2OARA

Mechanosensitive channel of large conductance (mscl)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
125
structure length
125
Chain Sequence
MLKGFKEFLARGNIVDLAVAVVIGTAFTALVTKFTDSIITPLINRIGVNAQSDVGILRIGIGGGQTIDLNVLLSAAINFFLIAFAVYFLVVLPYNTLRKKGEVEQPGDTQVVLLTEIRDLLAQTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of the Prokaryotic Mechanosensitive Channels MscL and MscS
pubmed rcsb
source organism Mycobacterium tuberculosis h37ra
molecule tags Membrane protein
molecule keywords Large-conductance mechanosensitive channel
total genus 42
structure length 125
sequence length 125
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2006-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01741 MscL Large-conductance mechanosensitive channel, MscL
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.120 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2oarA01
1.20.5.220 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2oarA02
3CLQA 1SQXK 3HZQA 3LW5H 1NU1K 1SQQK 2OARA 1SQVK 2O01H 3M9QA 1NTZK 1SQPK 2WSCH 4IFDK 2FYUK 1L0LK 2WSFH 2WSEH 2LKMA 1L0NK 1NTMK 5KLVK 3G3ZA 2J59M 1NTKK 1SQBK
chains in the Genus database with same CATH superfamily
2GDYA 3L71E 3NY7B 5APTA 4H0LD 1RF0A 3L73G 4PV1C 4DCKA 5CBNA 2JO1A 2ITAA 3FX0A 5AVTB 2K3RA 4PH0A 1Z6MA 4C46A 2HR3A 1GXGA 1URQC 3MHVA 2P7JA 2WT7B 5L8RJ 4TT3H 3E1IA 3DPHA 4U0DA 2QE7H 1RQVA 2KGCA 2Z5IA 1OW6A 2PGDA 4EYYQ 1OIPA 2WSFH 2WSEH 2YMKA 2I1KA 1KORA 4H2WC 1L0LJ 3LMOA 1H0TB 4Z1MH 3BCCG 2Z44A 4UHPB 1GL2D 3CCUP 3HYBA 2R44A 1NAFA 1IFMA 5DCKA 5KTBA 1ZMEC 1SP4A 3CX5D 1X0TA 1BE3J 2WWWA 1KB9D 2FQ0A 1ZR4A 1GW4A 2AEJA 1SQXE 3AE5C 3B5IA 3V4WA 2EFJA 1BGYE 5KKZB 1CW5A 5AVXB 3G71P 1RY3A 5GTHH 1GD2E 4QKOA 3HE5A 2M5AB 2QIWA 1A02F 3M9HA 4R4MA 1DH3A 1EZVG 3AEFC 3HTKA 3H6PA 3L70E 1T3UA 5AW9B 1SQVJ 1MUUA 4OGQB 1NKNA 1GTWA 3AE1C 1UJZA 3A3YB 3M91A 2AFEA 2QNWA 3O8ZA 4WB4A 1ZN5A 1SFCD 3I55P 3CCEP 1JB0J 1RE3A 2P67A 2N1TC 2EHTA 1S4XA 3GF7A 5TISE 3QWOC 2JGPA 5APUA 3L73E 4U3FE 4BRYB 1UIXA 5GTIH 2WITA 3H1LE 1OZHA 2PEOA 3KXDA 2C9LY 3V2NA 1JEKA 1AF8A 3H1KJ 4DG9A 2OQQA 3M9BA 2KR5A 3V6IA 2WSEJ 2WSCJ 3CC4P 1JTHB 1L0NG 3MUDC 3WUUA 2AXCA 2PY8A 2HPCB 2ZXEB 5BS1A 2N6YA 3ITKA 3TGUE 4QNBA 1Q81Q 2H8PD 2IZ1A 5APQA 1G1IA 4DZOA 3FXEA 1SQVG 2L4BA 2FFDA 3CCMP 3V2PA 3L73D 2MJZA 2P2UA 2YIUC 3U59A 2PEJA 2NPSB 2FFDC 2WZ7A 4IFMA 3L70J 5EW5E 1KYOI 3L75J 3H32A 2QSIA 1KYOE 2KOOA 2M8NA 4LLHA 3GMAA 3BCCE 3RL0C 2Q5UA 2LKMA 5B66H 2R5BA 3RK3B 1FDIA 2M3EA 2XV6A 4K35A 2H7HA 2JU1A 5AVUB 3HZQA 1VPCA 2K1AA 2FVFA 1DD4A 2P1JA 1SQQJ 3UIAA 1EDJA 1J1EB 1LWUB 1JNMA 2CNRA 2OYHC 4R0MA 3PP5A 5GTIE 1Y8AA 2JKVA 4MRTC 1J2JB 2K9YA 5KLVK 4LGDE 4PD4I 1USEA 3M0DA 1T3JA 1GDTA 2JYGA 1KMIZ 3SWYA 1SQPE 2HG5D 5CHXA 2FXPA 3VN0A 3L74G 1J1DC 4WY4A 2NZ2A 3E7KA 2D2CD 2XKMA 2GZGA 2DW3A 1K73Q 1R5LA 4JYBA 1N73A 1X3OA 2LF4A 3MGNA 1P84I 1L4AA 4H0LB 2OYIA 3USSA 5APYA 1EOQA 4U0AA 4H44D 4GIFA 3EFGA 2XZ1C 2JB0A 1T8ZA 2YXRB 3PH0A 3VP8A 5CBOA 3CCQP 3D70A 1EMVA 1CI6B 1RE3C 4B86A 3PJSK 3CLQA 2L91A 2QJPB 1LTBC 2Z5HA 1JJ2O 2Y9ZA 1EDLA 1VF5D 1YI2P 1M1KQ 2KGEA 2BCCD 4LC1A 3L71D 2BHVA 1M90Q 1QGKB 2BCCJ 2AEMA 1A43A 2Z45A 3H1HE 1EDIA 3H1IE 4N78E 2KG6A 2XXMA 1FZCC 4HKGA 1H0TA 3KQGA 3M1MA 1GL2B 2FY8A 2PRRA 3TDKA 3CXHD 2AF8A 2G3AA 4L74A 2LR2A 1LWUC 2K94A 2FYUK 3HD7A 3LRYA 5EFWB 4U3FD 1BXIA 3AE7C 5B66E 5BS2A 1L4AC 2GZEA 1SFCC 1PPJG 3RBZA 2M0BA 3L35A 1JMMA 3GF3A 1AYIA 1BGYD 4UB6E 4U7JA 3HE5B 1PGQA 1SQXD 3M9QA 1HJ0A 2KZIA 3L72D 2MD9A 1NH4A 4M0IA 2MKVA 5APWA 2ZXXA 3AE9C 3KPEA 3CCVP 1EC5A 2FKWB 2M8RA 1PV3A 2OTLP 4WVZA 1RE4C 2O01J 4C7RA 3VMYA 1GZLA 3CWBD 1RH5B 2CPBA 1JY3O 2J59M 2W6AA 1IFJA 2QJKC 4EDFA 2K93A 1RNIA 5APSA 2NRGA 1KTMA 3P05A 1ZLLA 3AEEC 1BCCG 2POHA 4QMAA 3D71A 3VP9A 2VLNA 2JAZA 1IFNA 1EDKA 1OMIA 2VSQA 2KNCA 4XFZA 3P8CE 2QM8A 1YTZT 3TGUD 4ZMDA 3TNUA 2WPRA 3FWLA 4I2LC 1KILE 2R32A 3D6ZA 3GHGB 3N4XA 1VQ9P 1JUNA 2H43A 3CE7A 4UB6H 1EZVD 1HVVA 2FQ2A 1Q2NA 2GUVA 3CXHI 2WSSH 1FR2A 3DS4A 1NOHA 1PZQA 3JSVC 1Q82Q 3L74D 4IFDK 1FZBA 2XNXA 5AVRB 1ACPA 5BVZA 3Q5PA 2Y0CA 4UB8E 5APVA 2GA1A 2C0WA 5BU5A 2E43A 3VOPA 2RKLA 2O01N 3G6EP 1YBKA 1HTLC 1RO0A 1HGVA 1LWUA 5JPAA 2BEQD 3JCUE 2KS1A 2MF4A 3G21A 1L0HA 3BATA 2EG5A 4H44C 3TK1A 3W67A 3HE4A 2KOGA 1MZ8A 2CGQA 1LTJC 1USDA 1FZCA 1SQQD 3GHGC 2OYHA 1ZV8A 3L75G 3H1HD 1AFOA 3CCRP 3T97A 3LW5H 4N6JA 1SQQK 2M8LA 1PIXA 3AECC 1OWAA 3RGUA 3LW5J 2D2CC 3B4QA 4WWIA 2N9BA 2IYOA 1BDCA 3H1IJ 2ZYAA 3L72J 4ZKUA 5KLVJ 4AQRD 4NEOA 3FXDA 3RK2D 2KG9A 1RHZB 2LXCB 4CA3A 3HUSC 3C1LA 4BXLA 2OYIB 4U3FG 2FVAA 5DJTB 5KAFH 2IYPA 2FQ1A 4COCA 3TSIA 1FJPA 3WUTA 4BWNA 4GR2A 1OVRA 1FAVA 1YTZI 3CI9A 3AE8C 1CI6A 4D6TG 3PRJA 2N1TA 1SQBK 1ZXGA 1SQBD 1L0LE 4DT0A 2E76D 4WBAA 1LT9A 4NPEA 2ZVOB 1PP9E 3MUDA 3SSUA 4H13B 1FZGA 3AEAC 4YTPC 1HQBA 3AEGC 1GL2A 5HGOA 2PEIA 4NPDA 5H2FH 2WSFJ 3NTEA 2FBWC 4COPA 3B8EB 4H0LC 3B5ND 2XZRA 1RF1A 2GDXA 1FBMA 2Q9IA 3GW6A 4JYCA 1LP1A 1RF0C 5KP6B 1EXIA 3TGUG 3Q3DA 1WMKA 4ASVA 2PP6A 1S9KD 2E74B 3EJEA 4H13C 1HH0A 2KYVA 1SQBE 2KZJA 2DNWA 3IAOA 5AW6B 1BCCD 2FYUJ 3H25A 2R3SA 2KUBA 1DEEG 3EQ2A 1JO5A 5EJDA 2LKIA 2IPPA 3CCSP 5KAFE 4GOEA 3H0DA 1ZR2A 3DS2A 1X22A 1E0HA 3CWBG 4N3YB 3A7OA 5TISH 5AVVB 2K2QA 1N7LA 3GZLA 5F2OA 1KV4A 2MY5A 5AW2B 1LTSC 1W2BO 1KB9H 3CX5H 2YO2A 3CMAP 3RL0B 3MZWB 3BCCD 1KFNA 3DTJA 5TJHA 2PEQA 4I6MC 2OARA 5GTHE 3P7KA 2M5AA 2ZVNB 5B5EE 1AA0A 2IZ0A 1NTMJ 3E1RA 1PGJA 2E76B 5AW7B 2IX7C 4GR6A 3L75D 1AQTA 1KZUB 2E42A 2YNYA 1L0NJ 1VQLP 1PFIA 1VQ4P 1GK4A 3WU2H 3TNUB 2KK7A 3U1AA 4U0BA 4XROA 2JR8A 3EWKA 2GDWA 1AVYA 2B89A 2ROQA 1KILC 5CCGC 3H4EA 2OTJP 2IBZE 2PEKA 4WYMA 4XE5B 2J58A 3KZIH 2YKOA 3NFQA 2JBGA 4HJGH 3WMM0 3R2PA 2Q1KA 2MVUA 2JDIH 2PAJA 3EFFK 3P8MC 1FZEA 1VF5C 3RK3C 1T6AA 4JBZA 3G4SP 1ZNVA 1NGMB 1ZMBA 1DEBA 2ZT9B 2VLOA 2ZYDA 1JY2N 2HPCA 1BSNA 5HV8A 1N86A 5KJ7A 4OH8B 3SWKA 1SLQA 2FACA 3I56P 3CL3D 1G2CB 3RG2A 1VQ5P 3IN6A 3HE4B 2FYUE 2NO8A 5CJ4A 2OYHB 3B5NC 3B5NA 1NTME 2NPSA 2PENA 3H1LG 2W8ZA 3T97B 1QVGO 1LTAC 4PWVB 2A06D 1EZVI 3BRVB 4I7ZC 1VQ8P 3H32B 2ZJSE 3IF4A 4OWFA 3JCUH 1PGPA 1IC2A 2WQYC 2Z4EA 3Q1MA 1KQFB 2L22A 2L6EA 1FS0E 1P84D 2E75C 1NAYA 1KLPA 3O6QA 1E6JP 1SFCA 1VQOP 1BDDA 3HD7C 2O1KA 4BPHA 1IFIA 3E2DA 4GT1A 3W68A 2YMYA 3HUSA 5B5EH 1YYCA 1AUMA 2P58A 3VTPC 5KP8B 1EQ7A 1QL2A 2B88A 1SQBJ 1KILA 2Y9YA 1K9MQ 4K3AA 3BCCJ 2XT1A 2WPTA 2HFED 5AVSB 3L72G 1IUQA 2G8YA 2N50A 4D6TD 1QL1A 1NU1E 1VL2A 2E5YA 4PD4E 4Y99B 1U7JA 1BGYG 1TU3F 2CG5B 2V7QH 4ZKPA 1L4AB 2CK3H 3MTUE 1KB9I 1SQVK 1KB9E 1AJYA 2JJLA 4IPYA 4HH2A 4L76A 1BCCJ 1LP1B 3G28A 3Q5SA 3OJAB 1S2EA 3N7NA 3A5TA 2BCCE 2K88A 1IK9A 3H1HJ 3L37A 2E74D 1OW7A 2BEZF 1M6NA 3H1HG 2OYOA 3BASA 5DJUB 1L0NE 1R5SA 1QX8A 1JCCA 2DGYA 2KODA 1NU1D 1SQVD 1ZOYC 1M8OB 1KQGB 1NU1K 1SQXJ 1H8AA 1GMJA 2N1TD 1IFDA 1U57A 1VHNA 3G26A 1BGYJ 3HD7B 3HRNA 3TYYA 3LIEA 1VQNP 2QJYC 3CXHE 1Z56A 3F89A 1NJIQ 1BE3E 3WBHA 1URQD 3BVHA 5KLVE 2O01H 2IFMA 1NTZE 2WTYA 4IL6X 1J1DB 3OW2O 3F5HA 1JCDA 2H88C 4H13D 5CCGA 1N7SD 1N7SA 3L4FA 1YIJP 2ZYGA 4XRQA 1IZNB 2IDBA 1VQPP 2E75D 3RK3D 1WT6A 4EOTA 3L70G 4MN4C 3VMZA 1GPJA 2O3JA 1NTMD 4KHXA 4BPFA 1LTIC 2ZFCA 2PFXA 5K5GB 3G1IA 2QM7A 4HKZH 3H1KE 2K37A 1FDOA 2KIKA 2N5IA 1MKMA 2GUSA 1E79H 3FGAD 1WRGA 1ZW0A 2HYNA 1K04A 1T2KD 2QRXA 2J5UA 3I5CA 4L73A 2K92A 5I4TG 1GL2C 2N98A 2L9FA 3G3ZA 2FYZA 4JF7A 2KNCB 5CJ0A 2A45H 1EXJA 2Q3IA 1QLED 3K5BA 3DS0A 3RL0g 2LXBA 2C9NY 2JYLA 1FC2C 3Q2YA 4U0CA 1S1CX 1LT9C 2KORA 1G2CA 3CD6P 3CPWO 3OAKA 4RESB 2Z46A 3L74J 2VRSA 3H1JG 1S72P 1AVOA 5HGMA 4IL6H 1KILD 1NO4A 3H1JJ 2LMLA 4PD4H 1CSBA 2WPVB 1HGZA 2XU6A 1K30A 1F80D 4C7NB 1JY2P 2WPQA 2YKQA 2B9BA 3H1JD 3KYQA 1H89A 5KLIC 2HODA 1NTMK 3MP7B 3CXHH 1VF5B 3OA7A 5KLVG 1SFCB 2M5RA 1NHLA 1T2KC 3WUVA 2GYKA 1NTZD 5KLIB 2Q6QA 2LPKA 3CC7P 4RKUJ 1K05A 1HBWA 3L70D 1SQQE 3Q20A 2EIAA 3AE6C 1FZCB 1PP9J 2WMMA 2KLUA 3SWFA 4M3LA 1PGOA 2LOLA 4HYTB 1YHQP 3GKLC 2JU2A 2K0YA 1NYHA 2FADA 3CWBJ 4WY4D 1Y47A 2V4HA 3MD0A 3S4RA 5BU8B 3U1CA 1DX7A 2M8PA 3KHUA 5KJ7C 3Q5RA 2ERHA 1VKUA 4O9BA 3H1LD 1KYOD 4W80A 1P84E 4YXDC 2IBZG 3IFMA 1MFZA 1LGHB 3G1GA 1D1DA 2V7QJ 5AW1B 3U43A 1M1JB 1SQPK 1GW3A 1CEIA 2QEXP 2FYNB 1HY8A 2WT7A 5CCHA 3V2QA 1NU1G 4F37A 3GLMA 2AVAA 1OXZA 4DOJA 3L72E 5APXA 1CZQA 2WPSA 2Q7CA 1LT9B 4JPZB 1NTKJ 1KQSO 5HGLA 3V4QA 1LTJA 7CEIA 2E76C 5AVYB 4GODA 3RK3E 1SQVE 2CWOA 3MGEA 3RK2C 1SVFA 1RF1B 2ZAEB 3L71J 2AFDA 1S5LE 4PV1B 4YXWH 3CWBE 1VQ7P 4WY4C 1QEXA 3A0HH 1YJ9P 1BE3D 1AV1A 4Y99C 2D2CB 1FOSF 4PXHB 3CMEP 3G0VA 2XDJA 4GDOA 3C9IA 1N7SB 2B87A 3P8CD 2KSEA 1AQ5A 1YJWP 4H44B 2N6ZA 1SQPG 1OVUA 5M1BA 1M57D 1PPJD 4BPGA 1YQ3C 1K8AQ 3B71A 1PP9D 4XA4A 5KAIH 3DS1A 1LT1A 1L0ND 2KI7B 1DNYA 4PJ0E 3RBXA 1L0NK 3H1JE 3GG2A 1ZRTD 3CX5E 1GK6A 3VRLC 3KDPB 1FU1A 4GOFA 2MR8A 1FZFA 4JQ0D 2QJYB 2QG4A 1VDFA 2W27A 1L0LK 1L0IA 4PH1A 2A06G 3CCLP 3H47A 1OX3A 4W7ZA 4U0FA 1UNKA 1RE4A 2AEFA 4CPGA 2RMZA 5KJ7D 1FJKA 2KSJA 5H2FE 1BCCE 2KGAA 1QVFO 1JMBA 1IMQA 2W6JH 2OGUA 2JQ4A 3HD7D 2YXQB 1L0LG 5AVZB 3L36A 3SFDC 4R4LA 1NTKE 3VMXA 2N5HA 2JP3A 1NTKK 3M0DC 3DS3A 1PL5A 1URQB 2E5TA 5CCGD 2FYUD 5KP7B 1KYOH 1YITP 1S5LX 4C7NA 2FHSC 3L73J 5HGNA 2GZJA 4U3FJ 4AYCA 2JWDA 1M6EX 1A8OA 3WU2E 2KWLA 2HODB 1OR5A 4H2YC 5KKZC 2KLVA 3M06A 1N73C 3PLNA 2KGDA 2E75B 4XFYA 1FZAA 1QRJA 3ABVC 2FXOA 1HUCA 1JY3P 1OW8A 2JWAA 2P10A 4IFFA 1Q86Q 3II6A 2GM4A 1Y9BA 2Y0EA 1X79B 2A06E 3B5NB 1NTZJ 2BUOA 5AVQB 1YJNP 3H1ID 4N78D 3IR9A 2I8DA 3BRTB 1SQBG 2K0XA 3G9RA 1ZP0C 2O1JA 3V5BA 2BASA 4WY4B 1SQXG 5AW4B 1ZRTE 3AE4C 2VLPA 3CX5I 4PJ0H 3H1IG 3NTNA 3R4YA 4IZ6A 3O6QB 1VQMP 2EHSA 1SQQG 1W2EA 4I1LA 4PD4D 3H1KG 1IJDB 1N2DC 1M1JA 1UIIA 3HUSB 1EIAA 2QJKB 3A0HE 1HF9A 1LTGC 2KB7P 1NWQA 3ZDMA 2LTEA 1KILB 3KZIE 3CXCO 4RO0A 1LTTC 2K9JB 2YO3A 3RL0D 4A7PA 2W6BA 1FDMA 1U7MA 1L2PA 1LTJB 3GZMA 1NTKD 5C39A 1IK7A 3PTZA 4YPCA 1MV8A 3EJDA 1N7SC 4OVNF 1JY2O 2H89C 2R5DA 1XTCC 2Y0DA 2JO0A 1G1JA 1KN7A 1KD1Q 1JM0A 3L74E 2SPZA 2KOQA 3MIWA 2CPSA 1S9KE 1SS1A 1JOCA 2N9YB 3M0AA 1E5WA 2RH0A 1IFPA 3TGUJ 2YKPA 1GU5A 4PV1D 5HVCA 4TLFA 5AW3B 2XNDH 1DD3A 1RF1C 4NPFX 3A2AA 2FYUG 1NTKG 3RK2B 3S1KA 2WVRA 5E79H 1HJBA 4ZNCA 1GU4A 2WSCH 2JEEA 1JY3N 4KJMA 1VQ6P 4I7ZB 4D6TJ 1H88A 3GJNA 1FE6A 1S5LH 2LIWA 2B87B 3L75E 3VYIA 4W7YA 2UWJE 5CCHC 1X9VA 1YQ4C 1J1EC 1IO4A 1PPJE 2K5XA 5CCHD 1NTZK 1HWTC 4XFJA 2ZT9D 1RQUA 3H1KD 2A45G 2FYNC 2ZT9C 3A0BH 4L75A 1W5CE 4GKGA 3AEDC 2MVVA 3NXSA 2KOPA 4U0EA 1VQKP 2P9XA 5KLVD 2NPSD 2IBZI 3JC22 1IMPA 1BSHA 1DV5A 3V2RA 5KAIE 3CCJP 2FXMA 3PHLA 4EI2A 1SQPJ 3HTKB 2GZIA 2HLOA 1LNQA 1LJ2A 2AXTH 2RN0A 1PP9G 1M74A 3P32A 2QA4P 2A45I 1SQPD 4IL6E 3GHGA 2MR7A 3LIDA 2KW2A 3AE2C 2IFNA 3AE3C 4ASWA 2K0DX 5F2NA 4BRYA 2M3BA 1URQA 3NMDA 2W90A 5AW8B 3L71G 2KP8A 2FVEA 3QH9A 2XV5A 5F2KA 2KG8A 3D6YA 1NKZB 5AW5B 2ONTA 2L0QA 1JTHA 4XFXA 2GZFA 1GXHA 1NTMG 1BAJA 1L0LD 1KQLA 2OTKE 1DIPA 2KS1B 2NPSC 1L4AD 2FFDB 2YIUB 3SFEC 2PEMA 1M7LA 2IBZD 5AW0B 4EIJA 2BCCG 1FOSE 4AUWA 1Q7YQ 2CQ8A 3RG6C 1T8KA 4RJTA 4DJGA 3AEBC 3S9OA 2R3CA 1EZVE 1NVOA 1XTGB 1OVVA 2QJPC 4HB1A 3C8VA 2AXTE 2E74C 3DS5A 1NQ4A 1P84H 2OYIC 2PNGA 3A0BE 1KFMA 3CC2P 2VLQA 2E1MA 1M1JC 2L5GB 4UB8H 2LL8A 4IOIH 2X2BA 1OFCX 5CZDB 2C0XA 1A02J 2KOSA 2W83C 3FWNA 1NTZG 1S3JA 2N1TB 2KXPB 5E79E 1Q90D 2QVAA 1RO2A 4KT0J 2XZ0D 1SQXK 5AVWB 1KC8Q 4D6TE 1MZ9A 1NU1J 1R8EA 1X8YA 2K9JA 2Q3EA 4H2XC 4OGQD 5CMZA 2FAEA 2LIUA 1M56D 3EJBA 1MFTA 2I1JA 4OGQC 4Y28J 1N8RQ 1BE3G 3H1LJ 3G29A 3TF5A 1N73B 1D7MA 3B4SA 3VMAA
chains in the Genus database with same CATH topology
1YTZT 5APTA 1L4AB 3MTUE 1SQVK 1FJKA 1RF0A 2KSJA 5KJ7D 3TNUA 1QVFO 2WPRA 5AVTB 2JJLA 4IPYA 4I2LC 3HD7D 4HH2A 2R32A 5AVZB 4PH0A 3GHGB 3N4XA 3L36A 1VQ9P 1JUNA 4C46A 2H43A 1URQC 3G28A 2P7JA 2WT7B 1HVVA 3VMXA 2GUVA 3OJAB 1NTKK 3N7NA 3A5TA 3M0DC 3DS3A 3DS4A 1NOHA 1URQB 1IK9A 5CCGD 3L37A 3E1IA 1M6NA 3DPHA 1YITP 4U0DA 4C7NA 1Q82Q 4IFDK 2Z5IA 1FZBA 2XNXA 5AVRB 5HGNA 3BASA 4AYCA 2WSFH 2WSEH 5BVZA 2I1KA 1M6EX 1A8OA 2HODB 5APVA 2KLVA 2C0WA 3M06A 5BU5A 2E43A 1JCCA 3VOPA 2DGYA 2KODA 1N73C 2Z44A 1GL2D 3CCUP 3HYBA 1NAFA 3G6EP 1IFMA 1NU1K 1HTLC 5DCKA 4XFYA 1FZAA 1QRJA 1H8AA 1RO0A 5KTBA 2N1TD 1HGVA 1SP4A 5JPAA 1HUCA 1LWUA 1IFDA 1JY3P 3G26A 2WWWA 3HD7B 1ZR4A 3HRNA 3TYYA 3LIEA 4IFFA 1VQNP 1GW4A 1Q86Q 3II6A 3G21A 2GM4A 3BATA 2EG5A 3TK1A 3HE4A 1Z56A 1NJIQ 2KOGA 3B5IA 1LTJC 3V4WA 2EFJA 1FZCA 1X79B 3GHGC 2OYHA 3B5NB 3WBHA 1ZV8A 2BUOA 1CW5A 1AFOA 1URQD 3CCRP 5AVQB 3LW5H 4N6JA 1YJNP 2M8LA 1SQQK 4N78D 1OWAA 3IR9A 5AVXB 3G71P 1RY3A 3BVHA 3BRTB 1GD2E 2O01H 2N9BA 3HE5A 2IFMA 2O1JA 2WTYA 3V5BA 1J1DB 2BASA 1A02F 3M9HA 4WY4B 3OW2O 5AW4B 1JCDA 5CCGA 1N7SD 1DH3A 1N7SA 4ZKUA 3HTKA 4AQRD 3H6PA 1T3UA 5AW9B 3RK2D 3L4FA 3NTNA 1MUUA 1VQMP 1NKNA 1YIJP 1GTWA 3HUSC 1W2EA 4I1LA 4XRQA 3A3YB 1VQPP 3M91A 2OYIB 3RK3D 1IJDB 3O8ZA 1N2DC 4WB4A 1WT6A 1ZN5A 1M1JA 4EOTA 1SFCD 3HUSB 3I55P 3VMZA 4COCA 3TSIA 3CCEP 4KHXA 1FJPA 1EIAA 1RE3A 2P67A 2N1TC 4GR2A 1LTGC 1FAVA 1YTZI 1LTIC 3CI9A 2KB7P 1NWQA 1CI6A 2ZFCA 2N1TA 5APUA 3G1IA 1SQBK 2QM7A 2WITA 1KILB 3CXCO 2PEOA 1LTTC 2GUSA 2YO3A 2C9LY 1WRGA 4WBAA 3RL0D 3V2NA 1LT9A 2W6BA 2HYNA 1FDMA 1T2KD 3MUDA 3M9BA 1LTJB 3I5CA 1FZGA 5I4TG 1GL2C 3G3ZA 3CC4P 1JTHB 1MV8A 2FYZA 4JF7A 5CJ0A 1N7SC 1JY2O 2A45H 2Q3IA 2R5DA 1XTCC 2PY8A 3DS0A 1GL2A 2HPCB 2JO0A 1G1JA 5HGOA 2ZXEB 2PEIA 5BS1A 1KD1Q 2C9NY 4QNBA 1Q81Q 2JYLA 2H8PD 3MIWA 3NTEA 4U0CA 5APQA 2CPSA 1LT9C 3B8EB 4COPA 1S9KE 1G2CA 1G1IA 2XZRA 3B5ND 1JOCA 4DZOA 3CD6P 3CPWO 1RF1A 2FFDA 1FBMA 3M0AA 3OAKA 3CCMP 4RESB 2Q9IA 1E5WA 3V2PA 4JYCA 2Z46A 2YKPA 1GU5A 1RF0C 2VRSA 2MJZA 2P2UA 3U59A 5AW3B 1S72P 2PEJA 2NPSB 2FFDC 5HGMA 1RF1C 2WZ7A 3A2AA 1KILD 1NO4A 4IFMA 2PP6A 1S9KD 1CSBA 1HGZA 2XU6A 3H32A 1K30A 3RK2B 1HH0A 2KYVA 4C7NB 1HJBA 1JY2P 2M8NA 1GU4A 2WSCH 2WPQA 4LLHA 5AW6B 2JEEA 1JY3N 2YKQA 1VQ6P 1H88A 3KYQA 1H89A 3RL0C 2Q5UA 2LKMA 3EQ2A 2HODA 2R5BA 3RK3B 1JO5A 1NTMK 2IPPA 3OA7A 2XV6A 3CCSP 3VYIA 2H7HA 1SFCB 4W7YA 5AVUB 1NHLA 1T2KC 3HZQA 1VPCA 5CCHC 1X9VA 3H0DA 1ZR2A 1J1EC 3DS2A 1IO4A 2P1JA 3CC7P 4N3YB 3UIAA 3A7OA 5CCHD 1J1EB 5AVVB 1NTZK 1LWUB 1N7LA 1JNMA 1HWTC 1HBWA 2OYHC 5F2OA 3PP5A 5AW2B 1LTSC 3Q20A 1J2JB 1W2BO 2A45G 2EIAA 4LGDE 4GKGA 5KLVK 2YO2A 3CMAP 1FZCB 3RL0B 3NXSA 4U0EA 3M0DA 1KFNA 1VQKP 2P9XA 1T3JA 2NPSD 1GDTA 3DTJA 3SWFA 2JYGA 4M3LA 2PEQA 4HYTB 3SWYA 4I6MC 2OARA 1YHQP 3V2RA 3P7KA 2HG5D 5CHXA 3CCJP 3VN0A 2FXMA 1J1DC 4WY4D 4WY4A 3MD0A 5BU8B 3U1CA 1DX7A 2M8PA 3HTKB 5KJ7C 2XKMA 1K73Q 2HLOA 4O9BA 5AW7B 2IX7C 4GR6A 4JYBA 1N73A 2LF4A 3MGNA 1KZUB 2E42A 2YNYA 4W80A 1L4AA 1PFIA 1VQLP 2OYIA 1VQ4P 1GK4A 5APYA 3IFMA 1MFZA 1EOQA 1LGHB 4U0AA 3G1GA 1D1DA 3TNUB 4GIFA 3EFGA 5AW1B 1M1JB 1SQPK 1M74A 2QM8A 3U1AA 4U0BA 3P32A 4XROA 2QA4P 1T8ZA 2A45I 3VP8A 3GHGA 3LIDA 1GW3A 2QEXP 3CCQP 1CI6B 2IFNA 1RE3C 1KILC 5CCHA 5CCGC 2WT7A 3H4EA 2OTJP 4B86A 3V2QA 5F2NA 2PEKA 3CLQA 2M3BA 1URQA 4WYMA 3NMDA 2J58A 4XE5B 1LTBC 2YKOA 3NFQA 1OXZA 2Z5HA 5AW8B 4DOJA 1JJ2O 5APXA 1CZQA 2KP8A 2WPSA 3R2PA 2Q7CA 3WMM0 1LT9B 1YI2P 2XV5A 2PAJA 5F2KA 1M1KQ 3P8MC 1KQSO 5HGLA 3V4QA 4LC1A 1LTJA 2BHVA 1M90Q 1NKZB 1FZEA 5AW5B 5AVYB 1A43A 2Z45A 3RK3C 3G4SP 2ONTA 1JTHA 4N78E 2XXMA 1ZMBA 1FZCC 4XFXA 1DEBA 3KQGA 3M1MA 1GL2B 1JY2N 2HPCA 2CWOA 1N86A 5KJ7A 3MGEA 3RK2C 1SVFA 4OH8B 1SLQA 1BAJA 3I56P 1KQLA 1LWUC 3CL3D 1G2CB 1VQ5P 2FYUK 3HD7A 3LRYA 2NPSC 1L4AD 2FFDB 1RF1B 2PEMA 1M7LA 3HE4B 5BS2A 5AW0B 1L4AC 4EIJA 5CJ4A 1SFCC 1FOSE 4AUWA 2OYHB 3B5NC 3B5NA 1Q7YQ 2NPSA 3L35A 1VQ7P 2PENA 4WY4C 1JMMA 3RG6C 1QVGO 1LTAC 1YJ9P 2R3CA 4Y99C 3BRVB 1VQ8P 1XTGB 3H32B 3HE5B 1FOSF 3CMEP 3M9QA 3G0VA 2XDJA 1IC2A 2Z4EA 3DS5A 3C9IA 1N7SB 2L6EA 2OYIC 3P8CD 1AQ5A 1NH4A 4M0IA 1YJWP 5APWA 1E6JP 1KFMA 3CC2P 1SFCA 2E1MA 3T97A 1VQOP 3HD7C 1M1JC 2O1KA 2L5GB 3CCVP 3KPEA 1K8AQ 2FKWB 1IFIA 2M8RA 3E2DA 2OTLP 4XA4A 4GT1A 2YMYA 3HUSA 1RE4C 3DS1A 2C0XA 1A02J 1YYCA 4C7RA 3VMYA 1GZLA 1AUMA 2CPBA 1L0NK 3VTPC 1JY3O 2J59M 2N1TB 1EQ7A 1QL2A 2W6AA 1GK6A 1IFJA 3VRLC 3KDPB 1FU1A 1RO2A 1SQXK 1FZFA 1KILA 1K9MQ 1RNIA 5AVWB 1KC8Q 5APSA 2XT1A 3P05A 1MZ9A 1X8YA 2HFED 1ZLLA 5AVSB 1VDFA 2W27A 5CMZA 1IUQA 2POHA 1L0LK 3VP9A 2I1JA 1IFNA 1QL1A 4Y99B 4PH1A 1N8RQ 3G29A 3CCLP 3H47A 4W7ZA 4U0FA 4XFZA 1N73B 3P8CE 4ZKPA 1RE4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CLQ A;  1SQX K;  3HZQ A;  3LW5 H;  1NU1 K;  1SQQ K;  2OAR A;  1SQV K;  2O01 H;  3M9Q A;  1NTZ K;  1SQP K;  2WSC H;  4IFD K;  2FYU K;  1L0L K;  2WSF H;  2WSE H;  2LKM A;  1L0N K;  1NTM K;  5KLV K;  3G3Z A;  2J59 M;  1NTK K;  1SQB K; 
#chains in the Genus database with same CATH topology
 2GDY A;  3L71 E;  3NY7 B;  5APT A;  4H0L D;  1RF0 A;  3L73 G;  4PV1 C;  4DCK A;  5CBN A;  2JO1 A;  2ITA A;  3FX0 A;  5AVT B;  2K3R A;  4PH0 A;  1Z6M A;  4C46 A;  2HR3 A;  1GXG A;  1URQ C;  3MHV A;  2P7J A;  2WT7 B;  5L8R J;  4TT3 H;  3E1I A;  3DPH A;  4U0D A;  2QE7 H;  1RQV A;  2KGC A;  2Z5I A;  1OW6 A;  2PGD A;  4EYY Q;  1OIP A;  2WSF H;  2WSE H;  2YMK A;  2I1K A;  1KOR A;  4H2W C;  1L0L J;  3LMO A;  1H0T B;  4Z1M H;  3BCC G;  2Z44 A;  4UHP B;  1GL2 D;  3CCU P;  3HYB A;  2R44 A;  1NAF A;  1IFM A;  5DCK A;  5KTB A;  1ZME C;  1SP4 A;  3CX5 D;  1X0T A;  1BE3 J;  2WWW A;  1KB9 D;  2FQ0 A;  1ZR4 A;  1GW4 A;  2AEJ A;  1SQX E;  3AE5 C;  3B5I A;  3V4W A;  2EFJ A;  1BGY E;  5KKZ B;  1CW5 A;  5AVX B;  3G71 P;  1RY3 A;  5GTH H;  1GD2 E;  4QKO A;  3HE5 A;  2M5A B;  2QIW A;  1A02 F;  3M9H A;  4R4M A;  1DH3 A;  1EZV G;  3AEF C;  3HTK A;  3H6P A;  3L70 E;  1T3U A;  5AW9 B;  1SQV J;  1MUU A;  4OGQ B;  1NKN A;  1GTW A;  3AE1 C;  1UJZ A;  3A3Y B;  3M91 A;  2AFE A;  2QNW A;  3O8Z A;  4WB4 A;  1ZN5 A;  1SFC D;  3I55 P;  3CCE P;  1JB0 J;  1RE3 A;  2P67 A;  2N1T C;  2EHT A;  1S4X A;  3GF7 A;  5TIS E;  3QWO C;  2JGP A;  5APU A;  3L73 E;  4U3F E;  4BRY B;  1UIX A;  5GTI H;  2WIT A;  3H1L E;  1OZH A;  2PEO A;  3KXD A;  2C9L Y;  3V2N A;  1JEK A;  1AF8 A;  3H1K J;  4DG9 A;  2OQQ A;  3M9B A;  2KR5 A;  3V6I A;  2WSE J;  2WSC J;  3CC4 P;  1JTH B;  1L0N G;  3MUD C;  3WUU A;  2AXC A;  2PY8 A;  2HPC B;  2ZXE B;  5BS1 A;  2N6Y A;  3ITK A;  3TGU E;  4QNB A;  1Q81 Q;  2H8P D;  2IZ1 A;  5APQ A;  1G1I A;  4DZO A;  3FXE A;  1SQV G;  2L4B A;  2FFD A;  3CCM P;  3V2P A;  3L73 D;  2MJZ A;  2P2U A;  2YIU C;  3U59 A;  2PEJ A;  2NPS B;  2FFD C;  2WZ7 A;  4IFM A;  3L70 J;  5EW5 E;  1KYO I;  3L75 J;  3H32 A;  2QSI A;  1KYO E;  2KOO A;  2M8N A;  4LLH A;  3GMA A;  3BCC E;  3RL0 C;  2Q5U A;  2LKM A;  5B66 H;  2R5B A;  3RK3 B;  1FDI A;  2M3E A;  2XV6 A;  4K35 A;  2H7H A;  2JU1 A;  5AVU B;  3HZQ A;  1VPC A;  2K1A A;  2FVF A;  1DD4 A;  2P1J A;  1SQQ J;  3UIA A;  1EDJ A;  1J1E B;  1LWU B;  1JNM A;  2CNR A;  2OYH C;  4R0M A;  3PP5 A;  5GTI E;  1Y8A A;  2JKV A;  4MRT C;  1J2J B;  2K9Y A;  5KLV K;  4LGD E;  4PD4 I;  1USE A;  3M0D A;  1T3J A;  1GDT A;  2JYG A;  1KMI Z;  3SWY A;  1SQP E;  2HG5 D;  5CHX A;  2FXP A;  3VN0 A;  3L74 G;  1J1D C;  4WY4 A;  2NZ2 A;  3E7K A;  2D2C D;  2XKM A;  2GZG A;  2DW3 A;  1K73 Q;  1R5L A;  4JYB A;  1N73 A;  1X3O A;  2LF4 A;  3MGN A;  1P84 I;  1L4A A;  4H0L B;  2OYI A;  3USS A;  5APY A;  1EOQ A;  4U0A A;  4H44 D;  4GIF A;  3EFG A;  2XZ1 C;  2JB0 A;  1T8Z A;  2YXR B;  3PH0 A;  3VP8 A;  5CBO A;  3CCQ P;  3D70 A;  1EMV A;  1CI6 B;  1RE3 C;  4B86 A;  3PJS K;  3CLQ A;  2L91 A;  2QJP B;  1LTB C;  2Z5H A;  1JJ2 O;  2Y9Z A;  1EDL A;  1VF5 D;  1YI2 P;  1M1K Q;  2KGE A;  2BCC D;  4LC1 A;  3L71 D;  2BHV A;  1M90 Q;  1QGK B;  2BCC J;  2AEM A;  1A43 A;  2Z45 A;  3H1H E;  1EDI A;  3H1I E;  4N78 E;  2KG6 A;  2XXM A;  1FZC C;  4HKG A;  1H0T A;  3KQG A;  3M1M A;  1GL2 B;  2FY8 A;  2PRR A;  3TDK A;  3CXH D;  2AF8 A;  2G3A A;  4L74 A;  2LR2 A;  1LWU C;  2K94 A;  2FYU K;  3HD7 A;  3LRY A;  5EFW B;  4U3F D;  1BXI A;  3AE7 C;  5B66 E;  5BS2 A;  1L4A C;  2GZE A;  1SFC C;  1PPJ G;  3RBZ A;  2M0B A;  3L35 A;  1JMM A;  3GF3 A;  1AYI A;  1BGY D;  4UB6 E;  4U7J A;  3HE5 B;  1PGQ A;  1SQX D;  3M9Q A;  1HJ0 A;  2KZI A;  3L72 D;  2MD9 A;  1NH4 A;  4M0I A;  2MKV A;  5APW A;  2ZXX A;  3AE9 C;  3KPE A;  3CCV P;  1EC5 A;  2FKW B;  2M8R A;  1PV3 A;  2OTL P;  4WVZ A;  1RE4 C;  2O01 J;  4C7R A;  3VMY A;  1GZL A;  3CWB D;  1RH5 B;  2CPB A;  1JY3 O;  2J59 M;  2W6A A;  1IFJ A;  2QJK C;  4EDF A;  2K93 A;  1RNI A;  5APS A;  2NRG A;  1KTM A;  3P05 A;  1ZLL A;  3AEE C;  1BCC G;  2POH A;  4QMA A;  3D71 A;  3VP9 A;  2VLN A;  2JAZ A;  1IFN A;  1EDK A;  1OMI A;  2VSQ A;  2KNC A;  4XFZ A;  3P8C E;  2QM8 A;  1YTZ T;  3TGU D;  4ZMD A;  3TNU A;  2WPR A;  3FWL A;  4I2L C;  1KIL E;  2R32 A;  3D6Z A;  3GHG B;  3N4X A;  1VQ9 P;  1JUN A;  2H43 A;  3CE7 A;  4UB6 H;  1EZV D;  1HVV A;  2FQ2 A;  1Q2N A;  2GUV A;  3CXH I;  2WSS H;  1FR2 A;  3DS4 A;  1NOH A;  1PZQ A;  3JSV C;  1Q82 Q;  3L74 D;  4IFD K;  1FZB A;  2XNX A;  5AVR B;  1ACP A;  5BVZ A;  3Q5P A;  2Y0C A;  4UB8 E;  5APV A;  2GA1 A;  2C0W A;  5BU5 A;  2E43 A;  3VOP A;  2RKL A;  2O01 N;  3G6E P;  1YBK A;  1HTL C;  1RO0 A;  1HGV A;  1LWU A;  5JPA A;  2BEQ D;  3JCU E;  2KS1 A;  2MF4 A;  3G21 A;  1L0H A;  3BAT A;  2EG5 A;  4H44 C;  3TK1 A;  3W67 A;  3HE4 A;  2KOG A;  1MZ8 A;  2CGQ A;  1LTJ C;  1USD A;  1FZC A;  1SQQ D;  3GHG C;  2OYH A;  1ZV8 A;  3L75 G;  3H1H D;  1AFO A;  3CCR P;  3T97 A;  3LW5 H;  4N6J A;  1SQQ K;  2M8L A;  1PIX A;  3AEC C;  1OWA A;  3RGU A;  3LW5 J;  2D2C C;  3B4Q A;  4WWI A;  2N9B A;  2IYO A;  1BDC A;  3H1I J;  2ZYA A;  3L72 J;  4ZKU A;  5KLV J;  4AQR D;  4NEO A;  3FXD A;  3RK2 D;  2KG9 A;  1RHZ B;  2LXC B;  4CA3 A;  3HUS C;  3C1L A;  4BXL A;  2OYI B;  4U3F G;  2FVA A;  5DJT B;  5KAF H;  2IYP A;  2FQ1 A;  4COC A;  3TSI A;  1FJP A;  3WUT A;  4BWN A;  4GR2 A;  1OVR A;  1FAV A;  1YTZ I;  3CI9 A;  3AE8 C;  1CI6 A;  4D6T G;  3PRJ A;  2N1T A;  1SQB K;  1ZXG A;  1SQB D;  1L0L E;  4DT0 A;  2E76 D;  4WBA A;  1LT9 A;  4NPE A;  2ZVO B;  1PP9 E;  3MUD A;  3SSU A;  4H13 B;  1FZG A;  3AEA C;  4YTP C;  1HQB A;  3AEG C;  1GL2 A;  5HGO A;  2PEI A;  4NPD A;  5H2F H;  2WSF J;  3NTE A;  2FBW C;  4COP A;  3B8E B;  4H0L C;  3B5N D;  2XZR A;  1RF1 A;  2GDX A;  1FBM A;  2Q9I A;  3GW6 A;  4JYC A;  1LP1 A;  1RF0 C;  5KP6 B;  1EXI A;  3TGU G;  3Q3D A;  1WMK A;  4ASV A;  2PP6 A;  1S9K D;  2E74 B;  3EJE A;  4H13 C;  1HH0 A;  2KYV A;  1SQB E;  2KZJ A;  2DNW A;  3IAO A;  5AW6 B;  1BCC D;  2FYU J;  3H25 A;  2R3S A;  2KUB A;  1DEE G;  3EQ2 A;  1JO5 A;  5EJD A;  2LKI A;  2IPP A;  3CCS P;  5KAF E;  4GOE A;  3H0D A;  1ZR2 A;  3DS2 A;  1X22 A;  1E0H A;  3CWB G;  4N3Y B;  3A7O A;  5TIS H;  5AVV B;  2K2Q A;  1N7L A;  3GZL A;  5F2O A;  1KV4 A;  2MY5 A;  5AW2 B;  1LTS C;  1W2B O;  1KB9 H;  3CX5 H;  2YO2 A;  3CMA P;  3RL0 B;  3MZW B;  3BCC D;  1KFN A;  3DTJ A;  5TJH A;  2PEQ A;  4I6M C;  2OAR A;  5GTH E;  3P7K A;  2M5A A;  2ZVN B;  5B5E E;  1AA0 A;  2IZ0 A;  1NTM J;  3E1R A;  1PGJ A;  2E76 B;  5AW7 B;  2IX7 C;  4GR6 A;  3L75 D;  1AQT A;  1KZU B;  2E42 A;  2YNY A;  1L0N J;  1VQL P;  1PFI A;  1VQ4 P;  1GK4 A;  3WU2 H;  3TNU B;  2KK7 A;  3U1A A;  4U0B A;  4XRO A;  2JR8 A;  3EWK A;  2GDW A;  1AVY A;  2B89 A;  2ROQ A;  1KIL C;  5CCG C;  3H4E A;  2OTJ P;  2IBZ E;  2PEK A;  4WYM A;  4XE5 B;  2J58 A;  3KZI H;  2YKO A;  3NFQ A;  2JBG A;  4HJG H;  3WMM 0;  3R2P A;  2Q1K A;  2MVU A;  2JDI H;  2PAJ A;  3EFF K;  3P8M C;  1FZE A;  1VF5 C;  3RK3 C;  1T6A A;  4JBZ A;  3G4S P;  1ZNV A;  1NGM B;  1ZMB A;  1DEB A;  2ZT9 B;  2VLO A;  2ZYD A;  1JY2 N;  2HPC A;  1BSN A;  5HV8 A;  1N86 A;  5KJ7 A;  4OH8 B;  3SWK A;  1SLQ A;  2FAC A;  3I56 P;  3CL3 D;  1G2C B;  3RG2 A;  1VQ5 P;  3IN6 A;  3HE4 B;  2FYU E;  2NO8 A;  5CJ4 A;  2OYH B;  3B5N C;  3B5N A;  1NTM E;  2NPS A;  2PEN A;  3H1L G;  2W8Z A;  3T97 B;  1QVG O;  1LTA C;  4PWV B;  2A06 D;  1EZV I;  3BRV B;  4I7Z C;  1VQ8 P;  3H32 B;  2ZJS E;  3IF4 A;  4OWF A;  3JCU H;  1PGP A;  1IC2 A;  2WQY C;  2Z4E A;  3Q1M A;  1KQF B;  2L22 A;  2L6E A;  1FS0 E;  1P84 D;  2E75 C;  1NAY A;  1KLP A;  3O6Q A;  1E6J P;  1SFC A;  1VQO P;  1BDD A;  3HD7 C;  2O1K A;  4BPH A;  1IFI A;  3E2D A;  4GT1 A;  3W68 A;  2YMY A;  3HUS A;  5B5E H;  1YYC A;  1AUM A;  2P58 A;  3VTP C;  5KP8 B;  1EQ7 A;  1QL2 A;  2B88 A;  1SQB J;  1KIL A;  2Y9Y A;  1K9M Q;  4K3A A;  3BCC J;  2XT1 A;  2WPT A;  2HFE D;  5AVS B;  3L72 G;  1IUQ A;  2G8Y A;  2N50 A;  4D6T D;  1QL1 A;  1NU1 E;  1VL2 A;  2E5Y A;  4PD4 E;  4Y99 B;  1U7J A;  1BGY G;  1TU3 F;  2CG5 B;  2V7Q H;  4ZKP A;  1L4A B;  2CK3 H;  3MTU E;  1KB9 I;  1SQV K;  1KB9 E;  1AJY A;  2JJL A;  4IPY A;  4HH2 A;  4L76 A;  1BCC J;  1LP1 B;  3G28 A;  3Q5S A;  3OJA B;  1S2E A;  3N7N A;  3A5T A;  2BCC E;  2K88 A;  1IK9 A;  3H1H J;  3L37 A;  2E74 D;  1OW7 A;  2BEZ F;  1M6N A;  3H1H G;  2OYO A;  3BAS A;  5DJU B;  1L0N E;  1R5S A;  1QX8 A;  1JCC A;  2DGY A;  2KOD A;  1NU1 D;  1SQV D;  1ZOY C;  1M8O B;  1KQG B;  1NU1 K;  1SQX J;  1H8A A;  1GMJ A;  2N1T D;  1IFD A;  1U57 A;  1VHN A;  3G26 A;  1BGY J;  3HD7 B;  3HRN A;  3TYY A;  3LIE A;  1VQN P;  2QJY C;  3CXH E;  1Z56 A;  3F89 A;  1NJI Q;  1BE3 E;  3WBH A;  1URQ D;  3BVH A;  5KLV E;  2O01 H;  2IFM A;  1NTZ E;  2WTY A;  4IL6 X;  1J1D B;  3OW2 O;  3F5H A;  1JCD A;  2H88 C;  4H13 D;  5CCG A;  1N7S D;  1N7S A;  3L4F A;  1YIJ P;  2ZYG A;  4XRQ A;  1IZN B;  2IDB A;  1VQP P;  2E75 D;  3RK3 D;  1WT6 A;  4EOT A;  3L70 G;  4MN4 C;  3VMZ A;  1GPJ A;  2O3J A;  1NTM D;  4KHX A;  4BPF A;  1LTI C;  2ZFC A;  2PFX A;  5K5G B;  3G1I A;  2QM7 A;  4HKZ H;  3H1K E;  2K37 A;  1FDO A;  2KIK A;  2N5I A;  1MKM A;  2GUS A;  1E79 H;  3FGA D;  1WRG A;  1ZW0 A;  2HYN A;  1K04 A;  1T2K D;  2QRX A;  2J5U A;  3I5C A;  4L73 A;  2K92 A;  5I4T G;  1GL2 C;  2N98 A;  2L9F A;  3G3Z A;  2FYZ A;  4JF7 A;  2KNC B;  5CJ0 A;  2A45 H;  1EXJ A;  2Q3I A;  1QLE D;  3K5B A;  3DS0 A;  3RL0 g;  2LXB A;  2C9N Y;  2JYL A;  1FC2 C;  3Q2Y A;  4U0C A;  1S1C X;  1LT9 C;  2KOR A;  1G2C A;  3CD6 P;  3CPW O;  3OAK A;  4RES B;  2Z46 A;  3L74 J;  2VRS A;  3H1J G;  1S72 P;  1AVO A;  5HGM A;  4IL6 H;  1KIL D;  1NO4 A;  3H1J J;  2LML A;  4PD4 H;  1CSB A;  2WPV B;  1HGZ A;  2XU6 A;  1K30 A;  1F80 D;  4C7N B;  1JY2 P;  2WPQ A;  2YKQ A;  2B9B A;  3H1J D;  3KYQ A;  1H89 A;  5KLI C;  2HOD A;  1NTM K;  3MP7 B;  3CXH H;  1VF5 B;  3OA7 A;  5KLV G;  1SFC B;  2M5R A;  1NHL A;  1T2K C;  3WUV A;  2GYK A;  1NTZ D;  5KLI B;  2Q6Q A;  2LPK A;  3CC7 P;  4RKU J;  1K05 A;  1HBW A;  3L70 D;  1SQQ E;  3Q20 A;  2EIA A;  3AE6 C;  1FZC B;  1PP9 J;  2WMM A;  2KLU A;  3SWF A;  4M3L A;  1PGO A;  2LOL A;  4HYT B;  1YHQ P;  3GKL C;  2JU2 A;  2K0Y A;  1NYH A;  2FAD A;  3CWB J;  4WY4 D;  1Y47 A;  2V4H A;  3MD0 A;  3S4R A;  5BU8 B;  3U1C A;  1DX7 A;  2M8P A;  3KHU A;  5KJ7 C;  3Q5R A;  2ERH A;  1VKU A;  4O9B A;  3H1L D;  1KYO D;  4W80 A;  1P84 E;  4YXD C;  2IBZ G;  3IFM A;  1MFZ A;  1LGH B;  3G1G A;  1D1D A;  2V7Q J;  5AW1 B;  3U43 A;  1M1J B;  1SQP K;  1GW3 A;  1CEI A;  2QEX P;  2FYN B;  1HY8 A;  2WT7 A;  5CCH A;  3V2Q A;  1NU1 G;  4F37 A;  3GLM A;  2AVA A;  1OXZ A;  4DOJ A;  3L72 E;  5APX A;  1CZQ A;  2WPS A;  2Q7C A;  1LT9 B;  4JPZ B;  1NTK J;  1KQS O;  5HGL A;  3V4Q A;  1LTJ A;  7CEI A;  2E76 C;  5AVY B;  4GOD A;  3RK3 E;  1SQV E;  2CWO A;  3MGE A;  3RK2 C;  1SVF A;  1RF1 B;  2ZAE B;  3L71 J;  2AFD A;  1S5L E;  4PV1 B;  4YXW H;  3CWB E;  1VQ7 P;  4WY4 C;  1QEX A;  3A0H H;  1YJ9 P;  1BE3 D;  1AV1 A;  4Y99 C;  2D2C B;  1FOS F;  4PXH B;  3CME P;  3G0V A;  2XDJ A;  4GDO A;  3C9I A;  1N7S B;  2B87 A;  3P8C D;  2KSE A;  1AQ5 A;  1YJW P;  4H44 B;  2N6Z A;  1SQP G;  1OVU A;  5M1B A;  1M57 D;  1PPJ D;  4BPG A;  1YQ3 C;  1K8A Q;  3B71 A;  1PP9 D;  4XA4 A;  5KAI H;  3DS1 A;  1LT1 A;  1L0N D;  2KI7 B;  1DNY A;  4PJ0 E;  3RBX A;  1L0N K;  3H1J E;  3GG2 A;  1ZRT D;  3CX5 E;  1GK6 A;  3VRL C;  3KDP B;  1FU1 A;  4GOF A;  2MR8 A;  1FZF A;  4JQ0 D;  2QJY B;  2QG4 A;  1VDF A;  2W27 A;  1L0L K;  1L0I A;  4PH1 A;  2A06 G;  3CCL P;  3H47 A;  1OX3 A;  4W7Z A;  4U0F A;  1UNK A;  1RE4 A;  2AEF A;  4CPG A;  2RMZ A;  5KJ7 D;  1FJK A;  2KSJ A;  5H2F E;  1BCC E;  2KGA A;  1QVF O;  1JMB A;  1IMQ A;  2W6J H;  2OGU A;  2JQ4 A;  3HD7 D;  2YXQ B;  1L0L G;  5AVZ B;  3L36 A;  3SFD C;  4R4L A;  1NTK E;  3VMX A;  2N5H A;  2JP3 A;  1NTK K;  3M0D C;  3DS3 A;  1PL5 A;  1URQ B;  2E5T A;  5CCG D;  2FYU D;  5KP7 B;  1KYO H;  1YIT P;  1S5L X;  4C7N A;  2FHS C;  3L73 J;  5HGN A;  2GZJ A;  4U3F J;  4AYC A;  2JWD A;  1M6E X;  1A8O A;  3WU2 E;  2KWL A;  2HOD B;  1OR5 A;  4H2Y C;  5KKZ C;  2KLV A;  3M06 A;  1N73 C;  3PLN A;  2KGD A;  2E75 B;  4XFY A;  1FZA A;  1QRJ A;  3ABV C;  2FXO A;  1HUC A;  1JY3 P;  1OW8 A;  2JWA A;  2P10 A;  4IFF A;  1Q86 Q;  3II6 A;  2GM4 A;  1Y9B A;  2Y0E A;  1X79 B;  2A06 E;  3B5N B;  1NTZ J;  2BUO A;  5AVQ B;  1YJN P;  3H1I D;  4N78 D;  3IR9 A;  2I8D A;  3BRT B;  1SQB G;  2K0X A;  3G9R A;  1ZP0 C;  2O1J A;  3V5B A;  2BAS A;  4WY4 B;  1SQX G;  5AW4 B;  1ZRT E;  3AE4 C;  2VLP A;  3CX5 I;  4PJ0 H;  3H1I G;  3NTN A;  3R4Y A;  4IZ6 A;  3O6Q B;  1VQM P;  2EHS A;  1SQQ G;  1W2E A;  4I1L A;  4PD4 D;  3H1K G;  1IJD B;  1N2D C;  1M1J A;  1UII A;  3HUS B;  1EIA A;  2QJK B;  3A0H E;  1HF9 A;  1LTG C;  2KB7 P;  1NWQ A;  3ZDM A;  2LTE A;  1KIL B;  3KZI E;  3CXC O;  4RO0 A;  1LTT C;  2K9J B;  2YO3 A;  3RL0 D;  4A7P A;  2W6B A;  1FDM A;  1U7M A;  1L2P A;  1LTJ B;  3GZM A;  1NTK D;  5C39 A;  1IK7 A;  3PTZ A;  4YPC A;  1MV8 A;  3EJD A;  1N7S C;  4OVN F;  1JY2 O;  2H89 C;  2R5D A;  1XTC C;  2Y0D A;  2JO0 A;  1G1J A;  1KN7 A;  1KD1 Q;  1JM0 A;  3L74 E;  2SPZ A;  2KOQ A;  3MIW A;  2CPS A;  1S9K E;  1SS1 A;  1JOC A;  2N9Y B;  3M0A A;  1E5W A;  2RH0 A;  1IFP A;  3TGU J;  2YKP A;  1GU5 A;  4PV1 D;  5HVC A;  4TLF A;  5AW3 B;  2XND H;  1DD3 A;  1RF1 C;  4NPF X;  3A2A A;  2FYU G;  1NTK G;  3RK2 B;  3S1K A;  2WVR A;  5E79 H;  1HJB A;  4ZNC A;  1GU4 A;  2WSC H;  2JEE A;  1JY3 N;  4KJM A;  1VQ6 P;  4I7Z B;  4D6T J;  1H88 A;  3GJN A;  1FE6 A;  1S5L H;  2LIW A;  2B87 B;  3L75 E;  3VYI A;  4W7Y A;  2UWJ E;  5CCH C;  1X9V A;  1YQ4 C;  1J1E C;  1IO4 A;  1PPJ E;  2K5X A;  5CCH D;  1NTZ K;  1HWT C;  4XFJ A;  2ZT9 D;  1RQU A;  3H1K D;  2A45 G;  2FYN C;  2ZT9 C;  3A0B H;  4L75 A;  1W5C E;  4GKG A;  3AED C;  2MVV A;  3NXS A;  2KOP A;  4U0E A;  1VQK P;  2P9X A;  5KLV D;  2NPS D;  2IBZ I;  3JC2 2;  1IMP A;  1BSH A;  1DV5 A;  3V2R A;  5KAI E;  3CCJ P;  2FXM A;  3PHL A;  4EI2 A;  1SQP J;  3HTK B;  2GZI A;  2HLO A;  1LNQ A;  1LJ2 A;  2AXT H;  2RN0 A;  1PP9 G;  1M74 A;  3P32 A;  2QA4 P;  2A45 I;  1SQP D;  4IL6 E;  3GHG A;  2MR7 A;  3LID A;  2KW2 A;  3AE2 C;  2IFN A;  3AE3 C;  4ASW A;  2K0D X;  5F2N A;  4BRY A;  2M3B A;  1URQ A;  3NMD A;  2W90 A;  5AW8 B;  3L71 G;  2KP8 A;  2FVE A;  3QH9 A;  2XV5 A;  5F2K A;  2KG8 A;  3D6Y A;  1NKZ B;  5AW5 B;  2ONT A;  2L0Q A;  1JTH A;  4XFX A;  2GZF A;  1GXH A;  1NTM G;  1BAJ A;  1L0L D;  1KQL A;  2OTK E;  1DIP A;  2KS1 B;  2NPS C;  1L4A D;  2FFD B;  2YIU B;  3SFE C;  2PEM A;  1M7L A;  2IBZ D;  5AW0 B;  4EIJ A;  2BCC G;  1FOS E;  4AUW A;  1Q7Y Q;  2CQ8 A;  3RG6 C;  1T8K A;  4RJT A;  4DJG A;  3AEB C;  3S9O A;  2R3C A;  1EZV E;  1NVO A;  1XTG B;  1OVV A;  2QJP C;  4HB1 A;  3C8V A;  2AXT E;  2E74 C;  3DS5 A;  1NQ4 A;  1P84 H;  2OYI C;  2PNG A;  3A0B E;  1KFM A;  3CC2 P;  2VLQ A;  2E1M A;  1M1J C;  2L5G B;  4UB8 H;  2LL8 A;  4IOI H;  2X2B A;  1OFC X;  5CZD B;  2C0X A;  1A02 J;  2KOS A;  2W83 C;  3FWN A;  1NTZ G;  1S3J A;  2N1T B;  2KXP B;  5E79 E;  1Q90 D;  2QVA A;  1RO2 A;  4KT0 J;  2XZ0 D;  1SQX K;  5AVW B;  1KC8 Q;  4D6T E;  1MZ9 A;  1NU1 J;  1R8E A;  1X8Y A;  2K9J A;  2Q3E A;  4H2X C;  4OGQ D;  5CMZ A;  2FAE A;  2LIU A;  1M56 D;  3EJB A;  1MFT A;  2I1J A;  4OGQ C;  4Y28 J;  1N8R Q;  1BE3 G;  3H1L J;  3G29 A;  3TF5 A;  1N73 B;  1D7M A;  3B4S A;  3VMA A; 
#chains in the Genus database with same CATH homology
 1YTZ T;  5APT A;  1L4A B;  3MTU E;  1SQV K;  1FJK A;  1RF0 A;  2KSJ A;  5KJ7 D;  3TNU A;  1QVF O;  2WPR A;  5AVT B;  2JJL A;  4IPY A;  4I2L C;  3HD7 D;  4HH2 A;  2R32 A;  5AVZ B;  4PH0 A;  3GHG B;  3N4X A;  3L36 A;  1VQ9 P;  1JUN A;  4C46 A;  2H43 A;  1URQ C;  3G28 A;  2P7J A;  2WT7 B;  1HVV A;  3VMX A;  2GUV A;  3OJA B;  1NTK K;  3N7N A;  3A5T A;  3M0D C;  3DS3 A;  3DS4 A;  1NOH A;  1URQ B;  1IK9 A;  5CCG D;  3L37 A;  3E1I A;  1M6N A;  3DPH A;  1YIT P;  4U0D A;  4C7N A;  1Q82 Q;  4IFD K;  2Z5I A;  1FZB A;  2XNX A;  5AVR B;  5HGN A;  3BAS A;  4AYC A;  2WSF H;  2WSE H;  5BVZ A;  2I1K A;  1M6E X;  1A8O A;  2HOD B;  5APV A;  2KLV A;  2C0W A;  3M06 A;  5BU5 A;  2E43 A;  1JCC A;  3VOP A;  2DGY A;  2KOD A;  1N73 C;  2Z44 A;  1GL2 D;  3CCU P;  3HYB A;  1NAF A;  3G6E P;  1IFM A;  1NU1 K;  1HTL C;  5DCK A;  4XFY A;  1FZA A;  1QRJ A;  1H8A A;  1RO0 A;  5KTB A;  2N1T D;  1HGV A;  1SP4 A;  5JPA A;  1HUC A;  1LWU A;  1IFD A;  1JY3 P;  3G26 A;  2WWW A;  3HD7 B;  1ZR4 A;  3HRN A;  3TYY A;  3LIE A;  4IFF A;  1VQN P;  1GW4 A;  1Q86 Q;  3II6 A;  3G21 A;  2GM4 A;  3BAT A;  2EG5 A;  3TK1 A;  3HE4 A;  1Z56 A;  1NJI Q;  2KOG A;  3B5I A;  1LTJ C;  3V4W A;  2EFJ A;  1FZC A;  1X79 B;  3GHG C;  2OYH A;  3B5N B;  3WBH A;  1ZV8 A;  2BUO A;  1CW5 A;  1AFO A;  1URQ D;  3CCR P;  5AVQ B;  3LW5 H;  4N6J A;  1YJN P;  2M8L A;  1SQQ K;  4N78 D;  1OWA A;  3IR9 A;  5AVX B;  3G71 P;  1RY3 A;  3BVH A;  3BRT B;  1GD2 E;  2O01 H;  2N9B A;  3HE5 A;  2IFM A;  2O1J A;  2WTY A;  3V5B A;  1J1D B;  2BAS A;  1A02 F;  3M9H A;  4WY4 B;  3OW2 O;  5AW4 B;  1JCD A;  5CCG A;  1N7S D;  1DH3 A;  1N7S A;  4ZKU A;  3HTK A;  4AQR D;  3H6P A;  1T3U A;  5AW9 B;  3RK2 D;  3L4F A;  3NTN A;  1MUU A;  1VQM P;  1NKN A;  1YIJ P;  1GTW A;  3HUS C;  1W2E A;  4I1L A;  4XRQ A;  3A3Y B;  1VQP P;  3M91 A;  2OYI B;  3RK3 D;  1IJD B;  3O8Z A;  1N2D C;  4WB4 A;  1WT6 A;  1ZN5 A;  1M1J A;  4EOT A;  1SFC D;  3HUS B;  3I55 P;  3VMZ A;  4COC A;  3TSI A;  3CCE P;  4KHX A;  1FJP A;  1EIA A;  1RE3 A;  2P67 A;  2N1T C;  4GR2 A;  1LTG C;  1FAV A;  1YTZ I;  1LTI C;  3CI9 A;  2KB7 P;  1NWQ A;  1CI6 A;  2ZFC A;  2N1T A;  5APU A;  3G1I A;  1SQB K;  2QM7 A;  2WIT A;  1KIL B;  3CXC O;  2PEO A;  1LTT C;  2GUS A;  2YO3 A;  2C9L Y;  1WRG A;  4WBA A;  3RL0 D;  3V2N A;  1LT9 A;  2W6B A;  2HYN A;  1FDM A;  1T2K D;  3MUD A;  3M9B A;  1LTJ B;  3I5C A;  1FZG A;  5I4T G;  1GL2 C;  3G3Z A;  3CC4 P;  1JTH B;  1MV8 A;  2FYZ A;  4JF7 A;  5CJ0 A;  1N7S C;  1JY2 O;  2A45 H;  2Q3I A;  2R5D A;  1XTC C;  2PY8 A;  3DS0 A;  1GL2 A;  2HPC B;  2JO0 A;  1G1J A;  5HGO A;  2ZXE B;  2PEI A;  5BS1 A;  1KD1 Q;  2C9N Y;  4QNB A;  1Q81 Q;  2JYL A;  2H8P D;  3MIW A;  3NTE A;  4U0C A;  5APQ A;  2CPS A;  1LT9 C;  3B8E B;  4COP A;  1S9K E;  1G2C A;  1G1I A;  2XZR A;  3B5N D;  1JOC A;  4DZO A;  3CD6 P;  3CPW O;  1RF1 A;  2FFD A;  1FBM A;  3M0A A;  3OAK A;  3CCM P;  4RES B;  2Q9I A;  1E5W A;  3V2P A;  4JYC A;  2Z46 A;  2YKP A;  1GU5 A;  1RF0 C;  2VRS A;  2MJZ A;  2P2U A;  3U59 A;  5AW3 B;  1S72 P;  2PEJ A;  2NPS B;  2FFD C;  5HGM A;  1RF1 C;  2WZ7 A;  3A2A A;  1KIL D;  1NO4 A;  4IFM A;  2PP6 A;  1S9K D;  1CSB A;  1HGZ A;  2XU6 A;  3H32 A;  1K30 A;  3RK2 B;  1HH0 A;  2KYV A;  4C7N B;  1HJB A;  1JY2 P;  2M8N A;  1GU4 A;  2WSC H;  2WPQ A;  4LLH A;  5AW6 B;  2JEE A;  1JY3 N;  2YKQ A;  1VQ6 P;  1H88 A;  3KYQ A;  1H89 A;  3RL0 C;  2Q5U A;  2LKM A;  3EQ2 A;  2HOD A;  2R5B A;  3RK3 B;  1JO5 A;  1NTM K;  2IPP A;  3OA7 A;  2XV6 A;  3CCS P;  3VYI A;  2H7H A;  1SFC B;  4W7Y A;  5AVU B;  1NHL A;  1T2K C;  3HZQ A;  1VPC A;  5CCH C;  1X9V A;  3H0D A;  1ZR2 A;  1J1E C;  3DS2 A;  1IO4 A;  2P1J A;  3CC7 P;  4N3Y B;  3UIA A;  3A7O A;  5CCH D;  1J1E B;  5AVV B;  1NTZ K;  1LWU B;  1N7L A;  1JNM A;  1HWT C;  1HBW A;  2OYH C;  5F2O A;  3PP5 A;  5AW2 B;  1LTS C;  3Q20 A;  1J2J B;  1W2B O;  2A45 G;  2EIA A;  4LGD E;  4GKG A;  5KLV K;  2YO2 A;  3CMA P;  1FZC B;  3RL0 B;  3NXS A;  4U0E A;  3M0D A;  1KFN A;  1VQK P;  2P9X A;  1T3J A;  2NPS D;  1GDT A;  3DTJ A;  3SWF A;  2JYG A;  4M3L A;  2PEQ A;  4HYT B;  3SWY A;  4I6M C;  2OAR A;  1YHQ P;  3V2R A;  3P7K A;  2HG5 D;  5CHX A;  3CCJ P;  3VN0 A;  2FXM A;  1J1D C;  4WY4 D;  4WY4 A;  3MD0 A;  5BU8 B;  3U1C A;  1DX7 A;  2M8P A;  3HTK B;  5KJ7 C;  2XKM A;  1K73 Q;  2HLO A;  4O9B A;  5AW7 B;  2IX7 C;  4GR6 A;  4JYB A;  1N73 A;  2LF4 A;  3MGN A;  1KZU B;  2E42 A;  2YNY A;  4W80 A;  1L4A A;  1PFI A;  1VQL P;  2OYI A;  1VQ4 P;  1GK4 A;  5APY A;  3IFM A;  1MFZ A;  1EOQ A;  1LGH B;  4U0A A;  3G1G A;  1D1D A;  3TNU B;  4GIF A;  3EFG A;  5AW1 B;  1M1J B;  1SQP K;  1M74 A;  2QM8 A;  3U1A A;  4U0B A;  3P32 A;  4XRO A;  2QA4 P;  1T8Z A;  2A45 I;  3VP8 A;  3GHG A;  3LID A;  1GW3 A;  2QEX P;  3CCQ P;  1CI6 B;  2IFN A;  1RE3 C;  1KIL C;  5CCH A;  5CCG C;  2WT7 A;  3H4E A;  2OTJ P;  4B86 A;  3V2Q A;  5F2N A;  2PEK A;  3CLQ A;  2M3B A;  1URQ A;  4WYM A;  3NMD A;  2J58 A;  4XE5 B;  1LTB C;  2YKO A;  3NFQ A;  1OXZ A;  2Z5H A;  5AW8 B;  4DOJ A;  1JJ2 O;  5APX A;  1CZQ A;  2KP8 A;  2WPS A;  3R2P A;  2Q7C A;  3WMM 0;  1LT9 B;  1YI2 P;  2XV5 A;  2PAJ A;  5F2K A;  1M1K Q;  3P8M C;  1KQS O;  5HGL A;  3V4Q A;  4LC1 A;  1LTJ A;  2BHV A;  1M90 Q;  1NKZ B;  1FZE A;  5AW5 B;  5AVY B;  1A43 A;  2Z45 A;  3RK3 C;  3G4S P;  2ONT A;  1JTH A;  4N78 E;  2XXM A;  1ZMB A;  1FZC C;  4XFX A;  1DEB A;  3KQG A;  3M1M A;  1GL2 B;  1JY2 N;  2HPC A;  2CWO A;  1N86 A;  5KJ7 A;  3MGE A;  3RK2 C;  1SVF A;  4OH8 B;  1SLQ A;  1BAJ A;  3I56 P;  1KQL A;  1LWU C;  3CL3 D;  1G2C B;  1VQ5 P;  2FYU K;  3HD7 A;  3LRY A;  2NPS C;  1L4A D;  2FFD B;  1RF1 B;  2PEM A;  1M7L A;  3HE4 B;  5BS2 A;  5AW0 B;  1L4A C;  4EIJ A;  5CJ4 A;  1SFC C;  1FOS E;  4AUW A;  2OYH B;  3B5N C;  3B5N A;  1Q7Y Q;  2NPS A;  3L35 A;  1VQ7 P;  2PEN A;  4WY4 C;  1JMM A;  3RG6 C;  1QVG O;  1LTA C;  1YJ9 P;  2R3C A;  4Y99 C;  3BRV B;  1VQ8 P;  1XTG B;  3H32 B;  3HE5 B;  1FOS F;  3CME P;  3M9Q A;  3G0V A;  2XDJ A;  1IC2 A;  2Z4E A;  3DS5 A;  3C9I A;  1N7S B;  2L6E A;  2OYI C;  3P8C D;  1AQ5 A;  1NH4 A;  4M0I A;  1YJW P;  5APW A;  1E6J P;  1KFM A;  3CC2 P;  1SFC A;  2E1M A;  3T97 A;  1VQO P;  3HD7 C;  1M1J C;  2O1K A;  2L5G B;  3CCV P;  3KPE A;  1K8A Q;  2FKW B;  1IFI A;  2M8R A;  3E2D A;  2OTL P;  4XA4 A;  4GT1 A;  2YMY A;  3HUS A;  1RE4 C;  3DS1 A;  2C0X A;  1A02 J;  1YYC A;  4C7R A;  3VMY A;  1GZL A;  1AUM A;  2CPB A;  1L0N K;  3VTP C;  1JY3 O;  2J59 M;  2N1T B;  1EQ7 A;  1QL2 A;  2W6A A;  1GK6 A;  1IFJ A;  3VRL C;  3KDP B;  1FU1 A;  1RO2 A;  1SQX K;  1FZF A;  1KIL A;  1K9M Q;  1RNI A;  5AVW B;  1KC8 Q;  5APS A;  2XT1 A;  3P05 A;  1MZ9 A;  1X8Y A;  2HFE D;  1ZLL A;  5AVS B;  1VDF A;  2W27 A;  5CMZ A;  1IUQ A;  2POH A;  1L0L K;  3VP9 A;  2I1J A;  1IFN A;  1QL1 A;  4Y99 B;  4PH1 A;  1N8R Q;  3G29 A;  3CCL P;  3H47 A;  4W7Z A;  4U0F A;  4XFZ A;  1N73 B;  3P8C E;  4ZKP A;  1RE4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...