3DTJA

Hiv-1 capsid c-terminal domain mutant (e187a)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
73
structure length
73
Chain Sequence
SILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTATLLVQNANPDCKTILKALGPGATLEEMMTACQGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HIV-1 capsid protein
publication title Residues in the HIV-1 Capsid Assembly Inhibitor Binding Site Are Essential for Maintaining the Assembly-competent Quaternary Structure of the Capsid Protein.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 27
structure length 73
sequence length 73
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-07-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3dtjA00
3NTEA 4XFYA 4COCA 5HGMA 3G1IA 4U0EA 4XRQA 2JO0A 4U0DA 3G0VA 4WYMA 4U0BA 1A8OA 2M8PA 4PH1A 4U0AA 5DCKA 2XXMA 3VRLC 3DS2A 4PH0A 3G29A 4M0IA 2EIAA 3H47A 2JYLA 2L6EA 5HGLA 3G28A 3LRYA 2XT1A 3DS0A 4XFXA 2M8LA 3DS1A 3DPHA 2KODA 3DS3A 3G21A 3DS5A 4IPYA 1EIAA 2LF4A 5JPAA 2BUOA 1AUMA 3MGEA 4COPA 2JYGA 2XV6A 3H4EA 3P05A 1D1DA 4U0CA 5HGNA 1E6JP 4U0FA 4XROA 3G26A 1EOQA 1A43A 2M8NA 5HGOA 3DS4A 5I4TG 2ONTA 3G1GA 4XFZA 1QRJA 4QNBA 1BAJA 3DTJA
chains in the Genus database with same CATH superfamily
5HGMA 1BXIA 5DCKA 3VRLC 2QEXP 2WPTA 5KP8B 3H47A 3LRYA 2XT1A 2CG5B 4IPYA 2FVFA 2KG9A 3NY7B 2PY8A 3RG2A 2OTLP 1QRJA 4QNBA 4H2XC 4XFYA 1IMPA 3G1IA 4U0DA 3HYBA 4U0AA 2PENA 2MD9A 1KC8Q 3GZLA 3CCSP 2LIWA 2KW2A 2GDXA 2Z46A 1EMVA 3HZQA 2JYGA 1KQSO 2VLNA 2JQ4A 1JJ2O 5BS2A 1K9MQ 2XZ1C 4GR2A 5F2NA 3CCEP 1BAJA 3Q20A 2PEJA 2MVVA 4COCA 4U0EA 3GZMA 2MR7A 1QVGO 2LMLA 4U0CA 1K8AQ 1E6JP 3G26A 2FVEA 1DNYA 1L0HA 2KG6A 3CE7A 5HV8A 5HGLA 1Q82Q 4PWVB 3RG6C 3H0DA 5EW5E 2VSQA 1Z6MA 3E2DA 1YHQP 1UJZA 2N50A 2K0XA 1UNKA 1K30A 2FACA 5F2KA 2MVUA 2LOLA 1VQNP 3G6EP 2QA4P 2GZEA 1FR2A 2MF4A 2XV6A 2OTJP 2CGQA 1W2BO 2L9FA 2VLOA 1YJWP 2EHTA 1Q7YQ 3CCRP 2P9XA 4XRQA 3CCVP 1VHNA 2JBGA 2KGAA 2JAZA 2FQ0A 4DG9A 2LF4A 4F37A 3CCMP 5CZDB 3B5IA 1DV5A 5KP7B 1VQKP 3DTJA 3G4SP 2VLQA 3G71P 3CXCO 2L6EA 4MRTC 2L22A 1GXHA 3DS0A 1ACPA 2GZIA 3DS3A 1T8KA 2LTEA 2KWLA 2L4BA 2EFJA 3GKLC 4BPHA 1GPJA 1OR5A 1ZMBA 2PEKA 4U0BA 1VQ6P 4PH0A 2LIUA 1S72P 1NQ4A 2CNRA 2GDWA 2KGDA 2N98A 2K93A 3CC7P 1Q81Q 2EHSA 4BPFA 1KD1Q 2KOSA 3CMAP 1RO0A 1A43A 3DS4A 1AF8A 4XFZA 3CMEP 1YITP 2N6ZA 2DGYA 2JO0A 4WYMA 5EJDA 3I55P 2CWOA 2JYLA 1AYIA 2VLPA 1M90Q 3EJDA 1VQ4P 4COPA 2K94A 2M8NA 2KGEA 2ONTA 1RO2A 4HKGA 1RNIA 2X2BA 2E1MA 2K0YA 4PH1A 1VQ7P 2FAEA 2XXMA 4H2WC 1L0IA 1HY8A 2K2QA 1GXGA 1Q86Q 2KOOA 1M74A 2GZGA 3H4EA 3P05A 1D1DA 1E0HA 4U0FA 3OW2O 1EOQA 3LMOA 5HGOA 1VQPP 2MY5A 2LL8A 2AVAA 2K0DX 3DS2A 1IMQA 2PEIA 3CPWO 1VQOP 3CD6P 2KR5A 3G21A 2JU2A 2NO8A 2PEOA 4BPGA 1N8RQ 5KP6B 1VQMP 5I4TG 3NTEA 5F2OA 1HQBA 3G0VA 1A8OA 4H2YC 2JGPA 3CC4P 2FADA 1YJ9P 4PXHB 1KLPA 2GDYA 2N5HA 5HGNA 2QNWA 4GR6A 4CA3A 2K5XA 1F80D 1X3OA 5HVCA 2ERHA 2AFEA 2KOQA 2M8PA 1YJNP 3G29A 1VQ8P 3CC2P 3CCUP 1QVFO 3G28A 3DPHA 3CCQP 1EIAA 2BUOA 2DNWA 1VKUA 2FQ1A 2KOPA 3WBHA 2CQ8A 4XROA 3EJBA 2XZ0D 2PEMA 4UHPB 3M1MA 3U43A 4M0IA 2EIAA 1VQLP 2Z45A 1M6NA 4XFXA 2FVAA 3DS1A 4R0MA 1YI2P 3EJEA 2ROQA 1AUMA 2KORA 2LPKA 2PEQA 2JU1A 2FQ2A 3B4QA 3CCJP 2EG5A 5BS1A 2L0QA 4IZ6A 1YIJP 2JB0A 1MZ8A 2AFDA 1M1KQ 2KODA 3DS5A 3GJNA 5JPAA 3MGEA 2OARA 2M5RA 1VQ9P 4QKOA 2GYKA 2GZFA 1VQ5P 2Z44A 2K92A 1ZNVA 1IUQA 1CEIA 2GZJA 3CCLP 2PNGA 3I56P 2M8LA 1NJIQ 2KGCA 2LKIA 1K73Q 2KG8A 7CEIA 2N6YA 2BHVA 2MR8A 3G1GA 1M6EX 2N5IA 2FHSC 2AF8A 4NEOA
chains in the Genus database with same CATH topology
5HGMA 1YITP 2DGYA 2JO0A 4WYMA 2M8PA 1K30A 5DCKA 3VRLC 3I55P 2QEXP 1YJNP 3G29A 2CWOA 1VQ8P 5F2KA 3CC2P 3H47A 2JYLA 3CCUP 1QVFO 3G28A 3LRYA 2XT1A 1M90Q 1VQNP 3DPHA 1VQ4P 3G6EP 2QA4P 4IPYA 3CCQP 1EIAA 2BUOA 4COPA 2XV6A 2OTJP 3WBHA 2PY8A 1W2BO 4XROA 2M8NA 1YJWP 2OTLP 2ONTA 2PEMA 1QRJA 1RO2A 4QNBA 1Q7YQ 3CCRP 1RNIA 4XFYA 2P9XA 2E1MA 3G1IA 4XRQA 4U0DA 3CCVP 4PH1A 3HYBA 3M1MA 4U0AA 2XXMA 1VQ7P 2PENA 4M0IA 2EIAA 1VQLP 2Z45A 1M6NA 4XFXA 1KC8Q 3DS1A 3CCSP 2Z46A 1Q86Q 1YI2P 2LF4A 1M74A 1AUMA 3HZQA 2JYGA 3H4EA 3P05A 1KQSO 1D1DA 3CCMP 1JJ2O 5BS2A 2PEQA 1K9MQ 4U0FA 3OW2O 1EOQA 3B5IA 3CCJP 4GR2A 5HGOA 2EG5A 5F2NA 1VQPP 5BS1A 3CCEP 1YIJP 3Q20A 1BAJA 1VQKP 3DTJA 2PEJA 4COCA 3G4SP 4U0EA 3DS2A 3G71P 3CXCO 2L6EA 1QVGO 2PEIA 3DS0A 1M1KQ 3CPWO 1VQOP 2KODA 3DS3A 3G21A 3DS5A 3CD6P 5JPAA 2PEOA 3MGEA 2OARA 1N8RQ 4U0CA 1VQMP 1K8AQ 1VQ9P 1E6JP 3G26A 2EFJA 5I4TG 1VQ5P 2Z44A 3NTEA 5F2OA 1ZMBA 2PEKA 1IUQA 3G0VA 4U0BA 1A8OA 1VQ6P 4PH0A 1S72P 3CC4P 3CCLP 1YJ9P 5HGLA 1Q82Q 3I56P 3CC7P 2M8LA 1NJIQ 3RG6C 3H0DA 1Q81Q 1K73Q 1KD1Q 5HGNA 3CMAP 4GR6A 1RO0A 2BHVA 1A43A 3DS4A 3E2DA 3G1GA 4XFZA 1M6EX 3CMEP 1YHQP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NTE A;  4XFY A;  4COC A;  5HGM A;  3G1I A;  4U0E A;  4XRQ A;  2JO0 A;  4U0D A;  3G0V A;  4WYM A;  4U0B A;  1A8O A;  2M8P A;  4PH1 A;  4U0A A;  5DCK A;  2XXM A;  3VRL C;  3DS2 A;  4PH0 A;  3G29 A;  4M0I A;  2EIA A;  3H47 A;  2JYL A;  2L6E A;  5HGL A;  3G28 A;  3LRY A;  2XT1 A;  3DS0 A;  4XFX A;  2M8L A;  3DS1 A;  3DPH A;  2KOD A;  3DS3 A;  3G21 A;  3DS5 A;  4IPY A;  1EIA A;  2LF4 A;  5JPA A;  2BUO A;  1AUM A;  3MGE A;  4COP A;  2JYG A;  2XV6 A;  3H4E A;  3P05 A;  1D1D A;  4U0C A;  5HGN A;  1E6J P;  4U0F A;  4XRO A;  3G26 A;  1EOQ A;  1A43 A;  2M8N A;  5HGO A;  3DS4 A;  5I4T G;  2ONT A;  3G1G A;  4XFZ A;  1QRJ A;  4QNB A;  1BAJ A;  3DTJ A; 
#chains in the Genus database with same CATH topology
 5HGM A;  1BXI A;  5DCK A;  3VRL C;  2QEX P;  2WPT A;  5KP8 B;  3H47 A;  3LRY A;  2XT1 A;  2CG5 B;  4IPY A;  2FVF A;  2KG9 A;  3NY7 B;  2PY8 A;  3RG2 A;  2OTL P;  1QRJ A;  4QNB A;  4H2X C;  4XFY A;  1IMP A;  3G1I A;  4U0D A;  3HYB A;  4U0A A;  2PEN A;  2MD9 A;  1KC8 Q;  3GZL A;  3CCS P;  2LIW A;  2KW2 A;  2GDX A;  2Z46 A;  1EMV A;  3HZQ A;  2JYG A;  1KQS O;  2VLN A;  2JQ4 A;  1JJ2 O;  5BS2 A;  1K9M Q;  2XZ1 C;  4GR2 A;  5F2N A;  3CCE P;  1BAJ A;  3Q20 A;  2PEJ A;  2MVV A;  4COC A;  4U0E A;  3GZM A;  2MR7 A;  1QVG O;  2LML A;  4U0C A;  1K8A Q;  1E6J P;  3G26 A;  2FVE A;  1DNY A;  1L0H A;  2KG6 A;  3CE7 A;  5HV8 A;  5HGL A;  1Q82 Q;  4PWV B;  3RG6 C;  3H0D A;  5EW5 E;  2VSQ A;  1Z6M A;  3E2D A;  1YHQ P;  1UJZ A;  2N50 A;  2K0X A;  1UNK A;  1K30 A;  2FAC A;  5F2K A;  2MVU A;  2LOL A;  1VQN P;  3G6E P;  2QA4 P;  2GZE A;  1FR2 A;  2MF4 A;  2XV6 A;  2OTJ P;  2CGQ A;  1W2B O;  2L9F A;  2VLO A;  1YJW P;  2EHT A;  1Q7Y Q;  3CCR P;  2P9X A;  4XRQ A;  3CCV P;  1VHN A;  2JBG A;  2KGA A;  2JAZ A;  2FQ0 A;  4DG9 A;  2LF4 A;  4F37 A;  3CCM P;  5CZD B;  3B5I A;  1DV5 A;  5KP7 B;  1VQK P;  3DTJ A;  3G4S P;  2VLQ A;  3G71 P;  3CXC O;  2L6E A;  4MRT C;  2L22 A;  1GXH A;  3DS0 A;  1ACP A;  2GZI A;  3DS3 A;  1T8K A;  2LTE A;  2KWL A;  2L4B A;  2EFJ A;  3GKL C;  4BPH A;  1GPJ A;  1OR5 A;  1ZMB A;  2PEK A;  4U0B A;  1VQ6 P;  4PH0 A;  2LIU A;  1S72 P;  1NQ4 A;  2CNR A;  2GDW A;  2KGD A;  2N98 A;  2K93 A;  3CC7 P;  1Q81 Q;  2EHS A;  4BPF A;  1KD1 Q;  2KOS A;  3CMA P;  1RO0 A;  1A43 A;  3DS4 A;  1AF8 A;  4XFZ A;  3CME P;  1YIT P;  2N6Z A;  2DGY A;  2JO0 A;  4WYM A;  5EJD A;  3I55 P;  2CWO A;  2JYL A;  1AYI A;  2VLP A;  1M90 Q;  3EJD A;  1VQ4 P;  4COP A;  2K94 A;  2M8N A;  2KGE A;  2ONT A;  1RO2 A;  4HKG A;  1RNI A;  2X2B A;  2E1M A;  2K0Y A;  4PH1 A;  1VQ7 P;  2FAE A;  2XXM A;  4H2W C;  1L0I A;  1HY8 A;  2K2Q A;  1GXG A;  1Q86 Q;  2KOO A;  1M74 A;  2GZG A;  3H4E A;  3P05 A;  1D1D A;  1E0H A;  4U0F A;  3OW2 O;  1EOQ A;  3LMO A;  5HGO A;  1VQP P;  2MY5 A;  2LL8 A;  2AVA A;  2K0D X;  3DS2 A;  1IMQ A;  2PEI A;  3CPW O;  1VQO P;  3CD6 P;  2KR5 A;  3G21 A;  2JU2 A;  2NO8 A;  2PEO A;  4BPG A;  1N8R Q;  5KP6 B;  1VQM P;  5I4T G;  3NTE A;  5F2O A;  1HQB A;  3G0V A;  1A8O A;  4H2Y C;  2JGP A;  3CC4 P;  2FAD A;  1YJ9 P;  4PXH B;  1KLP A;  2GDY A;  2N5H A;  5HGN A;  2QNW A;  4GR6 A;  4CA3 A;  2K5X A;  1F80 D;  1X3O A;  5HVC A;  2ERH A;  2AFE A;  2KOQ A;  2M8P A;  1YJN P;  3G29 A;  1VQ8 P;  3CC2 P;  3CCU P;  1QVF O;  3G28 A;  3DPH A;  3CCQ P;  1EIA A;  2BUO A;  2DNW A;  1VKU A;  2FQ1 A;  2KOP A;  3WBH A;  2CQ8 A;  4XRO A;  3EJB A;  2XZ0 D;  2PEM A;  4UHP B;  3M1M A;  3U43 A;  4M0I A;  2EIA A;  1VQL P;  2Z45 A;  1M6N A;  4XFX A;  2FVA A;  3DS1 A;  4R0M A;  1YI2 P;  3EJE A;  2ROQ A;  1AUM A;  2KOR A;  2LPK A;  2PEQ A;  2JU1 A;  2FQ2 A;  3B4Q A;  3CCJ P;  2EG5 A;  5BS1 A;  2L0Q A;  4IZ6 A;  1YIJ P;  2JB0 A;  1MZ8 A;  2AFD A;  1M1K Q;  2KOD A;  3DS5 A;  3GJN A;  5JPA A;  3MGE A;  2OAR A;  2M5R A;  1VQ9 P;  4QKO A;  2GYK A;  2GZF A;  1VQ5 P;  2Z44 A;  2K92 A;  1ZNV A;  1IUQ A;  1CEI A;  2GZJ A;  3CCL P;  2PNG A;  3I56 P;  2M8L A;  1NJI Q;  2KGC A;  2LKI A;  1K73 Q;  2KG8 A;  7CEI A;  2N6Y A;  2BHV A;  2MR8 A;  3G1G A;  1M6E X;  2N5I A;  2FHS C;  2AF8 A;  4NEO A; 
#chains in the Genus database with same CATH homology
 5HGM A;  1YIT P;  2DGY A;  2JO0 A;  4WYM A;  2M8P A;  1K30 A;  5DCK A;  3VRL C;  3I55 P;  2QEX P;  1YJN P;  3G29 A;  2CWO A;  1VQ8 P;  5F2K A;  3CC2 P;  3H47 A;  2JYL A;  3CCU P;  1QVF O;  3G28 A;  3LRY A;  2XT1 A;  1M90 Q;  1VQN P;  3DPH A;  1VQ4 P;  3G6E P;  2QA4 P;  4IPY A;  3CCQ P;  1EIA A;  2BUO A;  4COP A;  2XV6 A;  2OTJ P;  3WBH A;  2PY8 A;  1W2B O;  4XRO A;  2M8N A;  1YJW P;  2OTL P;  2ONT A;  2PEM A;  1QRJ A;  1RO2 A;  4QNB A;  1Q7Y Q;  3CCR P;  1RNI A;  4XFY A;  2P9X A;  2E1M A;  3G1I A;  4XRQ A;  4U0D A;  3CCV P;  4PH1 A;  3HYB A;  3M1M A;  4U0A A;  2XXM A;  1VQ7 P;  2PEN A;  4M0I A;  2EIA A;  1VQL P;  2Z45 A;  1M6N A;  4XFX A;  1KC8 Q;  3DS1 A;  3CCS P;  2Z46 A;  1Q86 Q;  1YI2 P;  2LF4 A;  1M74 A;  1AUM A;  3HZQ A;  2JYG A;  3H4E A;  3P05 A;  1KQS O;  1D1D A;  3CCM P;  1JJ2 O;  5BS2 A;  2PEQ A;  1K9M Q;  4U0F A;  3OW2 O;  1EOQ A;  3B5I A;  3CCJ P;  4GR2 A;  5HGO A;  2EG5 A;  5F2N A;  1VQP P;  5BS1 A;  3CCE P;  1YIJ P;  3Q20 A;  1BAJ A;  1VQK P;  3DTJ A;  2PEJ A;  4COC A;  3G4S P;  4U0E A;  3DS2 A;  3G71 P;  3CXC O;  2L6E A;  1QVG O;  2PEI A;  3DS0 A;  1M1K Q;  3CPW O;  1VQO P;  2KOD A;  3DS3 A;  3G21 A;  3DS5 A;  3CD6 P;  5JPA A;  2PEO A;  3MGE A;  2OAR A;  1N8R Q;  4U0C A;  1VQM P;  1K8A Q;  1VQ9 P;  1E6J P;  3G26 A;  2EFJ A;  5I4T G;  1VQ5 P;  2Z44 A;  3NTE A;  5F2O A;  1ZMB A;  2PEK A;  1IUQ A;  3G0V A;  4U0B A;  1A8O A;  1VQ6 P;  4PH0 A;  1S72 P;  3CC4 P;  3CCL P;  1YJ9 P;  5HGL A;  1Q82 Q;  3I56 P;  3CC7 P;  2M8L A;  1NJI Q;  3RG6 C;  3H0D A;  1Q81 Q;  1K73 Q;  1KD1 Q;  5HGN A;  3CMA P;  4GR6 A;  1RO0 A;  2BHV A;  1A43 A;  3DS4 A;  3E2D A;  3G1G A;  4XFZ A;  1M6E X;  3CME P;  1YHQ P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...