2OARA

Mechanosensitive channel of large conductance (mscl)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
125
structure length
125
Chain Sequence
MLKGFKEFLARGNIVDLAVAVVIGTAFTALVTKFTDSIITPLINRIGVNAQSDVGILRIGIGGGQTIDLNVLLSAAINFFLIAFAVYFLVVLPYNTLRKKGEVEQPGDTQVVLLTEIRDLLAQTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of the Prokaryotic Mechanosensitive Channels MscL and MscS
pubmed rcsb
source organism Mycobacterium tuberculosis h37ra
molecule tags Membrane protein
molecule keywords Large-conductance mechanosensitive channel
total genus 42
structure length 125
sequence length 125
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2006-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01741 MscL Large-conductance mechanosensitive channel, MscL
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.120 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2oarA01
1.20.5.220 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2oarA02
3LW5H 3G3ZA 1SQVK 3HZQA 2LKMA 1NTZK 3CLQA 1L0LK 2WSFH 1NU1K 1SQBK 3M9QA 2WSEH 2J59M 2FYUK 5KLVK 2O01H 4IFDK 1NTKK 2WSCH 1SQPK 1NTMK 1SQQK 1L0NK 2OARA 1SQXK
chains in the Genus database with same CATH superfamily
2AF8A 3KXDA 3LW5J 1SQXG 1KILE 3AE7C 4XFJA 1KILD 2YO2A 2KLUA 1T2KC 4WWIA 2C0WA 5C39A 1U57A 1SQPK 4JBZA 2C9NY 2JO0A 1R8EA 3L75D 3P8MC 1SQXJ 2KS1A 3PP5A 4PV1D 3AEGC 5APTA 2K5XA 2Z46A 4GOFA 3MP7B 4UB8E 2N1TB 1S2EA 1KQFB 4D6TD 1NTKJ 1J1DB 1FS0E 1MKMA 3RBXA 2E5TA 1QVGO 4ZMDA 1M1JB 1SQQK 2OTJP 1JEKA 4WYMA 2MKVA 3TK1A 3P8CE 2XV5A 5AW7B 2PRRA 2K94A 3H0DA 4R4LA 2LXBA 3G9RA 2FFDA 1LJ2A 1QGKB 3MUDA 2AFDA 1SQBJ 2K9JB 2M5AA 5H2FE 4A7PA 5AVUB 3RL0C 2JR8A 4QNBA 2EHTA 1Q81Q 1RNIA 3U43A 1S5LE 3GF7A 2PFXA 1SQPJ 2JO1A 2R3SA 1BE3D 3OW2O 2KSJA 2OTKE 1XTCC 4PD4H 3WMM0 3BRVB 1GPJA 4PJ0E 2N1TD 4L75A 3V4WA 4O9BA 1IK7A 1NU1D 2M5RA 1P84H 3S1KA 2K9JA 2Q1KA 1D1DA 3L72G 2KGCA 5KLVK 1KYOE 1HGZA 1FOSE 1NVOA 1OFCX 3RGUA 3H1LG 2YIUB 1T2KD 1FZEA 3HTKB 2GM4A 1FZBA 2JU2A 3CC4P 2KGAA 3EJEA 5AW2B 2L0QA 2L22A 2JDIH 2Y0CA 3KDPB 1L0NJ 5KJ7A 1JM0A 5TISH 4PV1C 4OVNF 1QVFO 3LIDA 2GZGA 3G28A 1SQXE 4IPYA 1L4AA 2WT7B 4LGDE 2M8RA 3L73D 3SWFA 3CXHI 5APWA 2PGDA 2GA1A 1NU1E 3G21A 1RQVA 2CGQA 1NTKD 1NU1G 3M1MA 3O8ZA 2WZ7A 1URQC 4RKUJ 2FAEA 2XV6A 2ZYDA 1EZVI 3H1JE 1LP1A 1RE4C 1E79H 3SFEC 2IYOA 3CCMP 3Q20A 1ZNVA 3M9QA 5CJ4A 2KOQA 3K5BA 1BDCA 4OH8B 3RK2D 3H1IE 1L4AB 3VRLC 2N1TA 1EOQA 1L0IA 5CCHD 1G2CB 2IZ0A 3AE9C 3E2DA 3Q5SA 1LT9B 2IPPA 1M1JA 5TJHA 2NPSB 2D2CD 1VQ5P 3H47A 2I1JA 3H1HD 1JY3P 2FACA 2VRSA 3TSIA 3L72E 5CCGA 1Q90D 1QX8A 2E74B 2Z5IA 1JOCA 1S5LX 2PENA 1EZVD 1IFDA 1GK6A 1DD3A 3NTNA 3MUDC 1JY2P 1YI2P 1ZP0C 3TGUJ 3DS2A 2L91A 1L0LE 3B5ND 4I7ZC 2KGEA 4WY4A 3V5BA 2KSEA 2LOLA 3QH9A 2PNGA 3A3YB 2WSCH 3HE4A 3L36A 2BCCG 2IZ1A 4RJTA 4JYCA 3Q5PA 2CPBA 3EJBA 5AVRB 1RQUA 1M90Q 1KILA 2IBZI 3RK3C 4DJGA 5HV8A 4M3LA 2CWOA 3HUSA 4DZOA 2P10A 4HYTB 3PRJA 1AVOA 5F2KA 1NTMG 4I6MC 3CX5D 2N1TC 3VP8A 2Z44A 4W7YA 1S72P 1H0TB 5GTIH 3E7KA 1VF5D 5KAIE 1Y9BA 3CE7A 2K3RA 3CMEP 4GT1A 2PEIA 4H0LC 3FX0A 1L0LJ 3FXEA 3H1JG 5CZDB 1CSBA 4R0MA 2PEQA 1HJ0A 4BPGA 1FZCC 3UIAA 1Q2NA 2FYNB 3L4FA 3H1IJ 1HJBA 3SWKA 4PD4E 4D6TJ 3AEBC 2RN0A 1NTMD 2AVAA 1VQMP 5APQA 1NTKG 1VQKP 1UJZA 3L71D 3CCLP 3B8EB 5APVA 3B5NA 1OWAA 1DH3A 5KAFE 3BASA 3GZMA 2MR8A 1ZR4A 2AEJA 4GIFA 3L70G 3LMOA 1RE4A 3JCUH 2ZYGA 3MGNA 2X2BA 1NWQA 1Z6MA 1WT6A 2YMKA 2L5GB 3HD7C 5GTIE 1SQQD 1S5LH 2E75B 2Y0EA 3L71J 1PGPA 1JCDA 1AUMA 5KKZC 1SVFA 4U3FJ 2KG9A 1LTTC 1G1JA 5HVCA 1IJDB 3V6IA 4H44B 3G1GA 1FE6A 3VMAA 1RF1C 2HYNA 1L4AD 3IR9A 3DS1A 4MN4C 1LNQA 2H88C 1QL2A 2E74D 1L0LD 1LTJA 3HE5B 2DW3A 4HKGA 1MV8A 1WMKA 1RE3A 2QIWA 2IYPA 1S9KE 3A5TA 5BS1A 5KLVE 5AW6B 1HH0A 4WY4C 2Z45A 1QEXA 2YXQB 2JB0A 1LTGC 2A45H 3W67A 2OYHA 3KPEA 2E75C 3CXCO 2RKLA 3N4XA 4GKGA 1PP9D 1IZNB 1FAVA 3G71P 3CX5H 3TF5A 2RMZA 2QA4P 1M74A 2FYZA 3D6ZA 3H25A 2B87A 3F5HA 4F37A 3DTJA 1S9KD 3AE8C 1JMBA 2M8NA 2MR7A 2WMMA 4XA4A 1BE3E 2H8PD 2XNDH 1YQ3C 3B4SA 5CMZA 1OXZA 2Q3IA 2KK7A 2PEJA 1EMVA 1BGYG 2N6ZA 4HH2A 5APSA 3NXSA 4Z1MH 1BSHA 4XRQA 3Q2YA 1QL1A 2FYUK 3HE4B 2PEKA 2KR5A 1LT9A 3CI9A 3TYYA 3VN0A 5KLVG 4YPCA 3V2PA 3TGUE 3M91A 1IMPA 3GLMA 1SQXD 4TT3H 4TLFA 1KTMA 2WSFH 4GODA 1K04A 2WSEJ 3TNUB 1X0TA 1HBWA 2YXRB 3NY7B 1JB0J 3LW5H 1FZAA 2OYIB 2AFEA 2K0YA 4BWNA 1AF8A 1PFIA 4U0FA 3AE5C 3FXDA 1CEIA 4B86A 4UHPB 4WY4D 3I56P 2LIWA 4KJMA 3D6YA 1PIXA 1BGYE 1CI6A 3WU2E 4AQRD 2P9XA 3IFMA 5B5EH 3TNUA 1IFPA 5I4TG 3IAOA 2D2CB 3I55P 1PGOA 4UB6E 4DT0A 2KI7B 1VDFA 1GD2E 5M1BA 4COCA 3A0HE 1DEEG 2JWDA 2WSCJ 5CBOA 1GL2B 2MY5A 2N6YA 1N7SA 3C9IA 2GDWA 1JTHB 3Q3DA 2NPSC 1FR2A 2XZ1C 1ZRTD 2M0BA 1Z56A 2YMYA 3M0AA 1AYIA 1GW4A 1KMIZ 1USDA 1H0TA 2IFMA 5CCHA 1N73C 1HVVA 4PH0A 2CK3H 2KW2A 2N9BA 3TGUD 1SQPD 4BPHA 1YJ9P 2BEQD 3A7OA 2KIKA 3L73G 2BASA 4XROA 2A45G 1MZ8A 2ROQA 3GMAA 2BEZF 1BXIA 1PGQA 1JUNA 4ZKPA 1KB9E 4DG9A 3RL0D 2FYUE 2B89A 2WITA 1KQLA 1L0HA 3OAKA 3EQ2A 4D6TG 1LWUC 3CL3D 3VTPC 2LPKA 1BCCE 5AW4B 4COPA 2IFNA 2LKMA 2AXTH 4XE5B 4BRYB 1CW5A 3H1KJ 1AFOA 1SQBK 2JWAA 2FKWB 1KLPA 2LL8A 2VLQA 3L74E 1AQ5A 2IDBA 1E5WA 2GZFA 2O01N 1RH5B 1NGMB 1NKNA 4DCKA 2K2QA 5AVVB 1FZFA 1GTWA 2OYIC 2HODB 4Y28J 3CLQA 4BPFA 1PP9G 1BCCJ 1ZMBA 4N78D 4PH1A 1NTKK 2JAZA 2W6JH 3CCUP 1XTGB 3M0DC 3HUSC 3OJAB 2B87B 3T97A 1GK4A 2M5AB 1VQNP 2YKQA 1GDTA 1IFNA 2EHSA 1VPCA 2JP3A 1PP9E 1KQSO 2M8LA 2R44A 2D2CC 2W83C 1VL2A 1EZVE 2Y0DA 3B71A 1SLQA 4C7NA 2FQ0A 2GZEA 1VQ4P 1GL2C 2GUSA 1NTZG 5B5EE 4EOTA 5JPAA 3RL0g 1NTMJ 1Q7YQ 3AEFC 3CXHE 1YITP 1M1JC 1DV5A 3G0VA 3SWYA 1L0NK 1A8OA 2L6EA 3D70A 3AE2C 1WRGA 1EDJA 3B5NC 1R5SA 1U7JA 2WVRA 2NRGA 4AUWA 1GZLA 3L37A 1RHZB 1NKZB 4I1LA 5AVSB 4H0LB 1HWTC 2Y9ZA 3BATA 1K8AQ 2WWWA 1VQ8P 4IL6H 2JYLA 1GU5A 3LIEA 3RL0B 3HD7A 1BDDA 3M9BA 1VQPP 2J5UA 1SQBD 1GXGA 1URQA 2QM7A 5AW0B 1ZW0A 2WSEH 2ZT9B 2OQQA 4U0DA 1HTLC 1PPJE 2ONTA 3O6QA 2KNCB 2OARA 2JJLA 3L71E 1IFIA 1ZXGA 5HGNA 3MD0A 3DPHA 2H89C 4GDOA 1H8AA 1RF1A 3CWBG 5HGLA 3GHGC 4CA3A 1LTBC 1NTZK 2JEEA 4K35A 3WUTA 1RF0C 4EI2A 3G29A 1Q86Q 4H13B 3KZIE 1EDIA 1L0NG 5F2OA 1A02J 3RK3D 3A0BE 1N7SD 3A2AA 1N8RQ 1MZ9A 1JO5A 3H1KG 1M8OB 2R3CA 4L74A 1K73Q 2I8DA 5KP7B 1NYHA 1SQQJ 1KYOH 1X9VA 3GW6A 2E74C 3L35A 3JCUE 3L72J 5APXA 1KYOD 2FFDC 5DJUB 1UNKA 4BXLA 1S4XA 3C1LA 3BCCD 4NPFX 3CWBD 2K92A 1UIXA 1SQVE 4JQ0D 2ZXEB 3CX5I 1BGYD 1NH4A 4I7ZB 1SQVD 1CI6B 3HRNA 2HFED 2ZFCA 2SPZA 3HD7D 2DGYA 2ZVNB 3VMXA 3VOPA 2GDYA 2M8PA 1BSNA 3WUVA 1LGHB 2VLOA 1YIJP 4HJGH 2C0XA 1PL5A 3CWBJ 2N5IA 3DS0A 5BVZA 2XU6A 1DNYA 3ZDMA 1L2PA 1NHLA 2KNCA 1YJNP 2E5YA 3L72D 3WU2H 2HPCA 5KLVD 5DJTB 1JTHA 3S9OA 1VF5C 5KTBA 2LKIA 2E76D 1M57D 3L70J 3U1CA 4U0BA 3BCCG 2ZYAA 1KORA 2KWLA 2E42A 1IFMA 2FADA 2MF4A 1VQOP 2VSQA 5CHXA 1E6JP 2WT7A 2Q9IA 3EFGA 4H0LD 1NTMK 1L0NE 2W27A 2ZT9D 2KGDA 2KS1B 1LT9C 2ZJSE 3KHUA 1KQGB 4XFZA 1S1CX 2AEFA 5KAFH 3H1JJ 2N98A 2XDJA 2L9FA 4OWFA 3V2NA 1KZUB 4UB8H 3L74D 2NZ2A 3ITKA 1BE3J 2FY8A 5DCKA 1P84I 2K37A 4QMAA 1N73B 3NTEA 3P05A 1E0HA 1NJIQ 3RK3B 2LR2A 2E43A 1AQTA 1OW6A 2MVUA 2KUBA 1G2CA 1NAYA 2PEMA 3JC22 1GXHA 1K9MQ 1KD1Q 5TISE 3G1IA 3I5CA 5AW3B 1VKUA 1FZGA 2YKPA 3V2QA 1GW3A 1M56D 2RH0A 3CC2P 3G3ZA 5KJ7C 5KLIB 2JU1A 4IL6E 1SQBE 1H88A 4BRYA 1FC2C 1L4AC 2AEMA 1N73A 1JCCA 2QEXP 1AVYA 5BS2A 1LWUA 1PPJD 2FFDB 1DX7A 4U3FD 2FQ2A 1OR5A 3USSA 1DEBA 2P2UA 2YKOA 3V4QA 2M3BA 2YO3A 4PD4D 3KZIH 4C7NB 4XFYA 3Q1MA 4KHXA 1OIPA 4UB6H 1J1DC 2LXCB 2N5HA 1EZVG 5AW1B 1MFTA 1IO4A 2QJPB 1JY2N 5AW8B 2BUOA 2YIUC 3L70D 1SQVK 1RF1B 5AVWB 5BU8B 4IFMA 4C46A 4PD4I 1BGYJ 3H1HG 3FGAD 1LTAC 2KOSA 2JQ4A 3C8VA 1SQBG 2DNWA 7CEIA 2XKMA 3S4RA 1N2DC 2Z5HA 5CCGC 1L0ND 1FJKA 2HR3A 1ZMEC 2P58A 1L0LK 3EWKA 3VP9A 2FVFA 1QRJA 3R2PA 3LRYA 2PP6A 2CPSA 4U3FG 3L74J 4RO0A 1YTZI 2NO8A 4DOJA 2FYUD 1KB9D 1URQB 5AVTB 2WPTA 4WBAA 1L0LG 4OGQD 3BCCJ 4ZNCA 1H89A 1FDOA 1NTZE 4W7ZA 1KN7A 4H44D 2GDXA 2XZRA 3HUSB 4NPEA 3VMYA 2O3JA 3NMDA 1AJYA 2GUVA 1NU1J 1T8KA 1YHQP 5AVYB 4IZ6A 1YBKA 3L75E 2YNYA 4C7RA 2AXCA 3CCEP 3CC7P 4QKOA 2CQ8A 1TU3F 3D71A 1M1KQ 1NAFA 1IC2A 2H7HA 2FYUG 3H1HE 3H1LJ 2FXOA 2FQ1A 1EQ7A 4W80A 2KORA 2WPQA 1ACPA 2BCCD 1LTIC 1PPJG 2NPSD 3H1LD 2QNWA 1KILB 3GG2A 4GOEA 3HTKA 1GL2A 2XZ0D 5L8RJ 3L75J 4PV1B 2FYUJ 1U7MA 3VMZA 1IUQA 2A06E 1JJ2O 1P84D 3F89A 4YXDC 1EDLA 3PHLA 4U3FE 5AVZB 3RK3E 2QJKC 1URQD 1KB9I 3L73J 2P67A 3GHGA 1CZQA 5CCGD 1SS1A 1LTJC 1KB9H 5CJ0A 3GKLC 5K5GB 4M0IA 1FDIA 1R5LA 1OZHA 2A45I 4CPGA 5B66H 5CBNA 3GJNA 3EJDA 2FXPA 3OA7A 2CG5B 1EC5A 3FWLA 1ZR2A 2ZT9C 3U59A 3E1RA 2A06D 2Y9YA 2W8ZA 2IBZD 2IX7C 5H2FH 3BVHA 1SFCC 3SSUA 3GHGB 3TGUG 3U1AA 2KG6A 1ZN5A 3MTUE 3RBZA 2P1JA 3CXHD 4L73A 3NFQA 2HODA 5KP8B 1KFMA 3L75G 3B5NB 2KYVA 1RO2A 4H13D 1BAJA 2R5DA 2VLPA 3AE3C 1VHNA 3L73E 5APUA 1FZCA 1M7LA 2JBGA 4ASVA 4IOIH 2ITAA 2LF4A 1T6AA 4GR6A 5KJ7D 2WPRA 2PY8A 2IBZE 2QG4A 2B88A 2PEOA 2FVEA 2A06G 2OTLP 1USEA 2WQYC 2XNXA 3P8CD 2QSIA 2H43A 5AVXB 2QRXA 3FWNA 4JPZB 3B4QA 2QJYB 2K9YA 4HKZH 1YYCA 1X8YA 4LLHA 1EXIA 4HB1A 1EXJA 2KZJA 3QWOC 3WBHA 2E75D 1HGVA 3N7NA 3CCRP 3AE1C 2OYHB 2LMLA 3CWBE 1VQLP 2BHVA 4K3AA 4IFFA 4H13C 4N78E 1GMJA 1A43A 5BU5A 2KG8A 3CX5E 3A0BH 2P7JA 1SP4A 2Z4EA 1YJWP 3RK2B 3AEDC 2JKVA 3L70E 2K1AA 3H1JD 5E79E 1FDMA 1QLED 1FBMA 1J1EB 1PZQA 1HQBA 3CCQP 5HGMA 3M0DA 1NTKE 1X79B 3GF3A 2MJZA 5EJDA 3CCSP 3AE4C 4U7JA 3H4EA 1HUCA 1BCCD 3CXHH 1SQVG 2J58A 1FOSF 2KOPA 2OYIA 2GZJA 4AYCA 4EYYQ 1AA0A 2M3EA 2Q7CA 3H32A 2IBZG 3EFFK 2NPSA 1J1EC 2EFJA 1SQPE 2FVAA 2CNRA 1GL2D 1OVUA 5F2NA 5HGOA 1SQPG 3L71G 2G8YA 1SQVJ 2K0DX 2HG5D 3B5IA 4U0AA 1LP1B 3MHVA 2WPVB 1VQ6P 5AW5B 3PLNA 3CCJP 4I2LC 2V7QJ 4MRTC 2ZXXA 5E79H 2OGUA 3H1KE 2KOGA 1F80D 1ZOYC 3M06A 3Q5RA 3W68A 3HZQA 3BRTB 2N50A 2WTYA 1RY3A 5B66E 3MZWB 1ZRTE 2XT1A 3P7KA 4NPDA 2WPSA 3MIWA 2PAJA 1N7SC 1Y8AA 4Y99B 3H1KD 2K88A 2BCCE 4N3YB 3PTZA 4PXHB 5KP6B 2KXPB 4XFXA 3MGEA 2OYHC 3T97B 1EIAA 2K0XA 1LT1A 1KC8Q 1MUUA 1LTSC 4ASWA 1IMQA 2N9YB 2HLOA 3H32B 4EIJA 5KLIC 2LIUA 1PGJA 3CMAP 2E76B 3A0HH 5GTHH 4U0EA 1RF0A 1OW7A 4RESB 2G3AA 4H2XC 3JSVC 1NU1K 1UIIA 3AECC 4GR2A 4R4MA 1VQ7P 5AVQB 1N86A 4N6JA 4D6TE 3SFDC 1N7SB 1NTME 3RG2A 1P84E 2JGPA 2QJYC 1KFNA 3P32A 2O1JA 1D7MA 1OVRA 2O01J 3TDKA 3G6EP 4H2WC 1GU4A 2E76C 3RG6C 1DIPA 4ZKUA 1BE3G 1VF5B 2O01H 3IN6A 2OYOA 1T8ZA 1W2EA 1SQQG 2B9BA 1JY3N 1NTZJ 2C9LY 2WSFJ 5CCHC 2KB7P 2AXTE 2WSSH 3KQGA 1NTZD 4JYBA 4OGQB 3CPWO 1OX3A 1JNMA 3ABVC 2Q3EA 1K30A 3HYBA 2ZAEB 1T3JA 3VYIA 2ZVOB 2R5BA 1FJPA 4IFDK 1FZCB 2POHA 2KP8A 3PJSK 2FHSC 3E1IA 4KT0J 1PV3A 5EFWB 3IF4A 5AW9B 1MFZA 2R32A 2QE7H 4JF7A 1SFCD 1ZV8A 1JY2O 1M6NA 2K93A 1NOHA 3DS4A 3AEEC 3HE5A 1LTJB 1KILC 2QVAA 1W5CE 1Y47A 2V7QH 1J2JB 1G1IA 3II6A 1JY3O 4YTPC 2KOOA 2HPCB 2W6BA 3HD7B 4U0CA 1M6EX 2FXMA 4Y99C 3G26A 1OW8A 3AEAC 2ERHA 2QM8A 3H1IG 3AE6C 2VLNA 1OMIA 1SFCB 4LC1A 1N7LA 3R4YA 1HY8A 4H44C 2GZIA 4IL6X 1A02F 4YXWH 2KLVA 4WY4B 5GTHE 2KODA 3G4SP 3DS5A 4PWVB 1HF9A 5EW5E 1BCCG 3H1ID 3V2RA 1SQQE 1KV4A 3CD6P 1SFCA 3KYQA 5KAIH 2JYGA 2GYKA 1X22A 3O6QB 1SQXK 2FBWC 1IK9A 2Q6QA 3BCCE 1AV1A 1EDKA 1OVVA 1ZLLA 4NEOA 2MD9A 2O1KA 1JMMA 1T3UA 3L74G 2UWJE 2KZIA 2QJPC 2W6AA 1VQ9P 2L4BA 1FU1A 3CCVP 4OGQC 1DD4A 1IFJA 5KKZB 3DS3A 3GZLA 4PJ0H 1YQ4C 1RO0A 3PH0A 1S3JA 4WB4A 1K05A 5APYA 2FYNC 3WUUA 2E1MA 2BCCJ 2J59M 1NQ4A 1NO4A 2QJKB 1YTZT 2I1KA 4H2YC 1PP9J 1KYOI 2W90A 3RK2C 1Q82Q 2Q5UA 4EDFA 3H6PA 1W2BO 2EIAA 1LWUB 5KLVJ 2V4HA 4L76A 2EG5A 2MVVA 2LTEA 2XXMA 3H1HJ 3H1LE 4WVZA 1RE3C 1X3OA 3M9HA
chains in the Genus database with same CATH topology
2H43A 1LTGC 5AVXB 2A45H 2ZXEB 2OYHA 1KILD 1NH4A 3KPEA 3CXCO 3N4XA 4GKGA 1CI6B 1YYCA 2YO2A 1X8YA 3HRNA 4LLHA 1FAVA 3G71P 2HFED 2ZFCA 1T2KC 2C0WA 2QA4P 2DGYA 3HD7D 1SQPK 1M74A 3VMXA 2FYZA 3VOPA 2M8PA 3WBHA 1HGVA 1LGHB 3N7NA 2C9NY 1YIJP 2JO0A 3CCRP 3DTJA 1S9KD 2C0XA 3P8MC 2OYHB 3DS0A 1VQLP 2BHVA 2M8NA 4IFFA 5BVZA 3PP5A 4N78E 2XU6A 5APTA 2Z46A 1A43A 1NHLA 4XA4A 1YJNP 5BU5A 2N1TB 2H8PD 2HPCA 1J1DB 1JTHA 1QVGO 1M1JB 2P7JA 1SP4A 1SQQK 5CMZA 2OTJP 2Z4EA 4WYMA 1OXZA 1YJWP 3RK2B 3TK1A 3P8CE 2XV5A 5KTBA 5AW7B 2Q3IA 3U1CA 2PEJA 4U0BA 1FDMA 1FBMA 1J1EB 4HH2A 5APSA 3NXSA 3H0DA 3CCQP 2FFDA 4XRQA 2E42A 1IFMA 1QL1A 1VQOP 2FYUK 3HE4B 5CHXA 5HGMA 1E6JP 3M0DA 2WT7A 1X79B 3MUDA 3EFGA 2Q9IA 2PEKA 1LT9A 1NTMK 2MJZA 2W27A 3CCSP 3CI9A 3TYYA 3VN0A 3H4EA 5AVUB 1HUCA 3V2PA 1LT9C 3RL0C 4QNBA 2J58A 1FOSF 3M91A 2OYIA 1Q81Q 4XFZA 1RNIA 4AYCA 2WSFH 2Q7CA 2XDJA 3H32A 3TNUB 3V2NA 1KZUB 1J1EC 2NPSA 1HBWA 3OW2O 2EFJA 2KSJA 1GL2D 5F2NA 5HGOA 1XTCC 5DCKA 3LW5H 3WMM0 1FZAA 3BRVB 3NTEA 1N73B 2OYIB 3P05A 2N1TD 1NJIQ 2HG5D 3RK3B 3V4WA 4O9BA 3B5IA 4U0AA 2E43A 1PFIA 4U0FA 1G2CA 2PEMA 1D1DA 1VQ6P 1K9MQ 1KD1Q 5AW5B 3G1IA 3I5CA 4B86A 5KLVK 3CCJP 1HGZA 4I2LC 4WY4D 5AW3B 1FOSE 3I56P 1FZGA 1T2KD 1FZEA 1CI6A 2YKPA 1FZBA 1GW3A 3HTKB 3V2QA 2GM4A 3CC4P 4AQRD 2P9XA 2KOGA 3CC2P 3G3ZA 3M06A 5AW2B 5KJ7C 3IFMA 3HZQA 3BRTB 2WTYA 3TNUA 5I4TG 1RY3A 2XT1A 3I55P 3KDPB 1H88A 3P7KA 5KJ7A 2WPSA 3MIWA 2PAJA 1L4AC 1N7SC 4Y99B 1VDFA 1QVFO 3LIDA 1N73A 1JCCA 1GD2E 2QEXP 4COCA 5BS2A 1LWUA 2FFDB 4N3YB 1DX7A 3G28A 4IPYA 1GL2B 1DEBA 1L4AA 1N7SA 2P2UA 2YKOA 4XFXA 3V4QA 4LGDE 3MGEA 3C9IA 2WT7B 2M3BA 2M8RA 1JTHB 2YO3A 3SWFA 2NPSC 2OYHC 5APWA 1Z56A 1EIAA 2YMYA 3M0AA 4C7NB 4XFYA 3G21A 1GW4A 1KC8Q 4KHXA 1MUUA 3M1MA 2IFMA 1LTSC 5CCHA 3O8ZA 1J1DC 2WZ7A 1N73C 1HVVA 1URQC 4PH0A 5AW1B 1IO4A 2HLOA 2N9BA 3H32B 1JY2N 5AW8B 2XV6A 4EIJA 2BUOA 1YJ9P 1RE4C 3CMAP 3A7OA 1SQVK 1RF1B 2BASA 4XROA 2A45G 5AVWB 5BU8B 4U0EA 3CCMP 4IFMA 1RF0A 4C46A 4RESB 1JUNA 3Q20A 1NU1K 4ZKPA 4GR2A 1LTAC 3M9QA 5CJ4A 1VQ7P 5AVQB 3RL0D 1N86A 4N6JA 4OH8B 3RK2D 2WITA 1KQLA 1L4AB 1N7SB 3OAKA 3VRLC 2N1TA 1EOQA 3EQ2A 5CCHD 1LWUC 1G2CB 2XKMA 3CL3D 3VTPC 3E2DA 1KFNA 1N2DC 1LT9B 4COPA 2IPPA 5AW4B 1M1JA 2Z5HA 3P32A 5CCGC 1FJKA 2IFNA 2LKMA 2NPSB 2O1JA 4XE5B 1VQ5P 3H47A 2I1JA 1CW5A 1JY3P 1L0LK 2VRSA 1AFOA 1SQBK 3G6EP 3VP9A 3TSIA 2FKWB 1GU4A 1QRJA 5CCGA 3RG6C 4ZKUA 3R2PA 3LRYA 2O01H 2PP6A 2CPSA 1T8ZA 1W2EA 2Z5IA 1YTZI 1JOCA 4DOJA 2PENA 1IFDA 1AQ5A 1URQB 1GK6A 1E5WA 1JY3N 5AVTB 3NTNA 1JY2P 1YI2P 1NKNA 4WBAA 5AVVB 2C9LY 3DS2A 1FZFA 1GTWA 2OYIC 2HODB 5CCHC 1H89A 2KB7P 3CLQA 4W7ZA 3KQGA 4JYBA 3B5ND 3CPWO 1JNMA 2XZRA 3HUSB 3VMYA 1ZMBA 4WY4A 1K30A 3HYBA 3V5BA 1T3JA 3VYIA 1FJPA 2R5BA 4N78D 3A3YB 4PH1A 4IFDK 1NTKK 2WSCH 3HE4A 3NMDA 2POHA 1FZCB 3L36A 2GUVA 2KP8A 3CCUP 1YHQP 1XTGB 3M0DC 3HUSC 4JYCA 3OJAB 5AVYB 3T97A 1GK4A 3E1IA 2CPBA 1VQNP 2YNYA 2YKQA 5AVRB 4C7RA 1GDTA 5AW9B 1IFNA 3CCEP 1MFZA 2R32A 3CC7P 1M90Q 1VPCA 4JF7A 1KILA 1M1KQ 3RK3C 4M3LA 1KQSO 1SFCD 1ZV8A 2M8LA 1JY2O 1M6NA 2CWOA 3HUSA 1NAFA 4DZOA 1IC2A 2H7HA 1NOHA 4HYTB 3DS4A 1LTJB 5F2KA 1EQ7A 3HE5A 4W80A 2WPQA 4I6MC 1KILC 1LTIC 2N1TC 2NPSD 3VP8A 1SLQA 2Z44A 4C7NA 1J2JB 1G1IA 3II6A 4W7YA 1JY3O 1KILB 1S72P 1GL2C 1VQ4P 2GUSA 2HPCB 2W6BA 3HTKA 1GL2A 3HD7B 4EOTA 5JPAA 4U0CA 1M6EX 1Q7YQ 2FXMA 1YITP 4Y99C 3G26A 1M1JC 3VMZA 3G0VA 3CMEP 2QM8A 1IUQA 3SWYA 1L0NK 4GT1A 2PEIA 1JJ2O 1SFCB 4LC1A 1A8OA 2L6EA 1N7LA 5AVZB 1WRGA 3B5NC 1A02F 4AUWA 1CSBA 1GZLA 2KLVA 1URQD 3L37A 4WY4B 1NKZB 4I1LA 5AVSB 2P67A 3GHGA 2PEQA 1HWTC 2KODA 3G4SP 1FZCC 1CZQA 3UIAA 5CCGD 1HJBA 3L4FA 3DS5A 3BATA 1K8AQ 1LTJC 5CJ0A 2WWWA 3V2RA 4M0IA 1VQ8P 1VQMP 3CD6P 2JYLA 1SFCA 2A45I 5APQA 1VQKP 1GU5A 3KYQA 3LIEA 3RL0B 2JYGA 1SQXK 3HD7A 3CCLP 3B8EB 5APVA 3B5NA 1IK9A 3M9BA 3OA7A 1OWAA 1DH3A 1VQPP 3BASA 1ZR2A 1ZR4A 1ZLLA 3U59A 2O1KA 4GIFA 1JMMA 1T3UA 1RE4A 1URQA 2QM7A 5AW0B 2W6AA 2WSEH 1VQ9P 3MGNA 2IX7C 3BVHA 1FU1A 1NWQA 4U0DA 1HTLC 2ONTA 3CCVP 1SFCC 1WT6A 2OARA 1IFJA 2JJLA 2L5GB 3GHGB 3DS3A 1IFIA 3HD7C 3U1AA 1RO0A 1ZN5A 3MTUE 5HGNA 3MD0A 3DPHA 1H8AA 1RF1A 4WB4A 1JCDA 1AUMA 5HGLA 3GHGC 1LTBC 1NTZK 2JEEA 5APYA 2P1JA 2E1MA 1RF0C 1SVFA 3NFQA 3G29A 2HODA 1Q86Q 2J59M 1LTTC 1G1JA 1IJDB 1KFMA 1NO4A 3B5NB 3G1GA 1RF1C 2HYNA 1A02J 5F2OA 2KYVA 3RK3D 1RO2A 1L4AD 1N7SD 1BAJA 2R5DA 3IR9A 3DS1A 3A2AA 1N8RQ 1MZ9A 1YTZT 5APUA 1JO5A 1FZCA 1M7LA 1QL2A 2I1KA 2R3CA 1LTJA 3HE5B 2LF4A 1K73Q 1MV8A 1Q82Q 1RE3A 3RK2C 2Q5UA 4GR6A 1S9KE 5KJ7D 3A5TA 3H6PA 1W2BO 1X9VA 2WPRA 2EIAA 2PY8A 1LWUB 3L35A 5BS1A 5AW6B 2EG5A 2PEOA 1HH0A 5APXA 2XXMA 2FFDC 2OTLP 1RE3C 4WY4C 2Z45A 2XNXA 3P8CD 3M9HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LW5 H;  3G3Z A;  1SQV K;  3HZQ A;  2LKM A;  1NTZ K;  3CLQ A;  1L0L K;  2WSF H;  1NU1 K;  1SQB K;  3M9Q A;  2WSE H;  2J59 M;  2FYU K;  5KLV K;  2O01 H;  4IFD K;  1NTK K;  2WSC H;  1SQP K;  1NTM K;  1SQQ K;  1L0N K;  2OAR A;  1SQX K; 
#chains in the Genus database with same CATH topology
 2AF8 A;  3KXD A;  3LW5 J;  1SQX G;  1KIL E;  3AE7 C;  4XFJ A;  1KIL D;  2YO2 A;  2KLU A;  1T2K C;  4WWI A;  2C0W A;  5C39 A;  1U57 A;  1SQP K;  4JBZ A;  2C9N Y;  2JO0 A;  1R8E A;  3L75 D;  3P8M C;  1SQX J;  2KS1 A;  3PP5 A;  4PV1 D;  3AEG C;  5APT A;  2K5X A;  2Z46 A;  4GOF A;  3MP7 B;  4UB8 E;  2N1T B;  1S2E A;  1KQF B;  4D6T D;  1NTK J;  1J1D B;  1FS0 E;  1MKM A;  3RBX A;  2E5T A;  1QVG O;  4ZMD A;  1M1J B;  1SQQ K;  2OTJ P;  1JEK A;  4WYM A;  2MKV A;  3TK1 A;  3P8C E;  2XV5 A;  5AW7 B;  2PRR A;  2K94 A;  3H0D A;  4R4L A;  2LXB A;  3G9R A;  2FFD A;  1LJ2 A;  1QGK B;  3MUD A;  2AFD A;  1SQB J;  2K9J B;  2M5A A;  5H2F E;  4A7P A;  5AVU B;  3RL0 C;  2JR8 A;  4QNB A;  2EHT A;  1Q81 Q;  1RNI A;  3U43 A;  1S5L E;  3GF7 A;  2PFX A;  1SQP J;  2JO1 A;  2R3S A;  1BE3 D;  3OW2 O;  2KSJ A;  2OTK E;  1XTC C;  4PD4 H;  3WMM 0;  3BRV B;  1GPJ A;  4PJ0 E;  2N1T D;  4L75 A;  3V4W A;  4O9B A;  1IK7 A;  1NU1 D;  2M5R A;  1P84 H;  3S1K A;  2K9J A;  2Q1K A;  1D1D A;  3L72 G;  2KGC A;  5KLV K;  1KYO E;  1HGZ A;  1FOS E;  1NVO A;  1OFC X;  3RGU A;  3H1L G;  2YIU B;  1T2K D;  1FZE A;  3HTK B;  2GM4 A;  1FZB A;  2JU2 A;  3CC4 P;  2KGA A;  3EJE A;  5AW2 B;  2L0Q A;  2L22 A;  2JDI H;  2Y0C A;  3KDP B;  1L0N J;  5KJ7 A;  1JM0 A;  5TIS H;  4PV1 C;  4OVN F;  1QVF O;  3LID A;  2GZG A;  3G28 A;  1SQX E;  4IPY A;  1L4A A;  2WT7 B;  4LGD E;  2M8R A;  3L73 D;  3SWF A;  3CXH I;  5APW A;  2PGD A;  2GA1 A;  1NU1 E;  3G21 A;  1RQV A;  2CGQ A;  1NTK D;  1NU1 G;  3M1M A;  3O8Z A;  2WZ7 A;  1URQ C;  4RKU J;  2FAE A;  2XV6 A;  2ZYD A;  1EZV I;  3H1J E;  1LP1 A;  1RE4 C;  1E79 H;  3SFE C;  2IYO A;  3CCM P;  3Q20 A;  1ZNV A;  3M9Q A;  5CJ4 A;  2KOQ A;  3K5B A;  1BDC A;  4OH8 B;  3RK2 D;  3H1I E;  1L4A B;  3VRL C;  2N1T A;  1EOQ A;  1L0I A;  5CCH D;  1G2C B;  2IZ0 A;  3AE9 C;  3E2D A;  3Q5S A;  1LT9 B;  2IPP A;  1M1J A;  5TJH A;  2NPS B;  2D2C D;  1VQ5 P;  3H47 A;  2I1J A;  3H1H D;  1JY3 P;  2FAC A;  2VRS A;  3TSI A;  3L72 E;  5CCG A;  1Q90 D;  1QX8 A;  2E74 B;  2Z5I A;  1JOC A;  1S5L X;  2PEN A;  1EZV D;  1IFD A;  1GK6 A;  1DD3 A;  3NTN A;  3MUD C;  1JY2 P;  1YI2 P;  1ZP0 C;  3TGU J;  3DS2 A;  2L91 A;  1L0L E;  3B5N D;  4I7Z C;  2KGE A;  4WY4 A;  3V5B A;  2KSE A;  2LOL A;  3QH9 A;  2PNG A;  3A3Y B;  2WSC H;  3HE4 A;  3L36 A;  2BCC G;  2IZ1 A;  4RJT A;  4JYC A;  3Q5P A;  2CPB A;  3EJB A;  5AVR B;  1RQU A;  1M90 Q;  1KIL A;  2IBZ I;  3RK3 C;  4DJG A;  5HV8 A;  4M3L A;  2CWO A;  3HUS A;  4DZO A;  2P10 A;  4HYT B;  3PRJ A;  1AVO A;  5F2K A;  1NTM G;  4I6M C;  3CX5 D;  2N1T C;  3VP8 A;  2Z44 A;  4W7Y A;  1S72 P;  1H0T B;  5GTI H;  3E7K A;  1VF5 D;  5KAI E;  1Y9B A;  3CE7 A;  2K3R A;  3CME P;  4GT1 A;  2PEI A;  4H0L C;  3FX0 A;  1L0L J;  3FXE A;  3H1J G;  5CZD B;  1CSB A;  4R0M A;  2PEQ A;  1HJ0 A;  4BPG A;  1FZC C;  3UIA A;  1Q2N A;  2FYN B;  3L4F A;  3H1I J;  1HJB A;  3SWK A;  4PD4 E;  4D6T J;  3AEB C;  2RN0 A;  1NTM D;  2AVA A;  1VQM P;  5APQ A;  1NTK G;  1VQK P;  1UJZ A;  3L71 D;  3CCL P;  3B8E B;  5APV A;  3B5N A;  1OWA A;  1DH3 A;  5KAF E;  3BAS A;  3GZM A;  2MR8 A;  1ZR4 A;  2AEJ A;  4GIF A;  3L70 G;  3LMO A;  1RE4 A;  3JCU H;  2ZYG A;  3MGN A;  2X2B A;  1NWQ A;  1Z6M A;  1WT6 A;  2YMK A;  2L5G B;  3HD7 C;  5GTI E;  1SQQ D;  1S5L H;  2E75 B;  2Y0E A;  3L71 J;  1PGP A;  1JCD A;  1AUM A;  5KKZ C;  1SVF A;  4U3F J;  2KG9 A;  1LTT C;  1G1J A;  5HVC A;  1IJD B;  3V6I A;  4H44 B;  3G1G A;  1FE6 A;  3VMA A;  1RF1 C;  2HYN A;  1L4A D;  3IR9 A;  3DS1 A;  4MN4 C;  1LNQ A;  2H88 C;  1QL2 A;  2E74 D;  1L0L D;  1LTJ A;  3HE5 B;  2DW3 A;  4HKG A;  1MV8 A;  1WMK A;  1RE3 A;  2QIW A;  2IYP A;  1S9K E;  3A5T A;  5BS1 A;  5KLV E;  5AW6 B;  1HH0 A;  4WY4 C;  2Z45 A;  1QEX A;  2YXQ B;  2JB0 A;  1LTG C;  2A45 H;  3W67 A;  2OYH A;  3KPE A;  2E75 C;  3CXC O;  2RKL A;  3N4X A;  4GKG A;  1PP9 D;  1IZN B;  1FAV A;  3G71 P;  3CX5 H;  3TF5 A;  2RMZ A;  2QA4 P;  1M74 A;  2FYZ A;  3D6Z A;  3H25 A;  2B87 A;  3F5H A;  4F37 A;  3DTJ A;  1S9K D;  3AE8 C;  1JMB A;  2M8N A;  2MR7 A;  2WMM A;  4XA4 A;  1BE3 E;  2H8P D;  2XND H;  1YQ3 C;  3B4S A;  5CMZ A;  1OXZ A;  2Q3I A;  2KK7 A;  2PEJ A;  1EMV A;  1BGY G;  2N6Z A;  4HH2 A;  5APS A;  3NXS A;  4Z1M H;  1BSH A;  4XRQ A;  3Q2Y A;  1QL1 A;  2FYU K;  3HE4 B;  2PEK A;  2KR5 A;  1LT9 A;  3CI9 A;  3TYY A;  3VN0 A;  5KLV G;  4YPC A;  3V2P A;  3TGU E;  3M91 A;  1IMP A;  3GLM A;  1SQX D;  4TT3 H;  4TLF A;  1KTM A;  2WSF H;  4GOD A;  1K04 A;  2WSE J;  3TNU B;  1X0T A;  1HBW A;  2YXR B;  3NY7 B;  1JB0 J;  3LW5 H;  1FZA A;  2OYI B;  2AFE A;  2K0Y A;  4BWN A;  1AF8 A;  1PFI A;  4U0F A;  3AE5 C;  3FXD A;  1CEI A;  4B86 A;  4UHP B;  4WY4 D;  3I56 P;  2LIW A;  4KJM A;  3D6Y A;  1PIX A;  1BGY E;  1CI6 A;  3WU2 E;  4AQR D;  2P9X A;  3IFM A;  5B5E H;  3TNU A;  1IFP A;  5I4T G;  3IAO A;  2D2C B;  3I55 P;  1PGO A;  4UB6 E;  4DT0 A;  2KI7 B;  1VDF A;  1GD2 E;  5M1B A;  4COC A;  3A0H E;  1DEE G;  2JWD A;  2WSC J;  5CBO A;  1GL2 B;  2MY5 A;  2N6Y A;  1N7S A;  3C9I A;  2GDW A;  1JTH B;  3Q3D A;  2NPS C;  1FR2 A;  2XZ1 C;  1ZRT D;  2M0B A;  1Z56 A;  2YMY A;  3M0A A;  1AYI A;  1GW4 A;  1KMI Z;  1USD A;  1H0T A;  2IFM A;  5CCH A;  1N73 C;  1HVV A;  4PH0 A;  2CK3 H;  2KW2 A;  2N9B A;  3TGU D;  1SQP D;  4BPH A;  1YJ9 P;  2BEQ D;  3A7O A;  2KIK A;  3L73 G;  2BAS A;  4XRO A;  2A45 G;  1MZ8 A;  2ROQ A;  3GMA A;  2BEZ F;  1BXI A;  1PGQ A;  1JUN A;  4ZKP A;  1KB9 E;  4DG9 A;  3RL0 D;  2FYU E;  2B89 A;  2WIT A;  1KQL A;  1L0H A;  3OAK A;  3EQ2 A;  4D6T G;  1LWU C;  3CL3 D;  3VTP C;  2LPK A;  1BCC E;  5AW4 B;  4COP A;  2IFN A;  2LKM A;  2AXT H;  4XE5 B;  4BRY B;  1CW5 A;  3H1K J;  1AFO A;  1SQB K;  2JWA A;  2FKW B;  1KLP A;  2LL8 A;  2VLQ A;  3L74 E;  1AQ5 A;  2IDB A;  1E5W A;  2GZF A;  2O01 N;  1RH5 B;  1NGM B;  1NKN A;  4DCK A;  2K2Q A;  5AVV B;  1FZF A;  1GTW A;  2OYI C;  2HOD B;  4Y28 J;  3CLQ A;  4BPF A;  1PP9 G;  1BCC J;  1ZMB A;  4N78 D;  4PH1 A;  1NTK K;  2JAZ A;  2W6J H;  3CCU P;  1XTG B;  3M0D C;  3HUS C;  3OJA B;  2B87 B;  3T97 A;  1GK4 A;  2M5A B;  1VQN P;  2YKQ A;  1GDT A;  1IFN A;  2EHS A;  1VPC A;  2JP3 A;  1PP9 E;  1KQS O;  2M8L A;  2R44 A;  2D2C C;  2W83 C;  1VL2 A;  1EZV E;  2Y0D A;  3B71 A;  1SLQ A;  4C7N A;  2FQ0 A;  2GZE A;  1VQ4 P;  1GL2 C;  2GUS A;  1NTZ G;  5B5E E;  4EOT A;  5JPA A;  3RL0 g;  1NTM J;  1Q7Y Q;  3AEF C;  3CXH E;  1YIT P;  1M1J C;  1DV5 A;  3G0V A;  3SWY A;  1L0N K;  1A8O A;  2L6E A;  3D70 A;  3AE2 C;  1WRG A;  1EDJ A;  3B5N C;  1R5S A;  1U7J A;  2WVR A;  2NRG A;  4AUW A;  1GZL A;  3L37 A;  1RHZ B;  1NKZ B;  4I1L A;  5AVS B;  4H0L B;  1HWT C;  2Y9Z A;  3BAT A;  1K8A Q;  2WWW A;  1VQ8 P;  4IL6 H;  2JYL A;  1GU5 A;  3LIE A;  3RL0 B;  3HD7 A;  1BDD A;  3M9B A;  1VQP P;  2J5U A;  1SQB D;  1GXG A;  1URQ A;  2QM7 A;  5AW0 B;  1ZW0 A;  2WSE H;  2ZT9 B;  2OQQ A;  4U0D A;  1HTL C;  1PPJ E;  2ONT A;  3O6Q A;  2KNC B;  2OAR A;  2JJL A;  3L71 E;  1IFI A;  1ZXG A;  5HGN A;  3MD0 A;  3DPH A;  2H89 C;  4GDO A;  1H8A A;  1RF1 A;  3CWB G;  5HGL A;  3GHG C;  4CA3 A;  1LTB C;  1NTZ K;  2JEE A;  4K35 A;  3WUT A;  1RF0 C;  4EI2 A;  3G29 A;  1Q86 Q;  4H13 B;  3KZI E;  1EDI A;  1L0N G;  5F2O A;  1A02 J;  3RK3 D;  3A0B E;  1N7S D;  3A2A A;  1N8R Q;  1MZ9 A;  1JO5 A;  3H1K G;  1M8O B;  2R3C A;  4L74 A;  1K73 Q;  2I8D A;  5KP7 B;  1NYH A;  1SQQ J;  1KYO H;  1X9V A;  3GW6 A;  2E74 C;  3L35 A;  3JCU E;  3L72 J;  5APX A;  1KYO D;  2FFD C;  5DJU B;  1UNK A;  4BXL A;  1S4X A;  3C1L A;  3BCC D;  4NPF X;  3CWB D;  2K92 A;  1UIX A;  1SQV E;  4JQ0 D;  2ZXE B;  3CX5 I;  1BGY D;  1NH4 A;  4I7Z B;  1SQV D;  1CI6 B;  3HRN A;  2HFE D;  2ZFC A;  2SPZ A;  3HD7 D;  2DGY A;  2ZVN B;  3VMX A;  3VOP A;  2GDY A;  2M8P A;  1BSN A;  3WUV A;  1LGH B;  2VLO A;  1YIJ P;  4HJG H;  2C0X A;  1PL5 A;  3CWB J;  2N5I A;  3DS0 A;  5BVZ A;  2XU6 A;  1DNY A;  3ZDM A;  1L2P A;  1NHL A;  2KNC A;  1YJN P;  2E5Y A;  3L72 D;  3WU2 H;  2HPC A;  5KLV D;  5DJT B;  1JTH A;  3S9O A;  1VF5 C;  5KTB A;  2LKI A;  2E76 D;  1M57 D;  3L70 J;  3U1C A;  4U0B A;  3BCC G;  2ZYA A;  1KOR A;  2KWL A;  2E42 A;  1IFM A;  2FAD A;  2MF4 A;  1VQO P;  2VSQ A;  5CHX A;  1E6J P;  2WT7 A;  2Q9I A;  3EFG A;  4H0L D;  1NTM K;  1L0N E;  2W27 A;  2ZT9 D;  2KGD A;  2KS1 B;  1LT9 C;  2ZJS E;  3KHU A;  1KQG B;  4XFZ A;  1S1C X;  2AEF A;  5KAF H;  3H1J J;  2N98 A;  2XDJ A;  2L9F A;  4OWF A;  3V2N A;  1KZU B;  4UB8 H;  3L74 D;  2NZ2 A;  3ITK A;  1BE3 J;  2FY8 A;  5DCK A;  1P84 I;  2K37 A;  4QMA A;  1N73 B;  3NTE A;  3P05 A;  1E0H A;  1NJI Q;  3RK3 B;  2LR2 A;  2E43 A;  1AQT A;  1OW6 A;  2MVU A;  2KUB A;  1G2C A;  1NAY A;  2PEM A;  3JC2 2;  1GXH A;  1K9M Q;  1KD1 Q;  5TIS E;  3G1I A;  3I5C A;  5AW3 B;  1VKU A;  1FZG A;  2YKP A;  3V2Q A;  1GW3 A;  1M56 D;  2RH0 A;  3CC2 P;  3G3Z A;  5KJ7 C;  5KLI B;  2JU1 A;  4IL6 E;  1SQB E;  1H88 A;  4BRY A;  1FC2 C;  1L4A C;  2AEM A;  1N73 A;  1JCC A;  2QEX P;  1AVY A;  5BS2 A;  1LWU A;  1PPJ D;  2FFD B;  1DX7 A;  4U3F D;  2FQ2 A;  1OR5 A;  3USS A;  1DEB A;  2P2U A;  2YKO A;  3V4Q A;  2M3B A;  2YO3 A;  4PD4 D;  3KZI H;  4C7N B;  4XFY A;  3Q1M A;  4KHX A;  1OIP A;  4UB6 H;  1J1D C;  2LXC B;  2N5H A;  1EZV G;  5AW1 B;  1MFT A;  1IO4 A;  2QJP B;  1JY2 N;  5AW8 B;  2BUO A;  2YIU C;  3L70 D;  1SQV K;  1RF1 B;  5AVW B;  5BU8 B;  4IFM A;  4C46 A;  4PD4 I;  1BGY J;  3H1H G;  3FGA D;  1LTA C;  2KOS A;  2JQ4 A;  3C8V A;  1SQB G;  2DNW A;  7CEI A;  2XKM A;  3S4R A;  1N2D C;  2Z5H A;  5CCG C;  1L0N D;  1FJK A;  2HR3 A;  1ZME C;  2P58 A;  1L0L K;  3EWK A;  3VP9 A;  2FVF A;  1QRJ A;  3R2P A;  3LRY A;  2PP6 A;  2CPS A;  4U3F G;  3L74 J;  4RO0 A;  1YTZ I;  2NO8 A;  4DOJ A;  2FYU D;  1KB9 D;  1URQ B;  5AVT B;  2WPT A;  4WBA A;  1L0L G;  4OGQ D;  3BCC J;  4ZNC A;  1H89 A;  1FDO A;  1NTZ E;  4W7Z A;  1KN7 A;  4H44 D;  2GDX A;  2XZR A;  3HUS B;  4NPE A;  3VMY A;  2O3J A;  3NMD A;  1AJY A;  2GUV A;  1NU1 J;  1T8K A;  1YHQ P;  5AVY B;  4IZ6 A;  1YBK A;  3L75 E;  2YNY A;  4C7R A;  2AXC A;  3CCE P;  3CC7 P;  4QKO A;  2CQ8 A;  1TU3 F;  3D71 A;  1M1K Q;  1NAF A;  1IC2 A;  2H7H A;  2FYU G;  3H1H E;  3H1L J;  2FXO A;  2FQ1 A;  1EQ7 A;  4W80 A;  2KOR A;  2WPQ A;  1ACP A;  2BCC D;  1LTI C;  1PPJ G;  2NPS D;  3H1L D;  2QNW A;  1KIL B;  3GG2 A;  4GOE A;  3HTK A;  1GL2 A;  2XZ0 D;  5L8R J;  3L75 J;  4PV1 B;  2FYU J;  1U7M A;  3VMZ A;  1IUQ A;  2A06 E;  1JJ2 O;  1P84 D;  3F89 A;  4YXD C;  1EDL A;  3PHL A;  4U3F E;  5AVZ B;  3RK3 E;  2QJK C;  1URQ D;  1KB9 I;  3L73 J;  2P67 A;  3GHG A;  1CZQ A;  5CCG D;  1SS1 A;  1LTJ C;  1KB9 H;  5CJ0 A;  3GKL C;  5K5G B;  4M0I A;  1FDI A;  1R5L A;  1OZH A;  2A45 I;  4CPG A;  5B66 H;  5CBN A;  3GJN A;  3EJD A;  2FXP A;  3OA7 A;  2CG5 B;  1EC5 A;  3FWL A;  1ZR2 A;  2ZT9 C;  3U59 A;  3E1R A;  2A06 D;  2Y9Y A;  2W8Z A;  2IBZ D;  2IX7 C;  5H2F H;  3BVH A;  1SFC C;  3SSU A;  3GHG B;  3TGU G;  3U1A A;  2KG6 A;  1ZN5 A;  3MTU E;  3RBZ A;  2P1J A;  3CXH D;  4L73 A;  3NFQ A;  2HOD A;  5KP8 B;  1KFM A;  3L75 G;  3B5N B;  2KYV A;  1RO2 A;  4H13 D;  1BAJ A;  2R5D A;  2VLP A;  3AE3 C;  1VHN A;  3L73 E;  5APU A;  1FZC A;  1M7L A;  2JBG A;  4ASV A;  4IOI H;  2ITA A;  2LF4 A;  1T6A A;  4GR6 A;  5KJ7 D;  2WPR A;  2PY8 A;  2IBZ E;  2QG4 A;  2B88 A;  2PEO A;  2FVE A;  2A06 G;  2OTL P;  1USE A;  2WQY C;  2XNX A;  3P8C D;  2QSI A;  2H43 A;  5AVX B;  2QRX A;  3FWN A;  4JPZ B;  3B4Q A;  2QJY B;  2K9Y A;  4HKZ H;  1YYC A;  1X8Y A;  4LLH A;  1EXI A;  4HB1 A;  1EXJ A;  2KZJ A;  3QWO C;  3WBH A;  2E75 D;  1HGV A;  3N7N A;  3CCR P;  3AE1 C;  2OYH B;  2LML A;  3CWB E;  1VQL P;  2BHV A;  4K3A A;  4IFF A;  4H13 C;  4N78 E;  1GMJ A;  1A43 A;  5BU5 A;  2KG8 A;  3CX5 E;  3A0B H;  2P7J A;  1SP4 A;  2Z4E A;  1YJW P;  3RK2 B;  3AED C;  2JKV A;  3L70 E;  2K1A A;  3H1J D;  5E79 E;  1FDM A;  1QLE D;  1FBM A;  1J1E B;  1PZQ A;  1HQB A;  3CCQ P;  5HGM A;  3M0D A;  1NTK E;  1X79 B;  3GF3 A;  2MJZ A;  5EJD A;  3CCS P;  3AE4 C;  4U7J A;  3H4E A;  1HUC A;  1BCC D;  3CXH H;  1SQV G;  2J58 A;  1FOS F;  2KOP A;  2OYI A;  2GZJ A;  4AYC A;  4EYY Q;  1AA0 A;  2M3E A;  2Q7C A;  3H32 A;  2IBZ G;  3EFF K;  2NPS A;  1J1E C;  2EFJ A;  1SQP E;  2FVA A;  2CNR A;  1GL2 D;  1OVU A;  5F2N A;  5HGO A;  1SQP G;  3L71 G;  2G8Y A;  1SQV J;  2K0D X;  2HG5 D;  3B5I A;  4U0A A;  1LP1 B;  3MHV A;  2WPV B;  1VQ6 P;  5AW5 B;  3PLN A;  3CCJ P;  4I2L C;  2V7Q J;  4MRT C;  2ZXX A;  5E79 H;  2OGU A;  3H1K E;  2KOG A;  1F80 D;  1ZOY C;  3M06 A;  3Q5R A;  3W68 A;  3HZQ A;  3BRT B;  2N50 A;  2WTY A;  1RY3 A;  5B66 E;  3MZW B;  1ZRT E;  2XT1 A;  3P7K A;  4NPD A;  2WPS A;  3MIW A;  2PAJ A;  1N7S C;  1Y8A A;  4Y99 B;  3H1K D;  2K88 A;  2BCC E;  4N3Y B;  3PTZ A;  4PXH B;  5KP6 B;  2KXP B;  4XFX A;  3MGE A;  2OYH C;  3T97 B;  1EIA A;  2K0X A;  1LT1 A;  1KC8 Q;  1MUU A;  1LTS C;  4ASW A;  1IMQ A;  2N9Y B;  2HLO A;  3H32 B;  4EIJ A;  5KLI C;  2LIU A;  1PGJ A;  3CMA P;  2E76 B;  3A0H H;  5GTH H;  4U0E A;  1RF0 A;  1OW7 A;  4RES B;  2G3A A;  4H2X C;  3JSV C;  1NU1 K;  1UII A;  3AEC C;  4GR2 A;  4R4M A;  1VQ7 P;  5AVQ B;  1N86 A;  4N6J A;  4D6T E;  3SFD C;  1N7S B;  1NTM E;  3RG2 A;  1P84 E;  2JGP A;  2QJY C;  1KFN A;  3P32 A;  2O1J A;  1D7M A;  1OVR A;  2O01 J;  3TDK A;  3G6E P;  4H2W C;  1GU4 A;  2E76 C;  3RG6 C;  1DIP A;  4ZKU A;  1BE3 G;  1VF5 B;  2O01 H;  3IN6 A;  2OYO A;  1T8Z A;  1W2E A;  1SQQ G;  2B9B A;  1JY3 N;  1NTZ J;  2C9L Y;  2WSF J;  5CCH C;  2KB7 P;  2AXT E;  2WSS H;  3KQG A;  1NTZ D;  4JYB A;  4OGQ B;  3CPW O;  1OX3 A;  1JNM A;  3ABV C;  2Q3E A;  1K30 A;  3HYB A;  2ZAE B;  1T3J A;  3VYI A;  2ZVO B;  2R5B A;  1FJP A;  4IFD K;  1FZC B;  2POH A;  2KP8 A;  3PJS K;  2FHS C;  3E1I A;  4KT0 J;  1PV3 A;  5EFW B;  3IF4 A;  5AW9 B;  1MFZ A;  2R32 A;  2QE7 H;  4JF7 A;  1SFC D;  1ZV8 A;  1JY2 O;  1M6N A;  2K93 A;  1NOH A;  3DS4 A;  3AEE C;  3HE5 A;  1LTJ B;  1KIL C;  2QVA A;  1W5C E;  1Y47 A;  2V7Q H;  1J2J B;  1G1I A;  3II6 A;  1JY3 O;  4YTP C;  2KOO A;  2HPC B;  2W6B A;  3HD7 B;  4U0C A;  1M6E X;  2FXM A;  4Y99 C;  3G26 A;  1OW8 A;  3AEA C;  2ERH A;  2QM8 A;  3H1I G;  3AE6 C;  2VLN A;  1OMI A;  1SFC B;  4LC1 A;  1N7L A;  3R4Y A;  1HY8 A;  4H44 C;  2GZI A;  4IL6 X;  1A02 F;  4YXW H;  2KLV A;  4WY4 B;  5GTH E;  2KOD A;  3G4S P;  3DS5 A;  4PWV B;  1HF9 A;  5EW5 E;  1BCC G;  3H1I D;  3V2R A;  1SQQ E;  1KV4 A;  3CD6 P;  1SFC A;  3KYQ A;  5KAI H;  2JYG A;  2GYK A;  1X22 A;  3O6Q B;  1SQX K;  2FBW C;  1IK9 A;  2Q6Q A;  3BCC E;  1AV1 A;  1EDK A;  1OVV A;  1ZLL A;  4NEO A;  2MD9 A;  2O1K A;  1JMM A;  1T3U A;  3L74 G;  2UWJ E;  2KZI A;  2QJP C;  2W6A A;  1VQ9 P;  2L4B A;  1FU1 A;  3CCV P;  4OGQ C;  1DD4 A;  1IFJ A;  5KKZ B;  3DS3 A;  3GZL A;  4PJ0 H;  1YQ4 C;  1RO0 A;  3PH0 A;  1S3J A;  4WB4 A;  1K05 A;  5APY A;  2FYN C;  3WUU A;  2E1M A;  2BCC J;  2J59 M;  1NQ4 A;  1NO4 A;  2QJK B;  1YTZ T;  2I1K A;  4H2Y C;  1PP9 J;  1KYO I;  2W90 A;  3RK2 C;  1Q82 Q;  2Q5U A;  4EDF A;  3H6P A;  1W2B O;  2EIA A;  1LWU B;  5KLV J;  2V4H A;  4L76 A;  2EG5 A;  2MVV A;  2LTE A;  2XXM A;  3H1H J;  3H1L E;  4WVZ A;  1RE3 C;  1X3O A;  3M9H A; 
#chains in the Genus database with same CATH homology
 2H43 A;  1LTG C;  5AVX B;  2A45 H;  2ZXE B;  2OYH A;  1KIL D;  1NH4 A;  3KPE A;  3CXC O;  3N4X A;  4GKG A;  1CI6 B;  1YYC A;  2YO2 A;  1X8Y A;  3HRN A;  4LLH A;  1FAV A;  3G71 P;  2HFE D;  2ZFC A;  1T2K C;  2C0W A;  2QA4 P;  2DGY A;  3HD7 D;  1SQP K;  1M74 A;  3VMX A;  2FYZ A;  3VOP A;  2M8P A;  3WBH A;  1HGV A;  1LGH B;  3N7N A;  2C9N Y;  1YIJ P;  2JO0 A;  3CCR P;  3DTJ A;  1S9K D;  2C0X A;  3P8M C;  2OYH B;  3DS0 A;  1VQL P;  2BHV A;  2M8N A;  4IFF A;  5BVZ A;  3PP5 A;  4N78 E;  2XU6 A;  5APT A;  2Z46 A;  1A43 A;  1NHL A;  4XA4 A;  1YJN P;  5BU5 A;  2N1T B;  2H8P D;  2HPC A;  1J1D B;  1JTH A;  1QVG O;  1M1J B;  2P7J A;  1SP4 A;  1SQQ K;  5CMZ A;  2OTJ P;  2Z4E A;  4WYM A;  1OXZ A;  1YJW P;  3RK2 B;  3TK1 A;  3P8C E;  2XV5 A;  5KTB A;  5AW7 B;  2Q3I A;  3U1C A;  2PEJ A;  4U0B A;  1FDM A;  1FBM A;  1J1E B;  4HH2 A;  5APS A;  3NXS A;  3H0D A;  3CCQ P;  2FFD A;  4XRQ A;  2E42 A;  1IFM A;  1QL1 A;  1VQO P;  2FYU K;  3HE4 B;  5CHX A;  5HGM A;  1E6J P;  3M0D A;  2WT7 A;  1X79 B;  3MUD A;  3EFG A;  2Q9I A;  2PEK A;  1LT9 A;  1NTM K;  2MJZ A;  2W27 A;  3CCS P;  3CI9 A;  3TYY A;  3VN0 A;  3H4E A;  5AVU B;  1HUC A;  3V2P A;  1LT9 C;  3RL0 C;  4QNB A;  2J58 A;  1FOS F;  3M91 A;  2OYI A;  1Q81 Q;  4XFZ A;  1RNI A;  4AYC A;  2WSF H;  2Q7C A;  2XDJ A;  3H32 A;  3TNU B;  3V2N A;  1KZU B;  1J1E C;  2NPS A;  1HBW A;  3OW2 O;  2EFJ A;  2KSJ A;  1GL2 D;  5F2N A;  5HGO A;  1XTC C;  5DCK A;  3LW5 H;  3WMM 0;  1FZA A;  3BRV B;  3NTE A;  1N73 B;  2OYI B;  3P05 A;  2N1T D;  1NJI Q;  2HG5 D;  3RK3 B;  3V4W A;  4O9B A;  3B5I A;  4U0A A;  2E43 A;  1PFI A;  4U0F A;  1G2C A;  2PEM A;  1D1D A;  1VQ6 P;  1K9M Q;  1KD1 Q;  5AW5 B;  3G1I A;  3I5C A;  4B86 A;  5KLV K;  3CCJ P;  1HGZ A;  4I2L C;  4WY4 D;  5AW3 B;  1FOS E;  3I56 P;  1FZG A;  1T2K D;  1FZE A;  1CI6 A;  2YKP A;  1FZB A;  1GW3 A;  3HTK B;  3V2Q A;  2GM4 A;  3CC4 P;  4AQR D;  2P9X A;  2KOG A;  3CC2 P;  3G3Z A;  3M06 A;  5AW2 B;  5KJ7 C;  3IFM A;  3HZQ A;  3BRT B;  2WTY A;  3TNU A;  5I4T G;  1RY3 A;  2XT1 A;  3I55 P;  3KDP B;  1H88 A;  3P7K A;  5KJ7 A;  2WPS A;  3MIW A;  2PAJ A;  1L4A C;  1N7S C;  4Y99 B;  1VDF A;  1QVF O;  3LID A;  1N73 A;  1JCC A;  1GD2 E;  2QEX P;  4COC A;  5BS2 A;  1LWU A;  2FFD B;  4N3Y B;  1DX7 A;  3G28 A;  4IPY A;  1GL2 B;  1DEB A;  1L4A A;  1N7S A;  2P2U A;  2YKO A;  4XFX A;  3V4Q A;  4LGD E;  3MGE A;  3C9I A;  2WT7 B;  2M3B A;  2M8R A;  1JTH B;  2YO3 A;  3SWF A;  2NPS C;  2OYH C;  5APW A;  1Z56 A;  1EIA A;  2YMY A;  3M0A A;  4C7N B;  4XFY A;  3G21 A;  1GW4 A;  1KC8 Q;  4KHX A;  1MUU A;  3M1M A;  2IFM A;  1LTS C;  5CCH A;  3O8Z A;  1J1D C;  2WZ7 A;  1N73 C;  1HVV A;  1URQ C;  4PH0 A;  5AW1 B;  1IO4 A;  2HLO A;  2N9B A;  3H32 B;  1JY2 N;  5AW8 B;  2XV6 A;  4EIJ A;  2BUO A;  1YJ9 P;  1RE4 C;  3CMA P;  3A7O A;  1SQV K;  1RF1 B;  2BAS A;  4XRO A;  2A45 G;  5AVW B;  5BU8 B;  4U0E A;  3CCM P;  4IFM A;  1RF0 A;  4C46 A;  4RES B;  1JUN A;  3Q20 A;  1NU1 K;  4ZKP A;  4GR2 A;  1LTA C;  3M9Q A;  5CJ4 A;  1VQ7 P;  5AVQ B;  3RL0 D;  1N86 A;  4N6J A;  4OH8 B;  3RK2 D;  2WIT A;  1KQL A;  1L4A B;  1N7S B;  3OAK A;  3VRL C;  2N1T A;  1EOQ A;  3EQ2 A;  5CCH D;  1LWU C;  1G2C B;  2XKM A;  3CL3 D;  3VTP C;  3E2D A;  1KFN A;  1N2D C;  1LT9 B;  4COP A;  2IPP A;  5AW4 B;  1M1J A;  2Z5H A;  3P32 A;  5CCG C;  1FJK A;  2IFN A;  2LKM A;  2NPS B;  2O1J A;  4XE5 B;  1VQ5 P;  3H47 A;  2I1J A;  1CW5 A;  1JY3 P;  1L0L K;  2VRS A;  1AFO A;  1SQB K;  3G6E P;  3VP9 A;  3TSI A;  2FKW B;  1GU4 A;  1QRJ A;  5CCG A;  3RG6 C;  4ZKU A;  3R2P A;  3LRY A;  2O01 H;  2PP6 A;  2CPS A;  1T8Z A;  1W2E A;  2Z5I A;  1YTZ I;  1JOC A;  4DOJ A;  2PEN A;  1IFD A;  1AQ5 A;  1URQ B;  1GK6 A;  1E5W A;  1JY3 N;  5AVT B;  3NTN A;  1JY2 P;  1YI2 P;  1NKN A;  4WBA A;  5AVV B;  2C9L Y;  3DS2 A;  1FZF A;  1GTW A;  2OYI C;  2HOD B;  5CCH C;  1H89 A;  2KB7 P;  3CLQ A;  4W7Z A;  3KQG A;  4JYB A;  3B5N D;  3CPW O;  1JNM A;  2XZR A;  3HUS B;  3VMY A;  1ZMB A;  4WY4 A;  1K30 A;  3HYB A;  3V5B A;  1T3J A;  3VYI A;  1FJP A;  2R5B A;  4N78 D;  3A3Y B;  4PH1 A;  4IFD K;  1NTK K;  2WSC H;  3HE4 A;  3NMD A;  2POH A;  1FZC B;  3L36 A;  2GUV A;  2KP8 A;  3CCU P;  1YHQ P;  1XTG B;  3M0D C;  3HUS C;  4JYC A;  3OJA B;  5AVY B;  3T97 A;  1GK4 A;  3E1I A;  2CPB A;  1VQN P;  2YNY A;  2YKQ A;  5AVR B;  4C7R A;  1GDT A;  5AW9 B;  1IFN A;  3CCE P;  1MFZ A;  2R32 A;  3CC7 P;  1M90 Q;  1VPC A;  4JF7 A;  1KIL A;  1M1K Q;  3RK3 C;  4M3L A;  1KQS O;  1SFC D;  1ZV8 A;  2M8L A;  1JY2 O;  1M6N A;  2CWO A;  3HUS A;  1NAF A;  4DZO A;  1IC2 A;  2H7H A;  1NOH A;  4HYT B;  3DS4 A;  1LTJ B;  5F2K A;  1EQ7 A;  3HE5 A;  4W80 A;  2WPQ A;  4I6M C;  1KIL C;  1LTI C;  2N1T C;  2NPS D;  3VP8 A;  1SLQ A;  2Z44 A;  4C7N A;  1J2J B;  1G1I A;  3II6 A;  4W7Y A;  1JY3 O;  1KIL B;  1S72 P;  1GL2 C;  1VQ4 P;  2GUS A;  2HPC B;  2W6B A;  3HTK A;  1GL2 A;  3HD7 B;  4EOT A;  5JPA A;  4U0C A;  1M6E X;  1Q7Y Q;  2FXM A;  1YIT P;  4Y99 C;  3G26 A;  1M1J C;  3VMZ A;  3G0V A;  3CME P;  2QM8 A;  1IUQ A;  3SWY A;  1L0N K;  4GT1 A;  2PEI A;  1JJ2 O;  1SFC B;  4LC1 A;  1A8O A;  2L6E A;  1N7L A;  5AVZ B;  1WRG A;  3B5N C;  1A02 F;  4AUW A;  1CSB A;  1GZL A;  2KLV A;  1URQ D;  3L37 A;  4WY4 B;  1NKZ B;  4I1L A;  5AVS B;  2P67 A;  3GHG A;  2PEQ A;  1HWT C;  2KOD A;  3G4S P;  1FZC C;  1CZQ A;  3UIA A;  5CCG D;  1HJB A;  3L4F A;  3DS5 A;  3BAT A;  1K8A Q;  1LTJ C;  5CJ0 A;  2WWW A;  3V2R A;  4M0I A;  1VQ8 P;  1VQM P;  3CD6 P;  2JYL A;  1SFC A;  2A45 I;  5APQ A;  1VQK P;  1GU5 A;  3KYQ A;  3LIE A;  3RL0 B;  2JYG A;  1SQX K;  3HD7 A;  3CCL P;  3B8E B;  5APV A;  3B5N A;  1IK9 A;  3M9B A;  3OA7 A;  1OWA A;  1DH3 A;  1VQP P;  3BAS A;  1ZR2 A;  1ZR4 A;  1ZLL A;  3U59 A;  2O1K A;  4GIF A;  1JMM A;  1T3U A;  1RE4 A;  1URQ A;  2QM7 A;  5AW0 B;  2W6A A;  2WSE H;  1VQ9 P;  3MGN A;  2IX7 C;  3BVH A;  1FU1 A;  1NWQ A;  4U0D A;  1HTL C;  2ONT A;  3CCV P;  1SFC C;  1WT6 A;  2OAR A;  1IFJ A;  2JJL A;  2L5G B;  3GHG B;  3DS3 A;  1IFI A;  3HD7 C;  3U1A A;  1RO0 A;  1ZN5 A;  3MTU E;  5HGN A;  3MD0 A;  3DPH A;  1H8A A;  1RF1 A;  4WB4 A;  1JCD A;  1AUM A;  5HGL A;  3GHG C;  1LTB C;  1NTZ K;  2JEE A;  5APY A;  2P1J A;  2E1M A;  1RF0 C;  1SVF A;  3NFQ A;  3G29 A;  2HOD A;  1Q86 Q;  2J59 M;  1LTT C;  1G1J A;  1IJD B;  1KFM A;  1NO4 A;  3B5N B;  3G1G A;  1RF1 C;  2HYN A;  1A02 J;  5F2O A;  2KYV A;  3RK3 D;  1RO2 A;  1L4A D;  1N7S D;  1BAJ A;  2R5D A;  3IR9 A;  3DS1 A;  3A2A A;  1N8R Q;  1MZ9 A;  1YTZ T;  5APU A;  1JO5 A;  1FZC A;  1M7L A;  1QL2 A;  2I1K A;  2R3C A;  1LTJ A;  3HE5 B;  2LF4 A;  1K73 Q;  1MV8 A;  1Q82 Q;  1RE3 A;  3RK2 C;  2Q5U A;  4GR6 A;  1S9K E;  5KJ7 D;  3A5T A;  3H6P A;  1W2B O;  1X9V A;  2WPR A;  2EIA A;  2PY8 A;  1LWU B;  3L35 A;  5BS1 A;  5AW6 B;  2EG5 A;  2PEO A;  1HH0 A;  5APX A;  2XXM A;  2FFD C;  2OTL P;  1RE3 C;  4WY4 C;  2Z45 A;  2XNX A;  3P8C D;  3M9H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...