3DTJA

Hiv-1 capsid c-terminal domain mutant (e187a)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
73
structure length
73
Chain Sequence
SILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTATLLVQNANPDCKTILKALGPGATLEEMMTACQGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein
molecule keywords HIV-1 capsid protein
publication title Residues in the HIV-1 Capsid Assembly Inhibitor Binding Site Are Essential for Maintaining the Assembly-competent Quaternary Structure of the Capsid Protein.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 27
structure length 73
sequence length 73
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-07-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3dtjA00
3DS0A 4U0EA 5JPAA 1D1DA 3G26A 4XROA 1A43A 3NTEA 4XFZA 2LF4A 5HGOA 1EIAA 2JO0A 3G1GA 4PH1A 5DCKA 3MGEA 2BUOA 4U0BA 3VRLC 4U0AA 1E6JP 2KODA 1QRJA 2M8NA 2M8LA 2JYLA 3G21A 5HGLA 3DS3A 3G0VA 3DPHA 4QNBA 3DS1A 5HGNA 3G28A 1EOQA 4XRQA 3G1IA 4U0CA 3H4EA 1AUMA 2XXMA 3LRYA 2XV6A 3P05A 4XFXA 2EIAA 4U0FA 5I4TG 2M8PA 1A8OA 2L6EA 3DTJA 4M0IA 4XFYA 4COCA 3H47A 3G29A 2ONTA 3DS2A 3DS4A 5HGMA 1BAJA 3DS5A 4U0DA 4WYMA 4COPA 2XT1A 4PH0A 2JYGA 4IPYA
chains in the Genus database with same CATH superfamily
1Q86Q 4XROA 1VKUA 3NY7B 2N98A 2K0XA 2MVVA 3EJEA 1IMPA 2KW2A 2GDXA 2L0QA 5CZDB 2K94A 2E1MA 3G1IA 1HQBA 2L9FA 2M8PA 1QVFO 2QNWA 2FVAA 3B5IA 2FQ0A 4PH0A 3CD6P 1A43A 2CG5B 2MY5A 2MR8A 1GXGA 5HVCA 2PEJA 3CXCO 2OTLP 5HGNA 5F2OA 3EJDA 1YIJP 2K93A 2KGEA 1YITP 2N6ZA 3DS4A 2QEXP 1KLPA 1BAJA 5HV8A 1M6NA 1M6EX 1VQKP 3CCVP 2JU1A 2JO0A 2PENA 2KOSA 1W2BO 2LIUA 1Q81Q 5BS1A 1A8OA 2VLNA 3HYBA 2ERHA 3CMAP 3DS5A 3H4EA 2JAZA 1IMQA 3CCEP 2EG5A 2JU2A 1K8AQ 3G21A 4QNBA 2BHVA 3LRYA 1K73Q 2PY8A 2FAEA 2QA4P 1BXIA 2KGAA 1VQ7P 4GR2A 1T8KA 1GPJA 1N8RQ 2JQ4A 2LL8A 3DS0A 1F80D 2PEIA 2Z46A 4BPHA 4DG9A 4H2XC 2EHTA 2KORA 3EJBA 1QVGO 4U0DA 2N5HA 2JYGA 5HGOA 2FVEA 2KGCA 2LOLA 3GJNA 1VQMP 2MR7A 2GZIA 2JYLA 4XRQA 2PEQA 1AUMA 3GZLA 2KG8A 2EHSA 2VLPA 2XT1A 3I55P 5JPAA 3HZQA 3H0DA 2KWLA 3CC4P 1ZMBA 4IZ6A 1E6JP 2KODA 2M8LA 7CEIA 2FADA 4MRTC 5EJDA 4BPGA 2LMLA 2KG6A 1Q82Q 3DTJA 3CC2P 4COCA 5BS2A 2KOOA 2FQ2A 2AVAA 4WYMA 1L0IA 1Q7YQ 1K9MQ 4U0EA 2GDYA 3NTEA 2KOPA 4GR6A 2LTEA 3Q20A 3CCRP 2DGYA 2KOQA 1NQ4A 2M8NA 2MVUA 2VSQA 2GDWA 4U0CA 1ZNVA 2VLOA 2EIAA 2M5RA 2LKIA 1X3OA 5KP8B 5HGMA 2Z44A 2FHSC 1M74A 4XFZA 4R0MA 1EMVA 3G1GA 3GZMA 1VQ5P 1FR2A 4HKGA 1AYIA 5F2NA 3CE7A 2XXMA 3G71P 4M0IA 2K2QA 4CA3A 5DCKA 4PWVB 3G26A 1UNKA 2PEMA 4NEOA 1VQNP 2BUOA 4UHPB 5HGLA 2GZGA 2K0YA 1RO2A 2VLQA 2EFJA 5I4TG 1IUQA 2JBGA 3DS2A 1Z6MA 2LF4A 3G4SP 2N50A 1YJWP 1YHQP 3GKLC 1KQSO 1QRJA 1YI2P 2L4BA 3G6EP 4H2WC 3DS1A 3G28A 1OR5A 2L22A 2MD9A 3CCMP 5EW5E 3CMEP 1YJNP 2PNGA 2FACA 3CCJP 3I56P 1M1KQ 2N5IA 1VQLP 4H2YC 1EIAA 2CWOA 2AF8A 4U0BA 2K5XA 2ROQA 2GYKA 1GXHA 1JJ2O 3CCUP 2GZFA 3G29A 1VQ6P 1AF8A 1ACPA 2FVFA 4BPFA 3MGEA 2OARA 2FQ1A 2OTJP 2KR5A 1VQOP 3DPHA 1EOQA 4QKOA 3CC7P 1UJZA 2CQ8A 2DNWA 2P9XA 2CNRA 2XZ0D 4COPA 2CGQA 1D1DA 1DNYA 2AFDA 4PH1A 2GZEA 2Z45A 3VRLC 4U0AA 5KP7B 5KP6B 2KG9A 3OW2O 1MZ8A 3P05A 3CCSP 1VHNA 3U43A 3H47A 2GZJA 1VQPP 1KC8Q 3M1MA 1K30A 1RNIA 4IPYA 1S72P 2NO8A 2AFEA 2LPKA 4PXHB 2PEKA 1NJIQ 3E2DA 3LMOA 2N6YA 3RG6C 2X2BA 2LIWA 2XV6A 4U0FA 1KD1Q 1HY8A 2K0DX 2ONTA 3B4QA 1DV5A 2JGPA 1YJ9P 2MF4A 2XZ1C 2K92A 1VQ4P 3DS3A 1VQ9P 3CCQP 1CEIA 3CPWO 3RG2A 3CCLP 1M90Q 1RO0A 3G0VA 5F2KA 2WPTA 2PEOA 1E0HA 3WBHA 4F37A 1L0HA 4XFXA 2L6EA 4XFYA 2JB0A 2KGDA 1VQ8P
chains in the Genus database with same CATH topology
3DS0A 1Q86Q 4XROA 2PEIA 1M74A 4XFZA 2Z46A 3G1GA 1VQ5P 3MGEA 2OARA 2OTJP 1VQOP 3DPHA 2E1MA 1EOQA 3G1IA 5F2NA 2XXMA 3CC7P 3G71P 2M8PA 1QVFO 4M0IA 3B5IA 2P9XA 1QVGO 4PH0A 4U0DA 4COPA 2JYGA 5DCKA 1D1DA 3CD6P 3G26A 1A43A 5HGOA 2PEMA 4PH1A 2Z45A 1VQMP 1VQNP 2BUOA 3VRLC 4U0AA 2JYLA 2PEJA 5HGLA 3CXCO 2OTLP 5HGNA 5F2OA 4XRQA 3OW2O 2PEQA 1AUMA 1RO2A 1YIJP 2EFJA 3P05A 5I4TG 3CCSP 1YITP 1IUQA 3H47A 1VQPP 1KC8Q 3DS2A 3DS4A 3M1MA 2QEXP 1K30A 1BAJA 2XT1A 3I55P 1RNIA 4IPYA 5JPAA 1M6NA 1M6EX 1VQKP 1S72P 3CCVP 3HZQA 2LF4A 3H0DA 3G4SP 3CC4P 2PEKA 1YJWP 1YHQP 1NJIQ 2JO0A 1ZMBA 2PENA 1KQSO 1E6JP 2KODA 1QRJA 2M8LA 1YI2P 1W2BO 3E2DA 1Q81Q 3G6EP 3DS1A 5BS1A 3G28A 3RG6C 2XV6A 4U0FA 1KD1Q 1A8OA 1Q82Q 3DTJA 3CC2P 3CCMP 4COCA 5BS2A 3HYBA 3CMEP 2ONTA 1YJNP 3CMAP 3DS5A 4WYMA 1Q7YQ 1YJ9P 1K9MQ 1VQ4P 3DS3A 3H4EA 3CCJP 4U0EA 1VQ9P 3I56P 3CCQP 3NTEA 3CPWO 1M1KQ 4GR6A 3CCEP 3Q20A 3CCRP 1VQLP 1EIAA 2CWOA 2DGYA 2EG5A 3CCLP 4U0BA 1M90Q 2M8NA 1K8AQ 1RO0A 3G21A 3G0VA 5F2KA 4QNBA 2BHVA 2PEOA 4U0CA 3WBHA 1JJ2O 3CCUP 3LRYA 4XFXA 2EIAA 1K73Q 2L6EA 2PY8A 2QA4P 4XFYA 3G29A 1VQ7P 5HGMA 2Z44A 4GR2A 1VQ6P 1VQ8P 1N8RQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DS0 A;  4U0E A;  5JPA A;  1D1D A;  3G26 A;  4XRO A;  1A43 A;  3NTE A;  4XFZ A;  2LF4 A;  5HGO A;  1EIA A;  2JO0 A;  3G1G A;  4PH1 A;  5DCK A;  3MGE A;  2BUO A;  4U0B A;  3VRL C;  4U0A A;  1E6J P;  2KOD A;  1QRJ A;  2M8N A;  2M8L A;  2JYL A;  3G21 A;  5HGL A;  3DS3 A;  3G0V A;  3DPH A;  4QNB A;  3DS1 A;  5HGN A;  3G28 A;  1EOQ A;  4XRQ A;  3G1I A;  4U0C A;  3H4E A;  1AUM A;  2XXM A;  3LRY A;  2XV6 A;  3P05 A;  4XFX A;  2EIA A;  4U0F A;  5I4T G;  2M8P A;  1A8O A;  2L6E A;  3DTJ A;  4M0I A;  4XFY A;  4COC A;  3H47 A;  3G29 A;  2ONT A;  3DS2 A;  3DS4 A;  5HGM A;  1BAJ A;  3DS5 A;  4U0D A;  4WYM A;  4COP A;  2XT1 A;  4PH0 A;  2JYG A;  4IPY A; 
#chains in the Genus database with same CATH topology
 1Q86 Q;  4XRO A;  1VKU A;  3NY7 B;  2N98 A;  2K0X A;  2MVV A;  3EJE A;  1IMP A;  2KW2 A;  2GDX A;  2L0Q A;  5CZD B;  2K94 A;  2E1M A;  3G1I A;  1HQB A;  2L9F A;  2M8P A;  1QVF O;  2QNW A;  2FVA A;  3B5I A;  2FQ0 A;  4PH0 A;  3CD6 P;  1A43 A;  2CG5 B;  2MY5 A;  2MR8 A;  1GXG A;  5HVC A;  2PEJ A;  3CXC O;  2OTL P;  5HGN A;  5F2O A;  3EJD A;  1YIJ P;  2K93 A;  2KGE A;  1YIT P;  2N6Z A;  3DS4 A;  2QEX P;  1KLP A;  1BAJ A;  5HV8 A;  1M6N A;  1M6E X;  1VQK P;  3CCV P;  2JU1 A;  2JO0 A;  2PEN A;  2KOS A;  1W2B O;  2LIU A;  1Q81 Q;  5BS1 A;  1A8O A;  2VLN A;  3HYB A;  2ERH A;  3CMA P;  3DS5 A;  3H4E A;  2JAZ A;  1IMQ A;  3CCE P;  2EG5 A;  2JU2 A;  1K8A Q;  3G21 A;  4QNB A;  2BHV A;  3LRY A;  1K73 Q;  2PY8 A;  2FAE A;  2QA4 P;  1BXI A;  2KGA A;  1VQ7 P;  4GR2 A;  1T8K A;  1GPJ A;  1N8R Q;  2JQ4 A;  2LL8 A;  3DS0 A;  1F80 D;  2PEI A;  2Z46 A;  4BPH A;  4DG9 A;  4H2X C;  2EHT A;  2KOR A;  3EJB A;  1QVG O;  4U0D A;  2N5H A;  2JYG A;  5HGO A;  2FVE A;  2KGC A;  2LOL A;  3GJN A;  1VQM P;  2MR7 A;  2GZI A;  2JYL A;  4XRQ A;  2PEQ A;  1AUM A;  3GZL A;  2KG8 A;  2EHS A;  2VLP A;  2XT1 A;  3I55 P;  5JPA A;  3HZQ A;  3H0D A;  2KWL A;  3CC4 P;  1ZMB A;  4IZ6 A;  1E6J P;  2KOD A;  2M8L A;  7CEI A;  2FAD A;  4MRT C;  5EJD A;  4BPG A;  2LML A;  2KG6 A;  1Q82 Q;  3DTJ A;  3CC2 P;  4COC A;  5BS2 A;  2KOO A;  2FQ2 A;  2AVA A;  4WYM A;  1L0I A;  1Q7Y Q;  1K9M Q;  4U0E A;  2GDY A;  3NTE A;  2KOP A;  4GR6 A;  2LTE A;  3Q20 A;  3CCR P;  2DGY A;  2KOQ A;  1NQ4 A;  2M8N A;  2MVU A;  2VSQ A;  2GDW A;  4U0C A;  1ZNV A;  2VLO A;  2EIA A;  2M5R A;  2LKI A;  1X3O A;  5KP8 B;  5HGM A;  2Z44 A;  2FHS C;  1M74 A;  4XFZ A;  4R0M A;  1EMV A;  3G1G A;  3GZM A;  1VQ5 P;  1FR2 A;  4HKG A;  1AYI A;  5F2N A;  3CE7 A;  2XXM A;  3G71 P;  4M0I A;  2K2Q A;  4CA3 A;  5DCK A;  4PWV B;  3G26 A;  1UNK A;  2PEM A;  4NEO A;  1VQN P;  2BUO A;  4UHP B;  5HGL A;  2GZG A;  2K0Y A;  1RO2 A;  2VLQ A;  2EFJ A;  5I4T G;  1IUQ A;  2JBG A;  3DS2 A;  1Z6M A;  2LF4 A;  3G4S P;  2N50 A;  1YJW P;  1YHQ P;  3GKL C;  1KQS O;  1QRJ A;  1YI2 P;  2L4B A;  3G6E P;  4H2W C;  3DS1 A;  3G28 A;  1OR5 A;  2L22 A;  2MD9 A;  3CCM P;  5EW5 E;  3CME P;  1YJN P;  2PNG A;  2FAC A;  3CCJ P;  3I56 P;  1M1K Q;  2N5I A;  1VQL P;  4H2Y C;  1EIA A;  2CWO A;  2AF8 A;  4U0B A;  2K5X A;  2ROQ A;  2GYK A;  1GXH A;  1JJ2 O;  3CCU P;  2GZF A;  3G29 A;  1VQ6 P;  1AF8 A;  1ACP A;  2FVF A;  4BPF A;  3MGE A;  2OAR A;  2FQ1 A;  2OTJ P;  2KR5 A;  1VQO P;  3DPH A;  1EOQ A;  4QKO A;  3CC7 P;  1UJZ A;  2CQ8 A;  2DNW A;  2P9X A;  2CNR A;  2XZ0 D;  4COP A;  2CGQ A;  1D1D A;  1DNY A;  2AFD A;  4PH1 A;  2GZE A;  2Z45 A;  3VRL C;  4U0A A;  5KP7 B;  5KP6 B;  2KG9 A;  3OW2 O;  1MZ8 A;  3P05 A;  3CCS P;  1VHN A;  3U43 A;  3H47 A;  2GZJ A;  1VQP P;  1KC8 Q;  3M1M A;  1K30 A;  1RNI A;  4IPY A;  1S72 P;  2NO8 A;  2AFE A;  2LPK A;  4PXH B;  2PEK A;  1NJI Q;  3E2D A;  3LMO A;  2N6Y A;  3RG6 C;  2X2B A;  2LIW A;  2XV6 A;  4U0F A;  1KD1 Q;  1HY8 A;  2K0D X;  2ONT A;  3B4Q A;  1DV5 A;  2JGP A;  1YJ9 P;  2MF4 A;  2XZ1 C;  2K92 A;  1VQ4 P;  3DS3 A;  1VQ9 P;  3CCQ P;  1CEI A;  3CPW O;  3RG2 A;  3CCL P;  1M90 Q;  1RO0 A;  3G0V A;  5F2K A;  2WPT A;  2PEO A;  1E0H A;  3WBH A;  4F37 A;  1L0H A;  4XFX A;  2L6E A;  4XFY A;  2JB0 A;  2KGD A;  1VQ8 P; 
#chains in the Genus database with same CATH homology
 3DS0 A;  1Q86 Q;  4XRO A;  2PEI A;  1M74 A;  4XFZ A;  2Z46 A;  3G1G A;  1VQ5 P;  3MGE A;  2OAR A;  2OTJ P;  1VQO P;  3DPH A;  2E1M A;  1EOQ A;  3G1I A;  5F2N A;  2XXM A;  3CC7 P;  3G71 P;  2M8P A;  1QVF O;  4M0I A;  3B5I A;  2P9X A;  1QVG O;  4PH0 A;  4U0D A;  4COP A;  2JYG A;  5DCK A;  1D1D A;  3CD6 P;  3G26 A;  1A43 A;  5HGO A;  2PEM A;  4PH1 A;  2Z45 A;  1VQM P;  1VQN P;  2BUO A;  3VRL C;  4U0A A;  2JYL A;  2PEJ A;  5HGL A;  3CXC O;  2OTL P;  5HGN A;  5F2O A;  4XRQ A;  3OW2 O;  2PEQ A;  1AUM A;  1RO2 A;  1YIJ P;  2EFJ A;  3P05 A;  5I4T G;  3CCS P;  1YIT P;  1IUQ A;  3H47 A;  1VQP P;  1KC8 Q;  3DS2 A;  3DS4 A;  3M1M A;  2QEX P;  1K30 A;  1BAJ A;  2XT1 A;  3I55 P;  1RNI A;  4IPY A;  5JPA A;  1M6N A;  1M6E X;  1VQK P;  1S72 P;  3CCV P;  3HZQ A;  2LF4 A;  3H0D A;  3G4S P;  3CC4 P;  2PEK A;  1YJW P;  1YHQ P;  1NJI Q;  2JO0 A;  1ZMB A;  2PEN A;  1KQS O;  1E6J P;  2KOD A;  1QRJ A;  2M8L A;  1YI2 P;  1W2B O;  3E2D A;  1Q81 Q;  3G6E P;  3DS1 A;  5BS1 A;  3G28 A;  3RG6 C;  2XV6 A;  4U0F A;  1KD1 Q;  1A8O A;  1Q82 Q;  3DTJ A;  3CC2 P;  3CCM P;  4COC A;  5BS2 A;  3HYB A;  3CME P;  2ONT A;  1YJN P;  3CMA P;  3DS5 A;  4WYM A;  1Q7Y Q;  1YJ9 P;  1K9M Q;  1VQ4 P;  3DS3 A;  3H4E A;  3CCJ P;  4U0E A;  1VQ9 P;  3I56 P;  3CCQ P;  3NTE A;  3CPW O;  1M1K Q;  4GR6 A;  3CCE P;  3Q20 A;  3CCR P;  1VQL P;  1EIA A;  2CWO A;  2DGY A;  2EG5 A;  3CCL P;  4U0B A;  1M90 Q;  2M8N A;  1K8A Q;  1RO0 A;  3G21 A;  3G0V A;  5F2K A;  4QNB A;  2BHV A;  2PEO A;  4U0C A;  3WBH A;  1JJ2 O;  3CCU P;  3LRY A;  4XFX A;  2EIA A;  1K73 Q;  2L6E A;  2PY8 A;  2QA4 P;  4XFY A;  3G29 A;  1VQ7 P;  5HGM A;  2Z44 A;  4GR2 A;  1VQ6 P;  1VQ8 P;  1N8R Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...