  3H47 A;  3G26 A;  3DS1 A;  1QVF O;  5HGM A;  1N8R Q;  3H4E A;  2EFJ A;  3DS3 A;  4PH1 A;  2M8N A;  3G71 P;  1K8A Q;  1VQ8 P;  3CCJ P;  3B5I A;  4GR2 A;  2PEK A;  1D1D A;  3MGE A;  4IPY A;  2JO0 A;  5I4T G;  1VQO P;  1K30 A;  1VQM P;  2OAR A;  2EG5 A;  1M90 Q;  2P9X A;  5HGO A;  3CC2 P;  1M6E X;  2PEN A;  3H0D A;  2KOD A;  2Z45 A;  1VQ4 P;  1VQ6 P;  2OTL P;  5BS2 A;  1M74 A;  3G4S P;  4COC A;  4WYM A;  3CCM P;  1A8O A;  1YHQ P;  5F2O A;  3Q20 A;  2XXM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...