2OARA

Mechanosensitive channel of large conductance (mscl)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
125
structure length
125
Chain Sequence
MLKGFKEFLARGNIVDLAVAVVIGTAFTALVTKFTDSIITPLINRIGVNAQSDVGILRIGIGGGQTIDLNVLLSAAINFFLIAFAVYFLVVLPYNTLRKKGEVEQPGDTQVVLLTEIRDLLAQTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Large-conductance mechanosensitive channel
publication title Structures of the Prokaryotic Mechanosensitive Channels MscL and MscS
pubmed rcsb
source organism Mycobacterium tuberculosis h37ra
total genus 42
structure length 125
sequence length 125
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2006-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01741 MscL Large-conductance mechanosensitive channel, MscL
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.120 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2oarA01
1.20.5.220 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2oarA02
2FYUK 1SQVK 2WSCH 1SQPK 5KLVK 1NTMK 3CLQA 1SQBK 1NU1K 1NTZK 1SQXK 3M9QA 2O01H 2J59M 1NTKK 3LW5H 3HZQA 2WSEH 3G3ZA 1L0LK 2LKMA 1SQQK 2OARA 4IFDK 1L0NK 2WSFH
chains in the Genus database with same CATH superfamily
3AE2C 2FYUK 2R3CA 2WSCH 5AVQB 1QL2A 1AYIA 1XTCC 1QRJA 1E5WA 4JF7A 1YJWP 3V4WA 3G26A 1IK9A 2YXRB 4DCKA 2WT7B 1AV1A 3M0DC 1JO5A 2LIUA 2WSFJ 3HUSB 1Q2NA 3RL0D 3H0DA 2Q3IA 5APUA 3GHGB 1N7SD 4C46A 3HE5B 4IFFA 3KPEA 3WU2H 2FYUD 2G3AA 4A7PA 2O01H 1A43A 4GOEA 2MF4A 2L91A 2AEJA 2L5GB 2WT7A 2ZT9D 1LT1A 4H0LC 5GTHH 1JCDA 4NPEA 4UHPB 3E2DA 3GHGA 1LTSC 1NU1K 1HGVA 3WUUA 5CCGA 3LRYA 1W2EA 3HE5A 3S1KA 3PHLA 4BRYA 5HGNA 1Z6MA 3CXHE 2HPCA 5GTIE 3JCUE 2HFED 4CA3A 4N6JA 2AXTE 1MZ9A 1IFDA 2FHSC 3UIAA 2FADA 2CPBA 2K1AA 3U1CA 5CBNA 1NU1D 1HTLC 2P2UA 1SQXD 1K04A 1ZOYC 4F37A 1PP9J 1NTKJ 1X0TA 2RN0A 3HTKB 5KAIE 2CWOA 2L4BA 2JDIH 3PH0A 1ZW0A 2L22A 2K2QA 2BEQD 1G1JA 1JY3P 1LTIC 1VQOP 2BUOA 1M1JB 2RKLA 4GODA 2YKOA 2GDWA 4TT3H 5AW6B 1L4AD 3A2AA 2JP3A 2BCCJ 2Z5IA 1JEKA 5APSA 2PFXA 3HD7C 4IL6H 4OGQD 2M5RA 1T3JA 1KQSO 1BDCA 3HTKA 1R5LA 1IMPA 4EDFA 2X2BA 5AVXB 5CJ0A 4JPZB 4D6TG 3L75E 2XKMA 2B87B 5KLVJ 2H89C 1M74A 2E74B 3SFEC 3I55P 2PEIA 2E5YA 3CI9A 1MKMA 4ASVA 3DS3A 4UB8E 1OW7A 3DS0A 2P58A 2IYOA 3KDPB 3BCCE 5APQA 3ITKA 3CCEP 1ZRTE 3K5BA 2R5DA 3G71P 1KN7A 2PNGA 3AEBC 5KJ7C 2KS1B 1RF1B 1A02F 4U3FG 4I2LC 2OTJP 1GW3A 2WPQA 4RO0A 3TYYA 1HF9A 3L70J 5KKZC 3RK3B 4YXWH 2OYIC 4MRTC 3A3YB 2E75B 2C9NY 2A45I 2D2CD 2XNXA 1NO4A 2M3BA 2EFJA 3E1IA 4BPFA 3ABVC 3MP7B 3MGNA 1KILB 3DS5A 3NY7B 1LTGC 1MZ8A 2DW3A 2K9JB 1MV8A 3NXSA 1BAJA 3VTPC 1SQQG 3L74G 1JY3N 2B88A 1J1EB 3KHUA 1QVFO 4PJ0H 1HQBA 2JJLA 2W6JH 2KXPB 1OXZA 3L71D 3MZWB 1UNKA 1YIJP 1KFMA 2IBZG 1KILA 5APYA 1KMIZ 2DNWA 2K9JA 2LR2A 3Q5RA 2FXOA 2KLVA 1Y8AA 3NTNA 2XV6A 3VP8A 1LNQA 3HYBA 5I4TG 3WU2E 2JEEA 4H44B 2GM4A 2JO0A 1NAYA 1NTMJ 2KORA 5KTBA 2KGCA 3P8MC 1L0HA 1FZFA 3N4XA 2DGYA 2HODB 3H1IG 3ZDMA 3V5BA 3L75J 3GZMA 1FU1A 3JC22 3Q3DA 2UWJE 2XZRA 1GD2E 1M56D 2W83C 1FZCB 2SPZA 1NHLA 4XFJA 2HODA 2KG6A 3GG2A 2Y0EA 4COCA 1VQ9P 2N1TB 1FE6A 2ZXEB 4LLHA 2PEOA 1M1KQ 1YI2P 1EIAA 1BCCJ 3H1HG 1SLQA 3CCMP 1DEBA 2NPSC 2H43A 3IFMA 1E0HA 1Q82Q 1IMQA 4HB1A 1LP1B 3V4QA 2WSEJ 1AF8A 3G21A 3U59A 4I1LA 3HZQA 3MGEA 1L0LG 1BGYD 2C9LY 1KC8Q 4DG9A 1NOHA 1SQBE 1QGKB 3R4YA 4WY4B 1GU4A 3H1LG 4DT0A 2CGQA 2IFMA 5KLIC 1JTHB 3H1JG 1PGQA 1RE3C 1LP1A 2Y9YA 3SFDC 4EIJA 4R0MA 1PGOA 1QEXA 3BRVB 1U7JA 4PV1D 2FXPA 3IR9A 2PEQA 4Y28J 3G1GA 3A5TA 2XXMA 1IO4A 2GUVA 2QVAA 1LT9B 2E1MA 2O01J 1HJBA 1JMMA 3RK3D 3DS1A 2QJPC 1SQPJ 2LXBA 1BE3G 2M0BA 2JU1A 2K9YA 1LT9C 3B5NB 1RQUA 1N73C 2JB0A 2K0XA 1KILD 2WITA 1AJYA 3S9OA 2GZEA 2JGPA 3EJEA 3F89A 1T8KA 1SQXE 3E7KA 2YNYA 3RL0C 3CX5I 2QJYB 5AVZB 2Q9IA 2Z45A 2K94A 1IFJA 2K92A 3B4SA 4N78E 2NO8A 1N7SC 3L37A 1FZGA 1S9KE 1P84I 1A8OA 1FZBA 3CC7P 3AE9C 3PRJA 5L8RJ 3OAKA 1Q90D 2OYHB 1SQQK 4PJ0E 2Y0DA 2ZT9C 1RE4A 1NTZG 1KQFB 1PPJE 1ZXGA 3N7NA 3Q20A 5HGMA 1JCCA 1YJNP 1D1DA 4H44D 2QM8A 1OZHA 1IUQA 1JY3O 1FDMA 3L73D 5CCHA 2Q7CA 1N86A 3B5IA 4ZNCA 3KQGA 1LTJB 2XU6A 3L74D 1NAFA 1DX7A 1NJIQ 1LWUC 2E42A 1LJ2A 1VF5B 2FYUJ 1AFOA 1RNIA 2KGEA 2LIWA 1NKZB 4B86A 1KD1Q 1IFMA 4RJTA 2L9FA 5AW4B 1LTJA 4HJGH 1L4AB 1YTZT 3CCVP 2JR8A 5AW7B 1Q86Q 2A06G 2N1TD 1IK7A 2WPTA 1KQLA 1BDDA 4OGQB 5JPAA 4BWNA 1L4AC 4N3YB 2MR8A 2Y9ZA 3T97A 2Z4EA 1P84D 4ZKUA 2QIWA 2QJKC 3H1ID 1AQ5A 1X79B 3L72D 3TK1A 3V2RA 2KUBA 1NU1J 1ZMEC 1GXHA 1SQXJ 3KYQA 3L71E 2W90A 2R3SA 4U7JA 2C0XA 3H25A 5KP8B 2KSJA 1ZLLA 4AQRD 1OVUA 1PP9E 3GKLC 2JU2A 1NTKE 1JMBA 3TGUD 4H13C 4Y99B 4JQ0D 3I5CA 1EZVG 5DJUB 1GL2B 1KZUB 1S5LH 2FFDC 1PFIA 2YXQB 3M0AA 1RY3A 5AVYB 2LMLA 3KZIH 1EXJA 1L0LK 2O3JA 3A0BH 2KLUA 2D2CB 3CE7A 4AYCA 2N6YA 2H7HA 1EQ7A 2E76D 4PD4D 1EMVA 3AE3C 3H6PA 5DJTB 1GL2A 2D2CC 2IPPA 2Q6QA 3OJAB 1SQVE 1M90Q 5KLVE 4RKUJ 2Q1KA 3B5ND 1CSBA 2WMMA 3CX5H 2BCCG 3IF4A 4JYCA 2N50A 1J1DB 1WMKA 3HUSC 2MD9A 2P10A 3AEAC 4BRYB 1X3OA 1Q81Q 3H1LD 1P84H 2J58A 3GHGC 3L4FA 2HPCB 3P8CD 2LF4A 2VSQA 2QA4P 5KLVG 1NYHA 5CCHD 1G2CA 4ZMDA 1H0TB 3L70E 3VOPA 1X8YA 2C0WA 2ZAEB 3VP9A 1DD4A 1NWQA 3SWFA 1PGJA 2AFEA 2LOLA 2VLPA 2Q3EA 2O1KA 2ROQA 1T2KC 1KYOD 5EFWB 3EJBA 3D70A 1NTZK 5AW1B 1H0TA 3L71J 5HVCA 1J2JB 1VQ6P 2WZ7A 1DNYA 1VF5D 1VQMP 3LW5H 1CEIA 4EOTA 4OH8B 3LMOA 4LC1A 4WYMA 1L0NK 2L0QA 3MUDC 1YQ3C 2FXMA 4QNBA 1DV5A 2KODA 2KSEA 1HJ0A 2LPKA 1AQTA 1R5SA 1NTZD 2MVVA 1GK6A 1LTTC 3FX0A 1NTME 1M1JC 1R8EA 2JYLA 3RK2B 1CZQA 1AA0A 2B89A 5C39A 2POHA 4PH1A 2M8PA 1GTWA 2KR5A 1PL5A 1L0ND 3TSIA 1HY8A 2J59M 1MFZA 1SQVJ 2KOSA 3G29A 2GYKA 4U0AA 2JAZA 3CCJP 2GDXA 1EC5A 3CD6P 3VMXA 3O8ZA 2MY5A 2XV5A 2B9BA 2WTYA 5F2OA 3C8VA 1NTMG 1G1IA 1UIIA 2ZJSE 1VQ5P 1N8RQ 2MKVA 2E74C 1K9MQ 5CHXA 2WPRA 1BSNA 2NRGA 3HD7A 3FWLA 2JWDA 4I7ZB 4PV1B 3L75G 1GL2D 2G8YA 1ZP0C 2P67A 1ZR2A 1EXIA 3MTUE 1NH4A 1BCCE 1YTZI 3EFFK 4IFDK 2WVRA 1KB9I 1RF1C 1A02J 3U1AA 3FGAD 5BU8B 3CWBD 4M3LA 5APXA 3BCCG 1EDLA 3H1KD 1IFNA 3RBZA 2FY8A 2W8ZA 3RK3C 2RH0A 3QH9A 2E75C 1AUMA 1URQB 4YTPC 2KK7A 1VQ7P 1W2BO 1BGYJ 2XDJA 3OW2O 1USEA 3A0BE 5KJ7A 4U0FA 3KXDA 1KILC 3L36A 2AVAA 1J1EC 3TF5A 5CCGD 4JBZA 1GDTA 1S2EA 5TJHA 1YBKA 1QX8A 1EZVD 3EJDA 5CZDB 2FBWC 1URQA 2IYPA 2FQ2A 5APTA 2W6AA 1OWAA 2OARA 2L6EA 1FC2C 3CX5E 3CLQA 1K30A 1BSHA 1K8AQ 3C1LA 3AEGC 2KW2A 1SQPE 4BPGA 4H44C 5HV8A 2AEFA 5GTHE 2OTLP 1YJ9P 2BHVA 2YKQA 3AE4C 4L76A 1KV4A 3CL3D 1S4XA 1KB9D 3TGUE 1ZNVA 3D6ZA 2E43A 4IFMA 1ZMBA 2LKIA 5HGOA 3AEDC 1SQPG 2PRRA 2GA1A 2N9BA 4C7NA 2FVAA 1PV3A 4WWIA 1H8AA 5AVRB 3SWYA 4QMAA 1FZCC 4BXLA 4R4LA 1X22A 2OGUA 3M91A 2KI7B 1IFPA 2R32A 5AW5B 3II6A 3L73J 2N1TC 4Z1MH 2K88A 2M5AB 3WUTA 1ZV8A 3EFGA 2ZVNB 2YO2A 3AE1C 1VQKP 3RK2D 3L74J 2EIAA 1S3JA 4M0IA 2VLNA 5KAFH 1OVVA 2FYUE 2I8DA 2K0YA 1FJPA 3CCUP 2JKVA 3DS4A 4IL6E 2VLOA 2M5AA 2W27A 1FAVA 1Y9BA 3IAOA 2KOQA 2NPSA 2WSSH 1FOSF 4WY4C 1JB0J 3VRLC 2FQ0A 4NPFX 3B71A 2E76B 4KHXA 2CPSA 5AVTB 1KB9H 5BU5A 1SQBG 1FS0E 1QLED 2ZVOB 2WWWA 4W80A 1GPJA 5HGLA 3G4SP 2E76C 2IBZI 3L72J 1L0IA 3AE8C 3F5HA 1SFCB 1GZLA 4D6TD 1NU1E 1URQD 3LIEA 2H88C 3AE5C 3B5NC 5E79H 3Q5SA 2HLOA 1FZEA 3SWKA 3TGUJ 2YKPA 4NPDA 4HYTB 2N98A 3RG2A 3GZLA 2NZ2A 2QJYC 5AVWB 1SFCA 2KZJA 3IN6A 2KOGA 4XRQA 3C9IA 1ACPA 3AE6C 2KG9A 4C7RA 1GXGA 1M57D 4U3FD 1NU1G 5AW0B 2CNRA 1SQXG 1N73A 2FQ1A 1CI6A 2QE7H 2FYNB 3LW5J 3BVHA 4ASWA 1HUCA 2KNCB 2OYHC 3PJSK 1N7LA 1KLPA 4CPGA 3BCCD 1S1CX 3H4EA 3DTJA 5GTIH 3JCUH 2FYNC 1KTMA 1N7SA 4COPA 1VL2A 2KZIA 2Q5UA 1FDOA 2V7QH 2WPSA 1SQQD 1NVOA 5BVZA 3M9QA 1LTBC 3W68A 1PPJG 3H1LJ 3MD0A 2FKWB 2KNCA 3FXEA 4OVNF 4PD4I 1LTJC 3PTZA 4PXHB 2WPVB 3A0HH 1VF5C 3WUVA 4DJGA 2IBZD 3T97B 1YYCA 3BATA 2M3EA 2IDBA 2KYVA 5DCKA 3V2QA 1U57A 1RHZB 3RGUA 3P7KA 2Z5HA 5APWA 3H1KE 2OTKE 2R44A 4L73A 2ZYAA 3PP5A 2P9XA 1WRGA 4OGQC 2YMKA 2GDYA 1WT6A 1DD3A 4UB8H 4DZOA 1EDKA 3U43A 1PGPA 4L74A 1JNMA 4H2XC 1JY2O 1YHQP 1ZN5A 5AW9B 4XA4A 3CCSP 1RF0C 5AVSB 1SVFA 1NTZJ 4BPHA 2YO3A 3M06A 1IFIA 5KAFE 1KYOI 1LTAC 3VMZA 3AEEC 4Y99C 4L75A 3L71G 1GL2C 1VDFA 3H1HD 1N2DC 3CC2P 4IOIH 4EYYQ 1VQPP 4YPCA 2AFDA 4GOFA 4OWFA 3VN0A 3VMYA 2MVUA 2CG5B 1PP9G 1L0NJ 1NTKG 4WVZA 1XTGB 4GT1A 4WBAA 2QG4A 2BASA 4AUWA 2QNWA 4DOJA 3H47A 2J5UA 3GLMA 2GZIA 1SFCD 1VQ8P 3L35A 1KB9E 2FFDA 1KFNA 1G2CB 2KP8A 1RO2A 5K5GB 5AW8B 4GDOA 2ZYGA 4IPYA 1L0LD 1SQBK 1DEEG 5KP7B 3S4RA 4YXDC 1EDJA 1T8ZA 4K3AA 4PWVB 2LXCB 3H1JD 1FJKA 1J1DC 5CCGC 1BXIA 2IX7C 1SQVG 4O9BA 1AVOA 1IZNB 1FBMA 1GMJA 2GZGA 3M0DA 5E79E 4H0LB 2A45G 1M8OB 3P32A 3CWBJ 4W7YA 1SQBD 4NEOA 3H1KJ 1FDIA 1S72P 2EHTA 3CCQP 3D71A 2IFNA 2K3RA 3HUSA 3SSUA 1EDIA 1BE3D 1CW5A 4U0EA 3GF3A 3V2NA 2ONTA 1PIXA 2ERHA 3GMAA 1BGYE 5TISH 1SQXK 3CMAP 1OW6A 3L70G 4PD4H 4IL6X 2O1JA 3VMAA 1W5CE 1DH3A 2Y0CA 5B5EH 4PH0A 2KGDA 1OMIA 5KP6B 2N9YB 2P7JA 4XE5B 3V6IA 4XFZA 1BGYG 2BEZF 3NFQA 2KWLA 2QM7A 2FAEA 3RK3E 1EOQA 5AW2B 2W6BA 4N78D 1H88A 3VYIA 3A0HE 4HH2A 2PEJA 3WBHA 1S9KD 2O01N 4H2YC 1KILE 4GIFA 4D6TE 1EZVI 3CC4P 1IJDB 3HD7B 3JSVC 1VPCA 3AECC 1JJ2O 3MIWA 3NTEA 1AVYA 3RK2C 1VKUA 1HVVA 3GW6A 2Z44A 3MUDA 3MHVA 3B4QA 2AEMA 3CMEP 1PPJD 2XT1A 2KB7P 2QEXP 2JYGA 2N6ZA 2JWAA 3NMDA 1HWTC 4KT0J 1M1JA 1OR5A 4U3FE 4QKOA 3A7OA 1KYOH 1FZAA 1JOCA 2KG8A 5AVVB 2EHSA 4GR6A 4H13D 3I56P 2A06D 3GF7A 4I7ZC 4IZ6A 4PV1C 5APVA 2ZXXA 2FVFA 3L73E 3W67A 1HGZA 1VHNA 2EG5A 2PY8A 5KKZB 2B87A 2ZYDA 1S5LE 2OYIB 1JY2P 1SQQE 3L74E 4WB4A 3KZIE 2PAJA 1BCCG 2IZ1A 1UIXA 2WQYC 1URQC 2PENA 3EQ2A 5M1BA 2IBZE 1NTKK 4HKGA 3L73G 3G6EP 1F80D 2KS1A 1RF1A 2OYIA 2V7QJ 2M8NA 2PEMA 2FYZA 2JBGA 5AW3B 1JUNA 2PP6A 3CXCO 2LTEA 2XNDH 3EWKA 3PLNA 3DPHA 1FOSE 3D6YA 4H0LD 1H89A 2AXCA 5H2FH 1P84E 1PP9D 1NTKD 2XZ0D 3CXHI 3H1IE 1OX3A 4D6TJ 3L72E 2LKMA 2GZJA 4C7NB 2MJZA 2FACA 2WSFH 1SQVK 4UB6H 5KLVK 3QWOC 2BCCD 2ZFCA 1OFCX 1MFTA 1KORA 2I1KA 2MR7A 4U0CA 1T2KD 1GW4A 3L72G 2KOPA 2CK3H 4U3FJ 3Q5PA 3P05A 2AF8A 3HE4B 1JY2N 5TISE 1SQVD 5KLVD 3H1HE 2QRXA 1LGHB 4PD4E 3CPWO 1YITP 5B66H 3R2PA 3TGUG 3BCCJ 5B5EE 3DS2A 1NGMB 5CMZA 2XZ1C 1JM0A 1SQQJ 3HE4A 2NPSB 2JQ4A 1HH0A 3HD7D 1L0LE 4HKZH 3L70D 1FZCA 3H1LE 3G1IA 3H1JE 3TNUB 1SS1A 3P8CE 1GK4A 3CXHD 3V2PA 7CEIA 2N1TA 5AVUB 2JO1A 4U0DA 5KLIB 1Z56A 4K35A 2PGDA 2WSCJ 1IC2A 3OA7A 2E74D 2FVEA 2FYUG 2E5TA 1E6JP 2VRSA 3E1RA 2PEKA 5KJ7D 1NTMK 3CCLP 3TNUA 3RBXA 4W7ZA 1BE3E 2P1JA 5BS1A 3RL0g 2N5HA 3H1IJ 2K0DX 1USDA 3G0VA 3TDKA 1KYOE 4GR2A 2QJPB 1M6NA 1RE3A 3AEFC 2A45H 1N73B 4WY4A 1CI6B 1SFCC 1K05A 2KOOA 1ZR4A 1PZQA 1MUUA 2E75D 1JTHA 1NTMD 3RL0B 1RE4C 2I1JA 2R5BA 1VQ4P 3Q1MA 1N7SB 1TU3F 3M1MA 1NTZE 3L75D 3LIDA 3O6QB 3H1HJ 3H32B 1U7MA 2HYNA 1E79H 2VLQA 1LT9A 2KIKA 1GU5A 3B8EB 5CCHC 2K5XA 1DIPA 4EI2A 1NQ4A 3M9BA 1M6EX 2ZT9B 3CXHH 3B5NA 1L0NE 1ZRTD 1T3UA 3FWNA 5EW5E 2AXTH 3O6QA 5F2KA 3H32A 4KJMA 2OQQA 1QVGO 1L0LJ 1OIPA 1KQGB 2LL8A 1RO0A 1BCCD 2ITAA 5BS2A 5H2FE 1LWUB 1RH5B 3H1JJ 3FXDA 1L0NG 3HRNA 4ZKPA 1K73Q 5KAIH 2HR3A 2M8RA 2OYHA 4MN4C 4UB6E 5CJ4A 2IZ0A 2A06E 3G28A 2GZFA 2Z46A 3M9HA 1SQBJ 4TLFA 3BASA 3BRTB 1SP4A 3CWBE 2YMYA 1RQVA 1LWUA 2OYOA 3USSA 1YQ4C 3WMM0 1VQNP 1BE3J 3G9RA 1L2PA 1SQPK 4XROA 1Q7YQ 1S5LX 4R4MA 2QSIA 5CBOA 2HG5D 2N5IA 1OVRA 4XFYA 3GJNA 1UJZA 2NPSD 3CX5D 4I6MC 3G3ZA 2K37A 1Y47A 2QJKB 5B66E 3CWBG 2V4HA 1OW8A 4H2WC 3H1KG 2GUSA 2YIUB 1EZVE 5F2NA 1QL1A 5EJDA 1SQPD 2M8LA 1L4AA 3AE7C 2H8PD 1VQLP 4GKGA 2YIUC 4LGDE 4H13B 3CCRP 2KGAA 3RG6C 2FFDB 1T6AA 2CQ8A 1M7LA 1HBWA 4WY4D 4JYBA 2RMZA 1NKNA 1FR2A 4U0BA 4RESB 3Q2YA 2WSEH 1RF0A 1X9VA 1D7MA 2BCCE 2K93A 4XFXA
chains in the Genus database with same CATH topology
2KB7P 2QEXP 4C7NA 2FYUK 2R3CA 2WSCH 5AVQB 2JYGA 1QL2A 1RE4A 3NMDA 1XTCC 1QRJA 1H8AA 5AVRB 3SWYA 1E5WA 3N7NA 1FZCC 1HWTC 1M1JA 3Q20A 4JF7A 5HGMA 1YJWP 3V4WA 1JCCA 3G26A 1IK9A 3M91A 3A7OA 2WT7B 1YJNP 1D1DA 3M0DC 1JO5A 2QM8A 1FZAA 3HUSB 1JOCA 1IUQA 1JY3O 2R32A 5AW5B 3RL0D 1FDMA 5AVVB 5CCHA 3H0DA 4GR6A 2Q7CA 2Q3IA 3I56P 1N86A 3II6A 2N1TC 3B5IA 5APUA 3GHGB 3KQGA 5APVA 1N7SD 1LTJB 1ZV8A 3EFGA 4C46A 2XU6A 2YO2A 1NAFA 1VQKP 3HE5B 4IFFA 3RK2D 3KPEA 1DX7A 1NJIQ 1LWUC 2E42A 2EIAA 1HGZA 2EG5A 2O01H 1A43A 2PY8A 1AFOA 2OYIB 1RNIA 2L5GB 4M0IA 1JY2P 1NKZB 4B86A 2WT7A 1FJPA 3CCUP 4WB4A 3DS4A 1KD1Q 1JCDA 2PAJA 1IFMA 3E2DA 2W27A 3GHGA 1LTSC 1NU1K 1HGVA 1FAVA 5AW4B 1LTJA 1URQC 5CCGA 1L4AB 3LRYA 1W2EA 3HE5A 2PENA 1YTZT 3EQ2A 2NPSA 3CCVP 1NTKK 3G6EP 5HGNA 5AW7B 1FOSF 1Q86Q 4WY4C 1RF1A 2OYIA 3VRLC 2N1TD 1KQLA 5JPAA 2HPCA 1L4AC 2M8NA 2PEMA 4N3YB 4KHXA 2FYZA 2CPSA 2HFED 5AVTB 5AW3B 5BU5A 1JUNA 3T97A 4N6JA 2Z4EA 1MZ9A 2PP6A 3CXCO 1IFDA 4ZKUA 3UIAA 4W80A 3DPHA 2CPBA 2WWWA 5HGLA 1AQ5A 1FOSE 3U1CA 3G4SP 1X79B 3TK1A 3V2RA 1HTLC 2P2UA 1H89A 1SFCB 1GZLA 3KYQA 3HTKB 2LKMA 2C0XA 2CWOA 2KSJA 1URQD 2MJZA 1ZLLA 4AQRD 4C7NB 2WSFH 3LIEA 1SQVK 5KLVK 3B5NC 1G1JA 1JY3P 1LTIC 1VQOP 2HLOA 1FZEA 2BUOA 4Y99B 1M1JB 3I5CA 1GL2B 2YKPA 1KZUB 2YKOA 5AW6B 1L4AD 2FFDC 3A2AA 2ZFCA 4HYTB 2Z5IA 5APSA 5AVWB 2I1KA 1PFIA 1SFCA 3M0AA 1RY3A 5AVYB 4U0CA 2KOGA 4XRQA 1T2KD 3C9IA 1GW4A 3HD7C 1L0LK 4C7RA 1T3JA 1KQSO 4AYCA 3HTKA 2H7HA 5AW0B 1EQ7A 3P05A 5AVXB 1N73A 5CJ0A 1CI6A 3HE4B 1JY2N 3H6PA 3BVHA 2XKMA 1HUCA 2OYHC 1GL2A 2IPPA 1N7LA 1LGHB 1M74A 3I55P 3CPWO 2PEIA 1YITP 3CI9A 3OJAB 3DS3A 3R2PA 3H4EA 3DTJA 1M90Q 3B5ND 3DS0A 3DS2A 1CSBA 5CMZA 1N7SA 4JYCA 4COPA 2Q5UA 2WPSA 1J1DB 3KDPB 5APQA 5BVZA 3HUSC 3CCEP 3HE4A 3M9QA 2NPSB 2R5DA 1LTBC 3G71P 1Q81Q 5KJ7C 1HH0A 1RF1B 2J58A 3HD7D 3MD0A 1A02F 2FKWB 4I2LC 3GHGC 1LTJC 3L4FA 2HPCB 3P8CD 2LF4A 2OTJP 1GW3A 2WPQA 1FZCA 3TYYA 2QA4P 5CCHD 3RK3B 2OYIC 3G1IA 1G2CA 3A3YB 3TNUB 2C9NY 2A45I 1YYCA 2XNXA 1NO4A 3P8CE 1GK4A 2M3BA 3V2PA 2EFJA 3E1IA 3VOPA 1X8YA 2C0WA 3BATA 2KYVA 5DCKA 3MGNA 1KILB 2N1TA 3V2QA 5AVUB 3DS5A 1LTGC 3VP9A 1NWQA 3SWFA 1MV8A 4U0DA 1Z56A 3NXSA 1BAJA 1IC2A 3VTPC 3OA7A 3P7KA 2Z5HA 5APWA 1JY3N 1J1EB 1QVFO 2JJLA 1E6JP 2VRSA 2PEKA 2O1KA 5KJ7D 1NTMK 1T2KC 3PP5A 3CCLP 3TNUA 1NTZK 5AW1B 2P9XA 1WRGA 1OXZA 4W7ZA 2P1JA 5BS1A 1J2JB 1VQ6P 2WZ7A 1WT6A 1YIJP 1KFMA 1KILA 5APYA 1VQMP 3G0VA 3LW5H 4DZOA 4GR2A 4EOTA 2KLVA 3NTNA 4OH8B 1M6NA 1RE3A 4LC1A 4WYMA 1JNMA 1L0NK 2XV6A 2A45H 1N73B 1JY2O 4WY4A 1YHQP 1CI6B 1ZN5A 5AW9B 3VP8A 4XA4A 3HYBA 5I4TG 3CCSP 1SFCC 4QNBA 2FXMA 1ZR4A 1RF0C 1MUUA 2KODA 1JTHA 2JEEA 5AVSB 2GM4A 1SVFA 2JO0A 5KTBA 3RL0B 1RE4C 2YO3A 1GK6A 3M06A 3P8MC 1IFIA 1LTTC 2I1JA 2R5BA 1VQ4P 1LTAC 3VMZA 4Y99C 1N7SB 1M1JC 1FZFA 3N4XA 2JYLA 3M1MA 1GL2C 1VDFA 3RK2B 2DGYA 1CZQA 2HODB 1N2DC 3CC2P 3LIDA 1VQPP 3V5BA 2POHA 3H32B 2HYNA 4PH1A 2M8PA 1LT9A 1GTWA 3TSIA 3VN0A 3VMYA 1GU5A 3B8EB 1XTGB 5CCHC 4GT1A 2J59M 3M9BA 1MFZA 1M6EX 1FU1A 4WBAA 3G29A 2BASA 2XZRA 4U0AA 4AUWA 3CCJP 1GD2E 3B5NA 3CD6P 3VMXA 4DOJA 1FZCB 3H47A 3O8ZA 2XV5A 2WTYA 1SFCD 5F2OA 1VQ8P 1NHLA 1T3UA 1G1IA 3L35A 1VQ5P 1N8RQ 1KFNA 1G2CB 2KP8A 2FFDA 1RO2A 5AW8B 2HODA 4IPYA 1K9MQ 5F2KA 1SQBK 3H32A 5CHXA 2WPRA 1QVGO 1RO0A 4COCA 1VQ9P 2N1TB 3HD7A 2ZXEB 4LLHA 2PEOA 1M1KQ 1YI2P 1EIAA 1T8ZA 5BS2A 1GL2D 1LWUB 1FJKA 1SLQA 3CCMP 1J1DC 1DEBA 5CCGC 2IX7C 2P67A 1ZR2A 3HRNA 3MTUE 1NH4A 2NPSC 4ZKPA 1K73Q 2M8RA 2H43A 1YTZI 4O9BA 2OYHA 3IFMA 4IFDK 1FBMA 1Q82Q 1RF1C 1A02J 3U1AA 5CJ4A 3M0DA 3V4QA 5BU8B 4M3LA 2A45G 3P32A 5APXA 4W7YA 3G28A 2Z46A 3M9HA 3G21A 1IFNA 1S72P 3RK3C 3U59A 4I1LA 3BASA 3HZQA 1AUMA 3CCQP 1URQB 3MGEA 1SP4A 3BRTB 2IFNA 2C9LY 1KC8Q 2YMYA 3HUSA 1VQ7P 1W2BO 1LWUA 2XDJA 1NOHA 1CW5A 3OW2O 5KJ7A 3WMM0 1VQNP 4U0FA 4U0EA 4WY4B 1KILC 1GU4A 3V2NA 2ONTA 1SQPK 3L36A 4XROA 1Q7YQ 2IFMA 1JTHB 1SQXK 2HG5D 1RE3C 1J1EC 3CMAP 5CCGD 1GDTA 4XFYA 4EIJA 2NPSD 3BRVB 2O1JA 3IR9A 4I6MC 3G3ZA 2PEQA 1DH3A 3G1GA 3A5TA 1URQA 4PH0A 2XXMA 1IO4A 5APTA 2GUVA 2W6AA 1OWAA 2OARA 2L6EA 2P7JA 2GUSA 1LT9B 2E1MA 3CLQA 1HJBA 1K30A 1JMMA 5F2NA 4XE5B 1QL1A 3RK3D 4XFZA 3DS1A 2M8LA 1L4AA 2H8PD 1K8AQ 1VQLP 4GKGA 3NFQA 1LT9C 3B5NB 1N73C 2QM7A 4LGDE 2WITA 1KILD 1EOQA 5AW2B 2W6BA 4N78D 3CCRP 3RG6C 3VYIA 1H88A 2FFDB 4HH2A 2PEJA 3WBHA 2YNYA 3RL0C 2OTLP 1S9KD 5AVZB 1M7LA 2Q9IA 4GIFA 1YJ9P 2Z45A 1IFJA 4WY4D 1HBWA 3CC4P 2BHVA 1IJDB 4JYBA 2YKQA 3HD7B 1VPCA 4N78E 1JJ2O 3MIWA 1N7SC 3CL3D 3NTEA 1NKNA 3RK2C 3L37A 1FZGA 1HVVA 4U0BA 4RESB 2Z44A 1S9KE 1A8OA 1FZBA 3MUDA 2E43A 3CC7P 2WSEH 4IFMA 3CMEP 1RF0A 1ZMBA 1X9VA 3OAKA 5HGOA 2XT1A 2OYHB 4XFXA 1SQQK 2N9BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FYU K;  1SQV K;  2WSC H;  1SQP K;  5KLV K;  1NTM K;  3CLQ A;  1SQB K;  1NU1 K;  1NTZ K;  1SQX K;  3M9Q A;  2O01 H;  2J59 M;  1NTK K;  3LW5 H;  3HZQ A;  2WSE H;  3G3Z A;  1L0L K;  2LKM A;  1SQQ K;  2OAR A;  4IFD K;  1L0N K;  2WSF H; 
#chains in the Genus database with same CATH topology
 3AE2 C;  2FYU K;  2R3C A;  2WSC H;  5AVQ B;  1QL2 A;  1AYI A;  1XTC C;  1QRJ A;  1E5W A;  4JF7 A;  1YJW P;  3V4W A;  3G26 A;  1IK9 A;  2YXR B;  4DCK A;  2WT7 B;  1AV1 A;  3M0D C;  1JO5 A;  2LIU A;  2WSF J;  3HUS B;  1Q2N A;  3RL0 D;  3H0D A;  2Q3I A;  5APU A;  3GHG B;  1N7S D;  4C46 A;  3HE5 B;  4IFF A;  3KPE A;  3WU2 H;  2FYU D;  2G3A A;  4A7P A;  2O01 H;  1A43 A;  4GOE A;  2MF4 A;  2L91 A;  2AEJ A;  2L5G B;  2WT7 A;  2ZT9 D;  1LT1 A;  4H0L C;  5GTH H;  1JCD A;  4NPE A;  4UHP B;  3E2D A;  3GHG A;  1LTS C;  1NU1 K;  1HGV A;  3WUU A;  5CCG A;  3LRY A;  1W2E A;  3HE5 A;  3S1K A;  3PHL A;  4BRY A;  5HGN A;  1Z6M A;  3CXH E;  2HPC A;  5GTI E;  3JCU E;  2HFE D;  4CA3 A;  4N6J A;  2AXT E;  1MZ9 A;  1IFD A;  2FHS C;  3UIA A;  2FAD A;  2CPB A;  2K1A A;  3U1C A;  5CBN A;  1NU1 D;  1HTL C;  2P2U A;  1SQX D;  1K04 A;  1ZOY C;  4F37 A;  1PP9 J;  1NTK J;  1X0T A;  2RN0 A;  3HTK B;  5KAI E;  2CWO A;  2L4B A;  2JDI H;  3PH0 A;  1ZW0 A;  2L22 A;  2K2Q A;  2BEQ D;  1G1J A;  1JY3 P;  1LTI C;  1VQO P;  2BUO A;  1M1J B;  2RKL A;  4GOD A;  2YKO A;  2GDW A;  4TT3 H;  5AW6 B;  1L4A D;  3A2A A;  2JP3 A;  2BCC J;  2Z5I A;  1JEK A;  5APS A;  2PFX A;  3HD7 C;  4IL6 H;  4OGQ D;  2M5R A;  1T3J A;  1KQS O;  1BDC A;  3HTK A;  1R5L A;  1IMP A;  4EDF A;  2X2B A;  5AVX B;  5CJ0 A;  4JPZ B;  4D6T G;  3L75 E;  2XKM A;  2B87 B;  5KLV J;  2H89 C;  1M74 A;  2E74 B;  3SFE C;  3I55 P;  2PEI A;  2E5Y A;  3CI9 A;  1MKM A;  4ASV A;  3DS3 A;  4UB8 E;  1OW7 A;  3DS0 A;  2P58 A;  2IYO A;  3KDP B;  3BCC E;  5APQ A;  3ITK A;  3CCE P;  1ZRT E;  3K5B A;  2R5D A;  3G71 P;  1KN7 A;  2PNG A;  3AEB C;  5KJ7 C;  2KS1 B;  1RF1 B;  1A02 F;  4U3F G;  4I2L C;  2OTJ P;  1GW3 A;  2WPQ A;  4RO0 A;  3TYY A;  1HF9 A;  3L70 J;  5KKZ C;  3RK3 B;  4YXW H;  2OYI C;  4MRT C;  3A3Y B;  2E75 B;  2C9N Y;  2A45 I;  2D2C D;  2XNX A;  1NO4 A;  2M3B A;  2EFJ A;  3E1I A;  4BPF A;  3ABV C;  3MP7 B;  3MGN A;  1KIL B;  3DS5 A;  3NY7 B;  1LTG C;  1MZ8 A;  2DW3 A;  2K9J B;  1MV8 A;  3NXS A;  1BAJ A;  3VTP C;  1SQQ G;  3L74 G;  1JY3 N;  2B88 A;  1J1E B;  3KHU A;  1QVF O;  4PJ0 H;  1HQB A;  2JJL A;  2W6J H;  2KXP B;  1OXZ A;  3L71 D;  3MZW B;  1UNK A;  1YIJ P;  1KFM A;  2IBZ G;  1KIL A;  5APY A;  1KMI Z;  2DNW A;  2K9J A;  2LR2 A;  3Q5R A;  2FXO A;  2KLV A;  1Y8A A;  3NTN A;  2XV6 A;  3VP8 A;  1LNQ A;  3HYB A;  5I4T G;  3WU2 E;  2JEE A;  4H44 B;  2GM4 A;  2JO0 A;  1NAY A;  1NTM J;  2KOR A;  5KTB A;  2KGC A;  3P8M C;  1L0H A;  1FZF A;  3N4X A;  2DGY A;  2HOD B;  3H1I G;  3ZDM A;  3V5B A;  3L75 J;  3GZM A;  1FU1 A;  3JC2 2;  3Q3D A;  2UWJ E;  2XZR A;  1GD2 E;  1M56 D;  2W83 C;  1FZC B;  2SPZ A;  1NHL A;  4XFJ A;  2HOD A;  2KG6 A;  3GG2 A;  2Y0E A;  4COC A;  1VQ9 P;  2N1T B;  1FE6 A;  2ZXE B;  4LLH A;  2PEO A;  1M1K Q;  1YI2 P;  1EIA A;  1BCC J;  3H1H G;  1SLQ A;  3CCM P;  1DEB A;  2NPS C;  2H43 A;  3IFM A;  1E0H A;  1Q82 Q;  1IMQ A;  4HB1 A;  1LP1 B;  3V4Q A;  2WSE J;  1AF8 A;  3G21 A;  3U59 A;  4I1L A;  3HZQ A;  3MGE A;  1L0L G;  1BGY D;  2C9L Y;  1KC8 Q;  4DG9 A;  1NOH A;  1SQB E;  1QGK B;  3R4Y A;  4WY4 B;  1GU4 A;  3H1L G;  4DT0 A;  2CGQ A;  2IFM A;  5KLI C;  1JTH B;  3H1J G;  1PGQ A;  1RE3 C;  1LP1 A;  2Y9Y A;  3SFD C;  4EIJ A;  4R0M A;  1PGO A;  1QEX A;  3BRV B;  1U7J A;  4PV1 D;  2FXP A;  3IR9 A;  2PEQ A;  4Y28 J;  3G1G A;  3A5T A;  2XXM A;  1IO4 A;  2GUV A;  2QVA A;  1LT9 B;  2E1M A;  2O01 J;  1HJB A;  1JMM A;  3RK3 D;  3DS1 A;  2QJP C;  1SQP J;  2LXB A;  1BE3 G;  2M0B A;  2JU1 A;  2K9Y A;  1LT9 C;  3B5N B;  1RQU A;  1N73 C;  2JB0 A;  2K0X A;  1KIL D;  2WIT A;  1AJY A;  3S9O A;  2GZE A;  2JGP A;  3EJE A;  3F89 A;  1T8K A;  1SQX E;  3E7K A;  2YNY A;  3RL0 C;  3CX5 I;  2QJY B;  5AVZ B;  2Q9I A;  2Z45 A;  2K94 A;  1IFJ A;  2K92 A;  3B4S A;  4N78 E;  2NO8 A;  1N7S C;  3L37 A;  1FZG A;  1S9K E;  1P84 I;  1A8O A;  1FZB A;  3CC7 P;  3AE9 C;  3PRJ A;  5L8R J;  3OAK A;  1Q90 D;  2OYH B;  1SQQ K;  4PJ0 E;  2Y0D A;  2ZT9 C;  1RE4 A;  1NTZ G;  1KQF B;  1PPJ E;  1ZXG A;  3N7N A;  3Q20 A;  5HGM A;  1JCC A;  1YJN P;  1D1D A;  4H44 D;  2QM8 A;  1OZH A;  1IUQ A;  1JY3 O;  1FDM A;  3L73 D;  5CCH A;  2Q7C A;  1N86 A;  3B5I A;  4ZNC A;  3KQG A;  1LTJ B;  2XU6 A;  3L74 D;  1NAF A;  1DX7 A;  1NJI Q;  1LWU C;  2E42 A;  1LJ2 A;  1VF5 B;  2FYU J;  1AFO A;  1RNI A;  2KGE A;  2LIW A;  1NKZ B;  4B86 A;  1KD1 Q;  1IFM A;  4RJT A;  2L9F A;  5AW4 B;  1LTJ A;  4HJG H;  1L4A B;  1YTZ T;  3CCV P;  2JR8 A;  5AW7 B;  1Q86 Q;  2A06 G;  2N1T D;  1IK7 A;  2WPT A;  1KQL A;  1BDD A;  4OGQ B;  5JPA A;  4BWN A;  1L4A C;  4N3Y B;  2MR8 A;  2Y9Z A;  3T97 A;  2Z4E A;  1P84 D;  4ZKU A;  2QIW A;  2QJK C;  3H1I D;  1AQ5 A;  1X79 B;  3L72 D;  3TK1 A;  3V2R A;  2KUB A;  1NU1 J;  1ZME C;  1GXH A;  1SQX J;  3KYQ A;  3L71 E;  2W90 A;  2R3S A;  4U7J A;  2C0X A;  3H25 A;  5KP8 B;  2KSJ A;  1ZLL A;  4AQR D;  1OVU A;  1PP9 E;  3GKL C;  2JU2 A;  1NTK E;  1JMB A;  3TGU D;  4H13 C;  4Y99 B;  4JQ0 D;  3I5C A;  1EZV G;  5DJU B;  1GL2 B;  1KZU B;  1S5L H;  2FFD C;  1PFI A;  2YXQ B;  3M0A A;  1RY3 A;  5AVY B;  2LML A;  3KZI H;  1EXJ A;  1L0L K;  2O3J A;  3A0B H;  2KLU A;  2D2C B;  3CE7 A;  4AYC A;  2N6Y A;  2H7H A;  1EQ7 A;  2E76 D;  4PD4 D;  1EMV A;  3AE3 C;  3H6P A;  5DJT B;  1GL2 A;  2D2C C;  2IPP A;  2Q6Q A;  3OJA B;  1SQV E;  1M90 Q;  5KLV E;  4RKU J;  2Q1K A;  3B5N D;  1CSB A;  2WMM A;  3CX5 H;  2BCC G;  3IF4 A;  4JYC A;  2N50 A;  1J1D B;  1WMK A;  3HUS C;  2MD9 A;  2P10 A;  3AEA C;  4BRY B;  1X3O A;  1Q81 Q;  3H1L D;  1P84 H;  2J58 A;  3GHG C;  3L4F A;  2HPC B;  3P8C D;  2LF4 A;  2VSQ A;  2QA4 P;  5KLV G;  1NYH A;  5CCH D;  1G2C A;  4ZMD A;  1H0T B;  3L70 E;  3VOP A;  1X8Y A;  2C0W A;  2ZAE B;  3VP9 A;  1DD4 A;  1NWQ A;  3SWF A;  1PGJ A;  2AFE A;  2LOL A;  2VLP A;  2Q3E A;  2O1K A;  2ROQ A;  1T2K C;  1KYO D;  5EFW B;  3EJB A;  3D70 A;  1NTZ K;  5AW1 B;  1H0T A;  3L71 J;  5HVC A;  1J2J B;  1VQ6 P;  2WZ7 A;  1DNY A;  1VF5 D;  1VQM P;  3LW5 H;  1CEI A;  4EOT A;  4OH8 B;  3LMO A;  4LC1 A;  4WYM A;  1L0N K;  2L0Q A;  3MUD C;  1YQ3 C;  2FXM A;  4QNB A;  1DV5 A;  2KOD A;  2KSE A;  1HJ0 A;  2LPK A;  1AQT A;  1R5S A;  1NTZ D;  2MVV A;  1GK6 A;  1LTT C;  3FX0 A;  1NTM E;  1M1J C;  1R8E A;  2JYL A;  3RK2 B;  1CZQ A;  1AA0 A;  2B89 A;  5C39 A;  2POH A;  4PH1 A;  2M8P A;  1GTW A;  2KR5 A;  1PL5 A;  1L0N D;  3TSI A;  1HY8 A;  2J59 M;  1MFZ A;  1SQV J;  2KOS A;  3G29 A;  2GYK A;  4U0A A;  2JAZ A;  3CCJ P;  2GDX A;  1EC5 A;  3CD6 P;  3VMX A;  3O8Z A;  2MY5 A;  2XV5 A;  2B9B A;  2WTY A;  5F2O A;  3C8V A;  1NTM G;  1G1I A;  1UII A;  2ZJS E;  1VQ5 P;  1N8R Q;  2MKV A;  2E74 C;  1K9M Q;  5CHX A;  2WPR A;  1BSN A;  2NRG A;  3HD7 A;  3FWL A;  2JWD A;  4I7Z B;  4PV1 B;  3L75 G;  1GL2 D;  2G8Y A;  1ZP0 C;  2P67 A;  1ZR2 A;  1EXI A;  3MTU E;  1NH4 A;  1BCC E;  1YTZ I;  3EFF K;  4IFD K;  2WVR A;  1KB9 I;  1RF1 C;  1A02 J;  3U1A A;  3FGA D;  5BU8 B;  3CWB D;  4M3L A;  5APX A;  3BCC G;  1EDL A;  3H1K D;  1IFN A;  3RBZ A;  2FY8 A;  2W8Z A;  3RK3 C;  2RH0 A;  3QH9 A;  2E75 C;  1AUM A;  1URQ B;  4YTP C;  2KK7 A;  1VQ7 P;  1W2B O;  1BGY J;  2XDJ A;  3OW2 O;  1USE A;  3A0B E;  5KJ7 A;  4U0F A;  3KXD A;  1KIL C;  3L36 A;  2AVA A;  1J1E C;  3TF5 A;  5CCG D;  4JBZ A;  1GDT A;  1S2E A;  5TJH A;  1YBK A;  1QX8 A;  1EZV D;  3EJD A;  5CZD B;  2FBW C;  1URQ A;  2IYP A;  2FQ2 A;  5APT A;  2W6A A;  1OWA A;  2OAR A;  2L6E A;  1FC2 C;  3CX5 E;  3CLQ A;  1K30 A;  1BSH A;  1K8A Q;  3C1L A;  3AEG C;  2KW2 A;  1SQP E;  4BPG A;  4H44 C;  5HV8 A;  2AEF A;  5GTH E;  2OTL P;  1YJ9 P;  2BHV A;  2YKQ A;  3AE4 C;  4L76 A;  1KV4 A;  3CL3 D;  1S4X A;  1KB9 D;  3TGU E;  1ZNV A;  3D6Z A;  2E43 A;  4IFM A;  1ZMB A;  2LKI A;  5HGO A;  3AED C;  1SQP G;  2PRR A;  2GA1 A;  2N9B A;  4C7N A;  2FVA A;  1PV3 A;  4WWI A;  1H8A A;  5AVR B;  3SWY A;  4QMA A;  1FZC C;  4BXL A;  4R4L A;  1X22 A;  2OGU A;  3M91 A;  2KI7 B;  1IFP A;  2R32 A;  5AW5 B;  3II6 A;  3L73 J;  2N1T C;  4Z1M H;  2K88 A;  2M5A B;  3WUT A;  1ZV8 A;  3EFG A;  2ZVN B;  2YO2 A;  3AE1 C;  1VQK P;  3RK2 D;  3L74 J;  2EIA A;  1S3J A;  4M0I A;  2VLN A;  5KAF H;  1OVV A;  2FYU E;  2I8D A;  2K0Y A;  1FJP A;  3CCU P;  2JKV A;  3DS4 A;  4IL6 E;  2VLO A;  2M5A A;  2W27 A;  1FAV A;  1Y9B A;  3IAO A;  2KOQ A;  2NPS A;  2WSS H;  1FOS F;  4WY4 C;  1JB0 J;  3VRL C;  2FQ0 A;  4NPF X;  3B71 A;  2E76 B;  4KHX A;  2CPS A;  5AVT B;  1KB9 H;  5BU5 A;  1SQB G;  1FS0 E;  1QLE D;  2ZVO B;  2WWW A;  4W80 A;  1GPJ A;  5HGL A;  3G4S P;  2E76 C;  2IBZ I;  3L72 J;  1L0I A;  3AE8 C;  3F5H A;  1SFC B;  1GZL A;  4D6T D;  1NU1 E;  1URQ D;  3LIE A;  2H88 C;  3AE5 C;  3B5N C;  5E79 H;  3Q5S A;  2HLO A;  1FZE A;  3SWK A;  3TGU J;  2YKP A;  4NPD A;  4HYT B;  2N98 A;  3RG2 A;  3GZL A;  2NZ2 A;  2QJY C;  5AVW B;  1SFC A;  2KZJ A;  3IN6 A;  2KOG A;  4XRQ A;  3C9I A;  1ACP A;  3AE6 C;  2KG9 A;  4C7R A;  1GXG A;  1M57 D;  4U3F D;  1NU1 G;  5AW0 B;  2CNR A;  1SQX G;  1N73 A;  2FQ1 A;  1CI6 A;  2QE7 H;  2FYN B;  3LW5 J;  3BVH A;  4ASW A;  1HUC A;  2KNC B;  2OYH C;  3PJS K;  1N7L A;  1KLP A;  4CPG A;  3BCC D;  1S1C X;  3H4E A;  3DTJ A;  5GTI H;  3JCU H;  2FYN C;  1KTM A;  1N7S A;  4COP A;  1VL2 A;  2KZI A;  2Q5U A;  1FDO A;  2V7Q H;  2WPS A;  1SQQ D;  1NVO A;  5BVZ A;  3M9Q A;  1LTB C;  3W68 A;  1PPJ G;  3H1L J;  3MD0 A;  2FKW B;  2KNC A;  3FXE A;  4OVN F;  4PD4 I;  1LTJ C;  3PTZ A;  4PXH B;  2WPV B;  3A0H H;  1VF5 C;  3WUV A;  4DJG A;  2IBZ D;  3T97 B;  1YYC A;  3BAT A;  2M3E A;  2IDB A;  2KYV A;  5DCK A;  3V2Q A;  1U57 A;  1RHZ B;  3RGU A;  3P7K A;  2Z5H A;  5APW A;  3H1K E;  2OTK E;  2R44 A;  4L73 A;  2ZYA A;  3PP5 A;  2P9X A;  1WRG A;  4OGQ C;  2YMK A;  2GDY A;  1WT6 A;  1DD3 A;  4UB8 H;  4DZO A;  1EDK A;  3U43 A;  1PGP A;  4L74 A;  1JNM A;  4H2X C;  1JY2 O;  1YHQ P;  1ZN5 A;  5AW9 B;  4XA4 A;  3CCS P;  1RF0 C;  5AVS B;  1SVF A;  1NTZ J;  4BPH A;  2YO3 A;  3M06 A;  1IFI A;  5KAF E;  1KYO I;  1LTA C;  3VMZ A;  3AEE C;  4Y99 C;  4L75 A;  3L71 G;  1GL2 C;  1VDF A;  3H1H D;  1N2D C;  3CC2 P;  4IOI H;  4EYY Q;  1VQP P;  4YPC A;  2AFD A;  4GOF A;  4OWF A;  3VN0 A;  3VMY A;  2MVU A;  2CG5 B;  1PP9 G;  1L0N J;  1NTK G;  4WVZ A;  1XTG B;  4GT1 A;  4WBA A;  2QG4 A;  2BAS A;  4AUW A;  2QNW A;  4DOJ A;  3H47 A;  2J5U A;  3GLM A;  2GZI A;  1SFC D;  1VQ8 P;  3L35 A;  1KB9 E;  2FFD A;  1KFN A;  1G2C B;  2KP8 A;  1RO2 A;  5K5G B;  5AW8 B;  4GDO A;  2ZYG A;  4IPY A;  1L0L D;  1SQB K;  1DEE G;  5KP7 B;  3S4R A;  4YXD C;  1EDJ A;  1T8Z A;  4K3A A;  4PWV B;  2LXC B;  3H1J D;  1FJK A;  1J1D C;  5CCG C;  1BXI A;  2IX7 C;  1SQV G;  4O9B A;  1AVO A;  1IZN B;  1FBM A;  1GMJ A;  2GZG A;  3M0D A;  5E79 E;  4H0L B;  2A45 G;  1M8O B;  3P32 A;  3CWB J;  4W7Y A;  1SQB D;  4NEO A;  3H1K J;  1FDI A;  1S72 P;  2EHT A;  3CCQ P;  3D71 A;  2IFN A;  2K3R A;  3HUS A;  3SSU A;  1EDI A;  1BE3 D;  1CW5 A;  4U0E A;  3GF3 A;  3V2N A;  2ONT A;  1PIX A;  2ERH A;  3GMA A;  1BGY E;  5TIS H;  1SQX K;  3CMA P;  1OW6 A;  3L70 G;  4PD4 H;  4IL6 X;  2O1J A;  3VMA A;  1W5C E;  1DH3 A;  2Y0C A;  5B5E H;  4PH0 A;  2KGD A;  1OMI A;  5KP6 B;  2N9Y B;  2P7J A;  4XE5 B;  3V6I A;  4XFZ A;  1BGY G;  2BEZ F;  3NFQ A;  2KWL A;  2QM7 A;  2FAE A;  3RK3 E;  1EOQ A;  5AW2 B;  2W6B A;  4N78 D;  1H88 A;  3VYI A;  3A0H E;  4HH2 A;  2PEJ A;  3WBH A;  1S9K D;  2O01 N;  4H2Y C;  1KIL E;  4GIF A;  4D6T E;  1EZV I;  3CC4 P;  1IJD B;  3HD7 B;  3JSV C;  1VPC A;  3AEC C;  1JJ2 O;  3MIW A;  3NTE A;  1AVY A;  3RK2 C;  1VKU A;  1HVV A;  3GW6 A;  2Z44 A;  3MUD A;  3MHV A;  3B4Q A;  2AEM A;  3CME P;  1PPJ D;  2XT1 A;  2KB7 P;  2QEX P;  2JYG A;  2N6Z A;  2JWA A;  3NMD A;  1HWT C;  4KT0 J;  1M1J A;  1OR5 A;  4U3F E;  4QKO A;  3A7O A;  1KYO H;  1FZA A;  1JOC A;  2KG8 A;  5AVV B;  2EHS A;  4GR6 A;  4H13 D;  3I56 P;  2A06 D;  3GF7 A;  4I7Z C;  4IZ6 A;  4PV1 C;  5APV A;  2ZXX A;  2FVF A;  3L73 E;  3W67 A;  1HGZ A;  1VHN A;  2EG5 A;  2PY8 A;  5KKZ B;  2B87 A;  2ZYD A;  1S5L E;  2OYI B;  1JY2 P;  1SQQ E;  3L74 E;  4WB4 A;  3KZI E;  2PAJ A;  1BCC G;  2IZ1 A;  1UIX A;  2WQY C;  1URQ C;  2PEN A;  3EQ2 A;  5M1B A;  2IBZ E;  1NTK K;  4HKG A;  3L73 G;  3G6E P;  1F80 D;  2KS1 A;  1RF1 A;  2OYI A;  2V7Q J;  2M8N A;  2PEM A;  2FYZ A;  2JBG A;  5AW3 B;  1JUN A;  2PP6 A;  3CXC O;  2LTE A;  2XND H;  3EWK A;  3PLN A;  3DPH A;  1FOS E;  3D6Y A;  4H0L D;  1H89 A;  2AXC A;  5H2F H;  1P84 E;  1PP9 D;  1NTK D;  2XZ0 D;  3CXH I;  3H1I E;  1OX3 A;  4D6T J;  3L72 E;  2LKM A;  2GZJ A;  4C7N B;  2MJZ A;  2FAC A;  2WSF H;  1SQV K;  4UB6 H;  5KLV K;  3QWO C;  2BCC D;  2ZFC A;  1OFC X;  1MFT A;  1KOR A;  2I1K A;  2MR7 A;  4U0C A;  1T2K D;  1GW4 A;  3L72 G;  2KOP A;  2CK3 H;  4U3F J;  3Q5P A;  3P05 A;  2AF8 A;  3HE4 B;  1JY2 N;  5TIS E;  1SQV D;  5KLV D;  3H1H E;  2QRX A;  1LGH B;  4PD4 E;  3CPW O;  1YIT P;  5B66 H;  3R2P A;  3TGU G;  3BCC J;  5B5E E;  3DS2 A;  1NGM B;  5CMZ A;  2XZ1 C;  1JM0 A;  1SQQ J;  3HE4 A;  2NPS B;  2JQ4 A;  1HH0 A;  3HD7 D;  1L0L E;  4HKZ H;  3L70 D;  1FZC A;  3H1L E;  3G1I A;  3H1J E;  3TNU B;  1SS1 A;  3P8C E;  1GK4 A;  3CXH D;  3V2P A;  7CEI A;  2N1T A;  5AVU B;  2JO1 A;  4U0D A;  5KLI B;  1Z56 A;  4K35 A;  2PGD A;  2WSC J;  1IC2 A;  3OA7 A;  2E74 D;  2FVE A;  2FYU G;  2E5T A;  1E6J P;  2VRS A;  3E1R A;  2PEK A;  5KJ7 D;  1NTM K;  3CCL P;  3TNU A;  3RBX A;  4W7Z A;  1BE3 E;  2P1J A;  5BS1 A;  3RL0 g;  2N5H A;  3H1I J;  2K0D X;  1USD A;  3G0V A;  3TDK A;  1KYO E;  4GR2 A;  2QJP B;  1M6N A;  1RE3 A;  3AEF C;  2A45 H;  1N73 B;  4WY4 A;  1CI6 B;  1SFC C;  1K05 A;  2KOO A;  1ZR4 A;  1PZQ A;  1MUU A;  2E75 D;  1JTH A;  1NTM D;  3RL0 B;  1RE4 C;  2I1J A;  2R5B A;  1VQ4 P;  3Q1M A;  1N7S B;  1TU3 F;  3M1M A;  1NTZ E;  3L75 D;  3LID A;  3O6Q B;  3H1H J;  3H32 B;  1U7M A;  2HYN A;  1E79 H;  2VLQ A;  1LT9 A;  2KIK A;  1GU5 A;  3B8E B;  5CCH C;  2K5X A;  1DIP A;  4EI2 A;  1NQ4 A;  3M9B A;  1M6E X;  2ZT9 B;  3CXH H;  3B5N A;  1L0N E;  1ZRT D;  1T3U A;  3FWN A;  5EW5 E;  2AXT H;  3O6Q A;  5F2K A;  3H32 A;  4KJM A;  2OQQ A;  1QVG O;  1L0L J;  1OIP A;  1KQG B;  2LL8 A;  1RO0 A;  1BCC D;  2ITA A;  5BS2 A;  5H2F E;  1LWU B;  1RH5 B;  3H1J J;  3FXD A;  1L0N G;  3HRN A;  4ZKP A;  1K73 Q;  5KAI H;  2HR3 A;  2M8R A;  2OYH A;  4MN4 C;  4UB6 E;  5CJ4 A;  2IZ0 A;  2A06 E;  3G28 A;  2GZF A;  2Z46 A;  3M9H A;  1SQB J;  4TLF A;  3BAS A;  3BRT B;  1SP4 A;  3CWB E;  2YMY A;  1RQV A;  1LWU A;  2OYO A;  3USS A;  1YQ4 C;  3WMM 0;  1VQN P;  1BE3 J;  3G9R A;  1L2P A;  1SQP K;  4XRO A;  1Q7Y Q;  1S5L X;  4R4M A;  2QSI A;  5CBO A;  2HG5 D;  2N5I A;  1OVR A;  4XFY A;  3GJN A;  1UJZ A;  2NPS D;  3CX5 D;  4I6M C;  3G3Z A;  2K37 A;  1Y47 A;  2QJK B;  5B66 E;  3CWB G;  2V4H A;  1OW8 A;  4H2W C;  3H1K G;  2GUS A;  2YIU B;  1EZV E;  5F2N A;  1QL1 A;  5EJD A;  1SQP D;  2M8L A;  1L4A A;  3AE7 C;  2H8P D;  1VQL P;  4GKG A;  2YIU C;  4LGD E;  4H13 B;  3CCR P;  2KGA A;  3RG6 C;  2FFD B;  1T6A A;  2CQ8 A;  1M7L A;  1HBW A;  4WY4 D;  4JYB A;  2RMZ A;  1NKN A;  1FR2 A;  4U0B A;  4RES B;  3Q2Y A;  2WSE H;  1RF0 A;  1X9V A;  1D7M A;  2BCC E;  2K93 A;  4XFX A; 
#chains in the Genus database with same CATH homology
 2KB7 P;  2QEX P;  4C7N A;  2FYU K;  2R3C A;  2WSC H;  5AVQ B;  2JYG A;  1QL2 A;  1RE4 A;  3NMD A;  1XTC C;  1QRJ A;  1H8A A;  5AVR B;  3SWY A;  1E5W A;  3N7N A;  1FZC C;  1HWT C;  1M1J A;  3Q20 A;  4JF7 A;  5HGM A;  1YJW P;  3V4W A;  1JCC A;  3G26 A;  1IK9 A;  3M91 A;  3A7O A;  2WT7 B;  1YJN P;  1D1D A;  3M0D C;  1JO5 A;  2QM8 A;  1FZA A;  3HUS B;  1JOC A;  1IUQ A;  1JY3 O;  2R32 A;  5AW5 B;  3RL0 D;  1FDM A;  5AVV B;  5CCH A;  3H0D A;  4GR6 A;  2Q7C A;  2Q3I A;  3I56 P;  1N86 A;  3II6 A;  2N1T C;  3B5I A;  5APU A;  3GHG B;  3KQG A;  5APV A;  1N7S D;  1LTJ B;  1ZV8 A;  3EFG A;  4C46 A;  2XU6 A;  2YO2 A;  1NAF A;  1VQK P;  3HE5 B;  4IFF A;  3RK2 D;  3KPE A;  1DX7 A;  1NJI Q;  1LWU C;  2E42 A;  2EIA A;  1HGZ A;  2EG5 A;  2O01 H;  1A43 A;  2PY8 A;  1AFO A;  2OYI B;  1RNI A;  2L5G B;  4M0I A;  1JY2 P;  1NKZ B;  4B86 A;  2WT7 A;  1FJP A;  3CCU P;  4WB4 A;  3DS4 A;  1KD1 Q;  1JCD A;  2PAJ A;  1IFM A;  3E2D A;  2W27 A;  3GHG A;  1LTS C;  1NU1 K;  1HGV A;  1FAV A;  5AW4 B;  1LTJ A;  1URQ C;  5CCG A;  1L4A B;  3LRY A;  1W2E A;  3HE5 A;  2PEN A;  1YTZ T;  3EQ2 A;  2NPS A;  3CCV P;  1NTK K;  3G6E P;  5HGN A;  5AW7 B;  1FOS F;  1Q86 Q;  4WY4 C;  1RF1 A;  2OYI A;  3VRL C;  2N1T D;  1KQL A;  5JPA A;  2HPC A;  1L4A C;  2M8N A;  2PEM A;  4N3Y B;  4KHX A;  2FYZ A;  2CPS A;  2HFE D;  5AVT B;  5AW3 B;  5BU5 A;  1JUN A;  3T97 A;  4N6J A;  2Z4E A;  1MZ9 A;  2PP6 A;  3CXC O;  1IFD A;  4ZKU A;  3UIA A;  4W80 A;  3DPH A;  2CPB A;  2WWW A;  5HGL A;  1AQ5 A;  1FOS E;  3U1C A;  3G4S P;  1X79 B;  3TK1 A;  3V2R A;  1HTL C;  2P2U A;  1H89 A;  1SFC B;  1GZL A;  3KYQ A;  3HTK B;  2LKM A;  2C0X A;  2CWO A;  2KSJ A;  1URQ D;  2MJZ A;  1ZLL A;  4AQR D;  4C7N B;  2WSF H;  3LIE A;  1SQV K;  5KLV K;  3B5N C;  1G1J A;  1JY3 P;  1LTI C;  1VQO P;  2HLO A;  1FZE A;  2BUO A;  4Y99 B;  1M1J B;  3I5C A;  1GL2 B;  2YKP A;  1KZU B;  2YKO A;  5AW6 B;  1L4A D;  2FFD C;  3A2A A;  2ZFC A;  4HYT B;  2Z5I A;  5APS A;  5AVW B;  2I1K A;  1PFI A;  1SFC A;  3M0A A;  1RY3 A;  5AVY B;  4U0C A;  2KOG A;  4XRQ A;  1T2K D;  3C9I A;  1GW4 A;  3HD7 C;  1L0L K;  4C7R A;  1T3J A;  1KQS O;  4AYC A;  3HTK A;  2H7H A;  5AW0 B;  1EQ7 A;  3P05 A;  5AVX B;  1N73 A;  5CJ0 A;  1CI6 A;  3HE4 B;  1JY2 N;  3H6P A;  3BVH A;  2XKM A;  1HUC A;  2OYH C;  1GL2 A;  2IPP A;  1N7L A;  1LGH B;  1M74 A;  3I55 P;  3CPW O;  2PEI A;  1YIT P;  3CI9 A;  3OJA B;  3DS3 A;  3R2P A;  3H4E A;  3DTJ A;  1M90 Q;  3B5N D;  3DS0 A;  3DS2 A;  1CSB A;  5CMZ A;  1N7S A;  4JYC A;  4COP A;  2Q5U A;  2WPS A;  1J1D B;  3KDP B;  5APQ A;  5BVZ A;  3HUS C;  3CCE P;  3HE4 A;  3M9Q A;  2NPS B;  2R5D A;  1LTB C;  3G71 P;  1Q81 Q;  5KJ7 C;  1HH0 A;  1RF1 B;  2J58 A;  3HD7 D;  3MD0 A;  1A02 F;  2FKW B;  4I2L C;  3GHG C;  1LTJ C;  3L4F A;  2HPC B;  3P8C D;  2LF4 A;  2OTJ P;  1GW3 A;  2WPQ A;  1FZC A;  3TYY A;  2QA4 P;  5CCH D;  3RK3 B;  2OYI C;  3G1I A;  1G2C A;  3A3Y B;  3TNU B;  2C9N Y;  2A45 I;  1YYC A;  2XNX A;  1NO4 A;  3P8C E;  1GK4 A;  2M3B A;  3V2P A;  2EFJ A;  3E1I A;  3VOP A;  1X8Y A;  2C0W A;  3BAT A;  2KYV A;  5DCK A;  3MGN A;  1KIL B;  2N1T A;  3V2Q A;  5AVU B;  3DS5 A;  1LTG C;  3VP9 A;  1NWQ A;  3SWF A;  1MV8 A;  4U0D A;  1Z56 A;  3NXS A;  1BAJ A;  1IC2 A;  3VTP C;  3OA7 A;  3P7K A;  2Z5H A;  5APW A;  1JY3 N;  1J1E B;  1QVF O;  2JJL A;  1E6J P;  2VRS A;  2PEK A;  2O1K A;  5KJ7 D;  1NTM K;  1T2K C;  3PP5 A;  3CCL P;  3TNU A;  1NTZ K;  5AW1 B;  2P9X A;  1WRG A;  1OXZ A;  4W7Z A;  2P1J A;  5BS1 A;  1J2J B;  1VQ6 P;  2WZ7 A;  1WT6 A;  1YIJ P;  1KFM A;  1KIL A;  5APY A;  1VQM P;  3G0V A;  3LW5 H;  4DZO A;  4GR2 A;  4EOT A;  2KLV A;  3NTN A;  4OH8 B;  1M6N A;  1RE3 A;  4LC1 A;  4WYM A;  1JNM A;  1L0N K;  2XV6 A;  2A45 H;  1N73 B;  1JY2 O;  4WY4 A;  1YHQ P;  1CI6 B;  1ZN5 A;  5AW9 B;  3VP8 A;  4XA4 A;  3HYB A;  5I4T G;  3CCS P;  1SFC C;  4QNB A;  2FXM A;  1ZR4 A;  1RF0 C;  1MUU A;  2KOD A;  1JTH A;  2JEE A;  5AVS B;  2GM4 A;  1SVF A;  2JO0 A;  5KTB A;  3RL0 B;  1RE4 C;  2YO3 A;  1GK6 A;  3M06 A;  3P8M C;  1IFI A;  1LTT C;  2I1J A;  2R5B A;  1VQ4 P;  1LTA C;  3VMZ A;  4Y99 C;  1N7S B;  1M1J C;  1FZF A;  3N4X A;  2JYL A;  3M1M A;  1GL2 C;  1VDF A;  3RK2 B;  2DGY A;  1CZQ A;  2HOD B;  1N2D C;  3CC2 P;  3LID A;  1VQP P;  3V5B A;  2POH A;  3H32 B;  2HYN A;  4PH1 A;  2M8P A;  1LT9 A;  1GTW A;  3TSI A;  3VN0 A;  3VMY A;  1GU5 A;  3B8E B;  1XTG B;  5CCH C;  4GT1 A;  2J59 M;  3M9B A;  1MFZ A;  1M6E X;  1FU1 A;  4WBA A;  3G29 A;  2BAS A;  2XZR A;  4U0A A;  4AUW A;  3CCJ P;  1GD2 E;  3B5N A;  3CD6 P;  3VMX A;  4DOJ A;  1FZC B;  3H47 A;  3O8Z A;  2XV5 A;  2WTY A;  1SFC D;  5F2O A;  1VQ8 P;  1NHL A;  1T3U A;  1G1I A;  3L35 A;  1VQ5 P;  1N8R Q;  1KFN A;  1G2C B;  2KP8 A;  2FFD A;  1RO2 A;  5AW8 B;  2HOD A;  4IPY A;  1K9M Q;  5F2K A;  1SQB K;  3H32 A;  5CHX A;  2WPR A;  1QVG O;  1RO0 A;  4COC A;  1VQ9 P;  2N1T B;  3HD7 A;  2ZXE B;  4LLH A;  2PEO A;  1M1K Q;  1YI2 P;  1EIA A;  1T8Z A;  5BS2 A;  1GL2 D;  1LWU B;  1FJK A;  1SLQ A;  3CCM P;  1J1D C;  1DEB A;  5CCG C;  2IX7 C;  2P67 A;  1ZR2 A;  3HRN A;  3MTU E;  1NH4 A;  2NPS C;  4ZKP A;  1K73 Q;  2M8R A;  2H43 A;  1YTZ I;  4O9B A;  2OYH A;  3IFM A;  4IFD K;  1FBM A;  1Q82 Q;  1RF1 C;  1A02 J;  3U1A A;  5CJ4 A;  3M0D A;  3V4Q A;  5BU8 B;  4M3L A;  2A45 G;  3P32 A;  5APX A;  4W7Y A;  3G28 A;  2Z46 A;  3M9H A;  3G21 A;  1IFN A;  1S72 P;  3RK3 C;  3U59 A;  4I1L A;  3BAS A;  3HZQ A;  1AUM A;  3CCQ P;  1URQ B;  3MGE A;  1SP4 A;  3BRT B;  2IFN A;  2C9L Y;  1KC8 Q;  2YMY A;  3HUS A;  1VQ7 P;  1W2B O;  1LWU A;  2XDJ A;  1NOH A;  1CW5 A;  3OW2 O;  5KJ7 A;  3WMM 0;  1VQN P;  4U0F A;  4U0E A;  4WY4 B;  1KIL C;  1GU4 A;  3V2N A;  2ONT A;  1SQP K;  3L36 A;  4XRO A;  1Q7Y Q;  2IFM A;  1JTH B;  1SQX K;  2HG5 D;  1RE3 C;  1J1E C;  3CMA P;  5CCG D;  1GDT A;  4XFY A;  4EIJ A;  2NPS D;  3BRV B;  2O1J A;  3IR9 A;  4I6M C;  3G3Z A;  2PEQ A;  1DH3 A;  3G1G A;  3A5T A;  1URQ A;  4PH0 A;  2XXM A;  1IO4 A;  5APT A;  2GUV A;  2W6A A;  1OWA A;  2OAR A;  2L6E A;  2P7J A;  2GUS A;  1LT9 B;  2E1M A;  3CLQ A;  1HJB A;  1K30 A;  1JMM A;  5F2N A;  4XE5 B;  1QL1 A;  3RK3 D;  4XFZ A;  3DS1 A;  2M8L A;  1L4A A;  2H8P D;  1K8A Q;  1VQL P;  4GKG A;  3NFQ A;  1LT9 C;  3B5N B;  1N73 C;  2QM7 A;  4LGD E;  2WIT A;  1KIL D;  1EOQ A;  5AW2 B;  2W6B A;  4N78 D;  3CCR P;  3RG6 C;  3VYI A;  1H88 A;  2FFD B;  4HH2 A;  2PEJ A;  3WBH A;  2YNY A;  3RL0 C;  2OTL P;  1S9K D;  5AVZ B;  1M7L A;  2Q9I A;  4GIF A;  1YJ9 P;  2Z45 A;  1IFJ A;  4WY4 D;  1HBW A;  3CC4 P;  2BHV A;  1IJD B;  4JYB A;  2YKQ A;  3HD7 B;  1VPC A;  4N78 E;  1JJ2 O;  3MIW A;  1N7S C;  3CL3 D;  3NTE A;  1NKN A;  3RK2 C;  3L37 A;  1FZG A;  1HVV A;  4U0B A;  4RES B;  2Z44 A;  1S9K E;  1A8O A;  1FZB A;  3MUD A;  2E43 A;  3CC7 P;  2WSE H;  4IFM A;  3CME P;  1RF0 A;  1ZMB A;  1X9V A;  3OAK A;  5HGO A;  2XT1 A;  2OYH B;  4XFX A;  1SQQ K;  2N9B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...