2OARA

Mechanosensitive channel of large conductance (mscl)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
125
structure length
125
Chain Sequence
MLKGFKEFLARGNIVDLAVAVVIGTAFTALVTKFTDSIITPLINRIGVNAQSDVGILRIGIGGGQTIDLNVLLSAAINFFLIAFAVYFLVVLPYNTLRKKGEVEQPGDTQVVLLTEIRDLLAQTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Large-conductance mechanosensitive channel
publication title Structures of the Prokaryotic Mechanosensitive Channels MscL and MscS
pubmed rcsb
source organism Mycobacterium tuberculosis h37ra
molecule tags Membrane protein
total genus 42
structure length 125
sequence length 125
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2006-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01741 MscL Large-conductance mechanosensitive channel, MscL
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.120 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2oarA01
1.20.5.220 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2oarA02
2J59M 1SQQK 2WSEH 1L0NK 2O01H 3M9QA 2WSFH 2OARA 3LW5H 2FYUK 1SQVK 3G3ZA 1NTMK 1SQXK 1SQBK 1NU1K 2LKMA 4IFDK 1L0LK 5KLVK 1NTKK 3HZQA 3CLQA 1SQPK 2WSCH 1NTZK
chains in the Genus database with same CATH superfamily
2PY8A 2NPSB 1NU1G 3MP7B 1P84H 1IUQA 2FYUJ 3E1RA 2O1JA 1S5LE 1KQGB 2AXTE 3BRTB 2G3AA 1NTME 2E75D 2W8ZA 1H88A 4L74A 1K8AQ 5APVA 2WSFJ 1SQQK 2E1MA 1EMVA 1LTBC 3WU2H 3GZMA 1KD1Q 1GL2A 4H0LC 1HGVA 3CXHH 4IFDK 3FWLA 2IYOA 2E74D 2OYHB 3CPWO 1SVFA 1A02J 2P9XA 2N1TA 2GZGA 1RE3C 2OARA 4QNBA 4U0BA 1L0HA 2WZ7A 2LPKA 4H13C 1KYOH 1OVRA 1SQPD 3HRNA 4WWIA 4H44C 5AVTB 1YYCA 4BRYB 1E5WA 5KLVK 2N50A 1RF1C 3B4SA 1CI6A 5HGMA 3CCLP 4F37A 3L73G 5B5EE 1OXZA 1L0NE 1QL1A 4JYCA 1YTZT 3V6IA 2E42A 2MJZA 3PP5A 2JU2A 2FVEA 4EIJA 5KP8B 4U0AA 3Q2YA 3G71P 3P8MC 1IK9A 4PV1C 3H1LG 2BHVA 3F5HA 3TGUE 2QSIA 3WUUA 5CCGA 2C0XA 1M7LA 2P58A 1K73Q 3KZIE 2M3EA 4COCA 2AXCA 3R4YA 3E2DA 2A06D 2J59M 3V2QA 2M0BA 3VMXA 2YO2A 4IFMA 2EHSA 5DCKA 1MZ8A 1IFNA 1JY2N 2AVAA 2WTYA 3EQ2A 2KXPB 3WUVA 1JNMA 3L74J 1JCDA 5F2OA 1J1DC 1VQ6P 4UHPB 3OW2O 2N9BA 2YKOA 3MGNA 4JF7A 3H1JJ 2FYUE 1VQ4P 2PP6A 1VQMP 5KKZC 3L75G 2DNWA 4B86A 1RF0C 4HH2A 2K37A 1QVFO 3MIWA 5E79H 3AEDC 4BXLA 2M5RA 2B87B 2ITAA 4Z1MH 1GPJA 2K92A 3VTPC 1OW6A 1Q2NA 3CCUP 5AVXB 3CC7P 1HY8A 5CCHD 2QNWA 2WPSA 2CQ8A 1G2CB 1RO0A 3H1KD 2FYNC 2HLOA 1A8OA 2Z5IA 1T3UA 3KHUA 3RK3E 1MZ9A 3C9IA 3O6QA 3LIDA 1ZLLA 3CMEP 1GMJA 1AYIA 2KG9A 2ZXEB 2Y9ZA 1GL2B 2C0WA 2AFDA 2CPSA 3AEAC 3P05A 4LGDE 1QL2A 1QRJA 2JWDA 1VL2A 3O8ZA 3JCUE 5KLIB 1L0NK 3HUSB 2N1TB 1W2EA 1EDLA 3IFMA 1L4AB 5AVUB 1IMQA 3RK2B 2JWAA 4DOJA 1LTJA 1LT9C 3CC2P 2OTJP 3PJSK 2ZYGA 2ZVOB 4KT0J 5EW5E 4OGQB 4UB6E 1QVGO 4D6TG 2KOQA 2MY5A 2QEXP 1SQPK 1VKUA 1A02F 5AVWB 4W7YA 2OYIA 2JYLA 5KJ7A 1MKMA 1SQQJ 2XKMA 2KW2A 2KOSA 3L73J 1YTZI 3L74D 1K9MQ 4M0IA 4OVNF 1M1JC 5AW4B 2P67A 4ZNCA 2L22A 3VOPA 3GF3A 1AA0A 4IFFA 4PD4H 4WY4C 1KILB 1SQPG 4RJTA 1VF5C 4BPHA 3CCVP 2YIUC 2H8PD 3CC4P 1P84D 3D6ZA 1JMMA 2PNGA 2IBZD 3H1LJ 4DCKA 2VRSA 3AEBC 2O01H 1ZRTD 2QJKB 3L74E 3HTKA 3MHVA 2CPBA 1NU1D 1L2PA 1PPJD 2FYUK 2Z46A 1ZNVA 2GM4A 5KAIH 4R4MA 4GODA 3CWBD 3RG2A 1GD2E 1X3OA 3H1JE 1Q7YQ 1SFCC 1MUUA 1T8ZA 3CXHD 2XDJA 2XT1A 1L0LG 2C9LY 3S4RA 3RL0C 1JTHA 2GZEA 2O01N 4PJ0H 3D71A 2YKQA 3TDKA 2ZYAA 2GUVA 1KYOD 2FFDB 2M8LA 2A06G 3QWOC 2WQYC 4ZKPA 1GU5A 1LJ2A 2GUSA 4I1LA 3DS1A 3L75J 3LIEA 1H8AA 1NO4A 2E76D 4HKGA 1T2KD 1GL2D 1NOHA 3BATA 1N7SB 4JPZB 1HBWA 2JGPA 4L73A 2PEMA 1GU4A 3VMYA 1T6AA 1ZXGA 2L5GB 1RE3A 1Q82Q 4KHXA 1YQ4C 2N1TD 2YNYA 1ZP0C 1L4AD 4U3FD 1SQVD 2FACA 3EJBA 4XRQA 3KDPB 1Q90D 1X9VA 1LTAC 1UNKA 1U7MA 1RF1A 3U1AA 4EI2A 5TISH 4EYYQ 4OGQD 3DTJA 3L72D 4H2WC 2KS1B 1N73C 1WT6A 3HZQA 2E75B 2KODA 2W90A 1KQLA 2W6JH 2ZVNB 2Q6QA 2QJYC 4GR2A 2EIAA 1SQQE 1FOSE 2PEIA 4N78D 3G28A 2KOGA 2XZ1C 5JPAA 1D7MA 1FDIA 1DX7A 2CGQA 2FVAA 1MFTA 2KI7B 3L73E 3H1KG 2KZJA 2OYIB 2R3CA 3PH0A 1KLPA 1FZAA 1YBKA 1FR2A 2BASA 1G1JA 3V4QA 2E43A 2K94A 2XZRA 1KILD 2R5BA 1LGHB 3P7KA 3M0AA 1FDMA 3MUDC 3NXSA 3OA7A 1U7JA 4R0MA 1KB9H 1BSHA 3W68A 4XFJA 2KGAA 1K30A 1FOSF 3H1LE 1FBMA 3L70D 1ZMBA 4IL6H 4I7ZC 5M1BA 3G1IA 5HGLA 3KQGA 4HKZH 1LWUB 2LKIA 1KILE 2O01J 1SQPJ 3RBZA 1T8KA 2JBGA 2IYPA 3HTKB 2XNXA 3T97B 4YXDC 2KG6A 1DV5A 1ZW0A 3G0VA 4MN4C 1RF0A 4EOTA 2JQ4A 1NU1K 4BWNA 2YO3A 1PGPA 1FU1A 5APUA 1IMPA 1IZNB 3VN0A 1QGKB 2N9YB 2JB0A 3RGUA 3V5BA 2W6AA 2LR2A 2WSSH 1S9KD 3A7OA 2VLOA 5AW9B 3L75E 2JR8A 1N7SD 1JTHB 1PGQA 2IX7C 4WBAA 1L0LJ 2IBZG 2KOOA 4Y28J 1S2EA 4WYMA 1NAFA 2BEQD 1LP1A 4H0LB 1PPJG 2VLNA 3Q20A 5KAFE 1KC8Q 5CZDB 1NTKD 3GHGC 3CWBG 3Q1MA 1PZQA 2BUOA 3USSA 1M56D 3UIAA 2KGEA 4Y99C 4D6TD 2K9YA 1LT9A 1M1KQ 4H13B 2PEOA 3LW5J 7CEIA 1BDDA 3M9HA 2PGDA 2WT7B 1SQVK 3P8CE 2GDWA 1P84I 2R5DA 5H2FE 3SSUA 1JY2O 2OGUA 2MVVA 2IBZI 1JUNA 1URQC 4PD4D 3A0BE 5AVRB 2CNRA 1NGMB 1SLQA 4PWVB 1HVVA 1AJYA 3M0DC 4RKUJ 2JYGA 1HWTC 4D6TE 3A3YB 1KORA 3GG2A 3H32A 2NPSC 1NAYA 2MF4A 1PV3A 2LXCB 5K5GB 3B5NC 3CXHI 4WY4A 4U3FG 1SQVG 3L4FA 4XFXA 3AEEC 1J2JB 3RK3C 4ZMDA 2N6ZA 3M9QA 1IFJA 3H1KJ 1IFDA 3L72G 3F89A 2D2CC 4GOFA 2OQQA 1NH4A 5HV8A 2V7QH 1KYOI 4BPGA 4U0EA 2H7HA 1VQ7P 1YJ9P 1SQPE 5CCHC 3TNUA 3RG6C 5KAIE 1QEXA 2KGCA 3C8VA 3VRLC 2ZT9C 1L0LD 1SFCA 1FE6A 4GDOA 1CSBA 1BE3D 5CBOA 3DS5A 1J1DB 2Z4EA 4NPDA 4DG9A 3CXCO 3H25A 3FWNA 4HJGH 5EJDA 1JJ2O 2RH0A 5AVSB 1H0TA 2FADA 1ZR4A 2MVUA 3DPHA 3AE2C 2KB7P 5KKZB 1WMKA 1X22A 1E0HA 3U43A 1OR5A 3NTNA 1BAJA 1L0LE 1HUCA 3BRVB 2YXQB 2R3SA 4H0LD 2FQ2A 3L70G 1BDCA 1VPCA 2I8DA 1BSNA 2Y0EA 1OWAA 2A06E 3DS0A 2QJPB 1NTZD 2M3BA 2P10A 3V2NA 2CK3H 4ASWA 1XTCC 3AE7C 1NWQA 3H1HD 2IFNA 4H13D 4H44D 4HB1A 3HD7C 2JJLA 1N73A 1YJNP 5AW0B 1M90Q 2LXBA 3H1ID 3FX0A 1NU1J 2FXMA 5BS2A 1N8RQ 1KN7A 2ROQA 1PP9D 3CWBJ 1GZLA 1LT9B 1IFIA 1GXHA 2W83C 3CE7A 1OZHA 3Q3DA 1KB9D 2QM8A 4O9BA 1FZEA 5GTIH 2E76B 5F2KA 3WUTA 2L0QA 3CCEP 2NZ2A 2XU6A 4H2YC 2L4BA 3TYYA 4XFZA 4TT3H 2BCCD 4PV1D 1NTMG 1SQXG 2RMZA 3Q5PA 1L0IA 2QIWA 3BCCD 3MUDA 4QMAA 3GW6A 1SQBD 3DS2A 1NTKG 3H32B 3EFGA 3HE4A 2EFJA 2LL8A 3H6PA 1S5LH 3H1KE 3SWFA 2XV5A 1KB9E 4RESB 3CI9A 3Q5RA 1CI6B 1SS1A 1VF5B 1EDKA 4AQRD 5HGNA 2YIUB 3MD0A 1VQNP 5HGOA 1USDA 2V7QJ 5KP7B 2W27A 4U3FJ 1SQVJ 3CCQP 5AVVB 3VMZA 1YIJP 3PRJA 3AE5C 1EXJA 3L72J 4U0DA 1GL2C 1DNYA 2WPRA 2IDBA 3TNUB 2O3JA 1EIAA 5GTHH 1S72P 1FS0E 2L91A 1FC2C 5KLIC 3HUSC 2IPPA 3AEGC 1IFMA 1L4AC 4AYCA 3D70A 2ERHA 3RK2C 5L8RJ 2HODA 1L0LK 2KG8A 5HVCA 2QA4P 2FBWC 2Z45A 3VYIA 2C9NY 2OTKE 4C7RA 4PXHB 1H0TB 3C1LA 5CJ4A 5CJ0A 2X2BA 1BGYD 5B5EH 1KZUB 4XROA 4PD4I 4QKOA 2Q3IA 2WPTA 1BCCD 5BVZA 2VLPA 4LLHA 1Q86Q 1J1EB 2I1JA 2MR7A 1KQSO 3OAKA 1M74A 3RBXA 3GHGA 2WSEH 2WMMA 1P84E 3BASA 4DZOA 1EZVD 3EJDA 2AEMA 2IBZE 2Q9IA 1R5SA 1BE3G 3L70J 2G8YA 3PHLA 1ZRTE 2JU1A 5KTBA 4NPEA 1KILC 2WWWA 1NU1E 1PPJE 3KZIH 2QE7H 5AW6B 1KFMA 3CWBE 1FZFA 3B71A 2PEQA 2FVFA 2K93A 3WU2E 2K2QA 1URQA 2QJKC 1AV1A 2YKPA 4A7PA 3CXHE 4JQ0D 3PLNA 1T3JA 2JO0A 2A45G 3M0DA 1HGZA 3DS4A 2QJYB 2LIUA 2Q1KA 2NPSA 3IN6A 2KLUA 4GIFA 3K5BA 1VQ9P 3AE1C 5APYA 2YMKA 2L9FA 3O6QB 3TSIA 2V4HA 1FZGA 2A45H 1KYOE 4YXWH 3B5NA 1NTZG 3MGEA 4MRTC 2NRGA 2ZYDA 4NPFX 5EFWB 3H1HG 1RH5B 1IJDB 3GF7A 1VF5D 1AFOA 2FXPA 1EDIA 1NYHA 4C7NA 1KQFB 2FFDC 2WSFH 1VQLP 1LTJB 1R5LA 3HE4B 1SQXJ 4C46A 3H1IG 4AUWA 3M9BA 1CZQA 1R8EA 2GZFA 2KYVA 1M57D 4U3FE 1SQVE 2A45I 2LKMA 1OIPA 2OTLP 2VLQA 1PP9G 1NTKJ 2DGYA 1DH3A 1N7SC 2J58A 3AE3C 1XTGB 3L72E 1JY3P 1E79H 1IO4A 1KV4A 2PAJA 4D6TJ 1KFNA 2WPQA 1SFCD 3CX5H 1FZCC 2KOPA 5CCGD 2MKVA 2RKLA 3H47A 3Q5SA 4BRYA 1N2DC 3A2AA 2BCCG 2Q3EA 2HPCA 1KTMA 3U59A 4N78E 2Q5UA 3V2RA 3FXEA 3BCCG 1UIXA 1SQBG 2E75C 5CMZA 1FDOA 1FAVA 1Z56A 4DT0A 1W2BO 3G6EP 2W6BA 1X0TA 4WVZA 3JSVC 3M91A 1SP4A 4OH8B 4COPA 1KB9I 1BXIA 1X8YA 4KJMA 3MZWB 4JYBA 1JO5A 1RO2A 2B9BA 1OMIA 3M06A 1RHZB 1E6JP 2AF8A 2JO1A 2LTEA 4OWFA 2E74C 3EFFK 2JP3A 1JEKA 2OYOA 2SPZA 3L70E 2CWOA 4H2XC 2IZ0A 2WSEJ 3HD7A 2Y0CA 3MTUE 5E79E 1HJ0A 3GHGB 4I6MC 3DS3A 4XA4A 4Y99B 3B5IA 1JOCA 5APQA 3QH9A 5AW7B 3A0HH 1BE3J 1LTTC 3SFEC 2FYZA 1HJBA 1LWUC 1NTMD 1SQXD 1BGYG 2KK7A 2N5IA 1YITP 3AE8C 1VQKP 1OVUA 2WPVB 5GTIE 1LNQA 1AVYA 1S9KE 5BS1A 2FXOA 1BCCG 1VQPP 1NKNA 3BVHA 2LF4A 4I2LC 1EZVG 4IL6X 3LRYA 3L71G 1M8OB 2B87A 4H44B 2HFED 3G3ZA 5BU5A 1RF1B 3B5NB 2EHTA 1SQXE 3S9OA 1G1IA 2ZAEB 3RK3B 2ZFCA 3GJNA 1G2CA 1NTKE 1NTZJ 5KJ7D 2B89A 3B4QA 2D2CB 3CL3D 1OVVA 1JY3N 4CPGA 1ZN5A 2XNDH 3H1HJ 4C7NB 1HTLC 1WRGA 3G26A 1X79B 1DEBA 5B66H 2K0DX 3GMAA 3PTZA 3SWYA 1M1JA 5DJTB 1L0ND 2N6YA 3H1IJ 2FAEA 2ZT9B 1EZVI 3HUSA 5GTHE 4PV1B 1PP9J 1L4AA 5DJUB 2K9JA 2JDIH 2KR5A 4PD4E 1GDTA 5AW8B 4BPFA 1JM0A 1IK7A 2GDYA 2JKVA 1SQQG 3KYQA 2H89C 3CCSP 3NY7B 2HPCB 3G4SP 2K88A 1VQ5P 4U0FA 1M6EX 1DEEG 3TGUD 2HYNA 2JEEA 2XXMA 1KMIZ 2BCCJ 3ABVC 4WB4A 2OYHC 3BCCJ 1NQ4A 2PEKA 3U1CA 1SQBJ 2KSJA 4GOEA 3WBHA 2RN0A 2KUBA 1FJPA 3VP8A 4GR6A 1UJZA 3W67A 1LT1A 2K5XA 1LTGC 5KLVG 1KILA 2UWJE 1RQVA 4JBZA 4PH0A 4PJ0E 2PFXA 1RE4C 1CEIA 2CG5B 3G1GA 3HD7B 1MFZA 1EDJA 2DW3A 2FYUD 1AQTA 3VP9A 1DD4A 3R2PA 2QRXA 1Q81Q 1BE3E 1URQD 3E7KA 3ZDMA 3S1KA 4UB8H 2M8RA 3CCMP 1VQOP 1S3JA 3V4WA 2FYNB 3A5TA 3L37A 1EOQA 3G9RA 3AE6C 2Z5HA 2NPSD 1RQUA 3P32A 1IC2A 2KIKA 1LP1B 2AEFA 3CCJP 1JMBA 1FZBA 3NTEA 4W7ZA 1UIIA 3B5ND 2PENA 5TISE 1NTMK 1SQXK 3RK3D 1BGYJ 1LTIC 3HE5A 3AE4C 1NTKK 3CLQA 2K0YA 3CX5D 2FFDA 2LIWA 1GK6A 2B88A 1TU3F 2D2CD 5TJHA 1NTZE 1BCCJ 2AEJA 4L75A 2M8NA 1AQ5A 1N7LA 3H1HE 1YQ3C 2IZ1A 3KPEA 1N7SA 3ITKA 3L71J 5APWA 1GTWA 2J5UA 1HQBA 2ZJSE 2WITA 3FGAD 4W80A 2ZT9D 2QJPC 3H1IE 1ACPA 1FZCA 3D6YA 2PRRA 2R44A 1PP9E 3CX5E 3L35A 5KAFH 1LTSC 4N6JA 3M1MA 2AXTH 2KS1A 1M1JB 3GZLA 2FKWB 2GZJA 1VHNA 2KZIA 4WY4B 1OFCX 2GDXA 2LOLA 1CW5A 1ZR2A 3B8EB 2K9JB 2O1KA 4IL6E 3EJEA 3AECC 2BCCE 1AUMA 3BCCE 2EG5A 5H2FH 2KNCA 4XFYA 1SQBE 3IF4A 4RO0A 3A0BH 2E76C 2VSQA 3NMDA 1T2KC 1YJWP 4IZ6A 1S1CX 1YI2P 1Y47A 1ZV8A 1EC5A 2QVAA 3I5CA 1OW7A 5I4TG 1SFCB 2N1TC 1NKZB 2XV6A 2NO8A 1L0NG 3HD7D 3AEFC 3CD6P 1Y8AA 4OGQC 3RL0B 3H1JD 2Y0DA 1DD3A 2ZXXA 1K04A 2GA1A 2P7JA 3G21A 3HYBA 1PGJA 1U57A 2L6EA 2KWLA 5BU8B 1NHLA 1LWUA 1Z6MA 5KLVJ 3N4XA 3A0HE 3AE9C 4YTPC 2WSCH 2E5YA 2QG4A 3TGUG 3TF5A 2Y9YA 1DIPA 3LMOA 1JCCA 1S5LX 3T97A 3L71D 5AW5B 1PL5A 3E1IA 2K3RA 2FY8A 1PFIA 2GZIA 1BGYE 3IR9A 4YPCA 2YXRB 1NTZK 5CCGC 2PEJA 3H4EA 1YHQP 1D1DA 1BCCE 4N3YB 1N73B 2KSEA 1IFPA 2Z44A 2KGDA 4GT1A 1EQ7A 2GYKA 3HE5B 2M5AA 3TK1A 3VMAA 1EZVE 5AVZB 3L71E 1FJKA 1M6NA 4CA3A 1QX8A 2FYUG 5AW2B 2MR8A 1MV8A 4U0CA 1J1EC 1JB0J 5B66E 1AF8A 2QM7A 2N98A 3CCRP 4L76A 4ZKUA 3N7NA 3I56P 1H89A 1AVOA 1SQQD 4XE5B 4WY4D 5AVQB 1QLED 5F2NA 1PGOA 3WMM0 3RK2D 1FZCB 2WT7A 3L73D 3LW5H 1F80D 3I55P 1NTMJ 1RNIA 4NEOA 1SQBK 2IFMA 2Q7CA 1GW3A 1Y9BA 5CCHA 2BEZF 3EWKA 1K05A 3H0DA 1RY3A 3SFDC 5AW1B 2OYHA 4I7ZB 2K0XA 1USEA 3GKLC 2I1KA 2FQ0A 1NVOA 1NJIQ 3FXDA 2JAZA 1N86A 5KLVD 5APSA 3II6A 3JC22 2MD9A 3H1LD 3NFQA 2KNCB 2AFEA 4K35A 2FQ1A 2R32A 3RL0D 3IAOA 2E74B 4TLFA 3JCUH 1GXGA 2N5HA 4R4LA 1RE4A 3L36A 3CX5I 4IPYA 2HODB 1LTJC 1A43A 1VDFA 4UB6H 5AW3B 5KLVE 1OX3A 1OW8A 1L0NJ 2WVRA 4PH1A 4EDFA 4UB8E 1VQ8P 2OYIC 1JY3O 3CMAP 1HH0A 5KJ7C 1GK4A 3RL0g 1W5CE 4HYTB 2WSCJ 4GKGA 4ASVA 4IOIH 4M3LA 3L75D 1S4XA 1ZOYC 5CHXA 2HG5D 2XZ0D 2E5TA 3OJAB 4DJGA 1GW4A 1PIXA 5APTA 3TGUJ 2KLVA 1ZMEC 2H88C 1EXIA 3L74G 5APXA 2KP8A 2HR3A 4U7JA 2FHSC 2K1AA 2ONTA 2P1JA 2YMYA 3H1JG 4LC1A 2H43A 3V2PA 1JY2P 3GLMA 2POHA 3KXDA 2KORA 1URQB 5CBNA 4K3AA 5AVYB 2M5AB 5C39A 3SWKA 1HF9A 3G29A 5KP6B 2LMLA 3P8CD 2P2UA 2M8PA
chains in the Genus database with same CATH topology
1KQLA 2PY8A 3VP9A 2WPRA 3R2PA 2NPSB 1Q81Q 3TNUB 1EIAA 1URQD 4GR2A 1S72P 2EIAA 1IUQA 2O1JA 1FOSE 2PEIA 4N78D 3G28A 2KOGA 3BRTB 3HUSC 2IPPA 2M8RA 1IFMA 5JPAA 1L4AC 4AYCA 3RK2C 3CCMP 1DX7A 1VQOP 2HODA 3V4WA 1L0LK 2QA4P 2Z45A 3A5TA 3L37A 1H88A 1EOQA 3VYIA 2Z5HA 2C9NY 1K8AQ 2NPSD 2OYIB 2R3CA 3P32A 5APVA 1IC2A 4C7RA 1FZAA 1SQQK 2BASA 2E1MA 1G1JA 5CJ4A 5CJ0A 3V4QA 2E43A 3CCJP 1FZBA 3NTEA 2XZRA 4W7ZA 1LTBC 1KILD 2R5BA 3B5ND 1KD1Q 2PENA 1LGHB 1KZUB 1NTMK 1SQXK 3M0AA 3P7KA 1FDMA 3NXSA 3OA7A 1GL2A 4XROA 3RK3D 1LTIC 1HGVA 3HE5A 4IFDK 1NTKK 2Q3IA 3CLQA 5BVZA 2FFDA 1K30A 4LLHA 1Q86Q 1J1EB 2I1JA 1GK6A 1KQSO 3CPWO 2OYHB 1FOSF 3OAKA 1SVFA 1M74A 3GHGA 1A02J 1FBMA 2WSEH 2P9XA 2N1TA 1RE3C 3BASA 4DZOA 2M8NA 1AQ5A 2OARA 4QNBA 1N7LA 1ZMBA 4U0BA 2Q9IA 2WZ7A 3KPEA 1N7SA 3G1IA 5HGLA 3KQGA 3HRNA 5AVTB 5APWA 1YYCA 5KTBA 1E5WA 1GTWA 1LWUB 5KLVK 1KILC 2WITA 2WWWA 1RF1C 4W80A 1CI6A 5HGMA 3CCLP 5AW6B 1KFMA 1FZCA 1FZFA 2PEQA 3HTKB 1OXZA 1QL1A 2XNXA 3L35A 1URQA 1LTSC 4JYCA 3M1MA 3G0VA 4N6JA 1RF0A 1YTZT 4EOTA 2YKPA 2E42A 1NU1K 1M1JB 2YO3A 1FU1A 2FKWB 1T3JA 2MJZA 5APUA 2JO0A 2A45G 3M0DA 1HGZA 3VN0A 3DS4A 3PP5A 4WY4B 4EIJA 2NPSA 1CW5A 3V5BA 2W6AA 1S9KD 1ZR2A 3A7OA 3B8EB 4GIFA 4U0AA 2O1KA 1VQ9P 5AW9B 3G71P 3P8MC 1IK9A 5APYA 3TSIA 1FZGA 2A45H 1N7SD 1JTHB 2BHVA 3B5NA 5CCGA 1AUMA 2C0XA 3MGEA 2EG5A 2IX7C 4WBAA 1M7LA 1K73Q 4XFYA 1IJDB 3NMDA 1T2KC 1YJWP 4WYMA 4COCA 1NAFA 3E2DA 1YI2P 1AFOA 2J59M 3V2QA 3VMXA 2YO2A 1ZV8A 4IFMA 4C7NA 3Q20A 2FFDC 5DCKA 2WSFH 1VQLP 1IFNA 1LTJB 1JY2N 3HE4B 1KC8Q 3GHGC 3I5CA 4C46A 2WTYA 3M9BA 4AUWA 3EQ2A 1SFCB 5I4TG 1CZQA 2N1TC 2KYVA 1NKZB 2A45I 2XV6A 2LKMA 2BUOA 2OTLP 3UIAA 3HD7D 2DGYA 3CD6P 4Y99C 1JNMA 1DH3A 1N7SC 2J58A 1LT9A 1XTGB 1M1KQ 1JY3P 1JCDA 3RL0B 5F2OA 2PEOA 1IO4A 1J1DC 1VQ6P 2PAJA 3OW2O 2N9BA 2YKOA 3M9HA 1KFNA 2WT7B 3MGNA 2WPQA 1SFCD 1SQVK 2P7JA 4JF7A 3G21A 3HYBA 3P8CE 1FZCC 5CCGD 2R5DA 2L6EA 1VQ4P 3H47A 2PP6A 1JY2O 5BU8B 1NHLA 1VQMP 1LWUA 1N2DC 1JUNA 3A2AA 1URQC 3N4XA 5AVRB 2HPCA 4B86A 1RF0C 1SLQA 2WSCH 4HH2A 3U59A 4N78E 2Q5UA 3V2RA 1QVFO 3MIWA 1HVVA 3M0DC 1JCCA 2JYGA 5CMZA 1HWTC 3T97A 3A3YB 1FAVA 1Z56A 3H32A 1W2BO 3VTPC 2NPSC 5AW5B 3G6EP 2W6BA 5AVXB 3CCUP 3CC7P 3E1IA 5CCHD 3M91A 1PFIA 2WPSA 1SP4A 3IR9A 4OH8B 3B5NC 4COPA 1G2CB 4WY4A 1NTZK 1RO0A 5CCGC 2HLOA 1X8YA 2PEJA 3L4FA 3H4EA 1A8OA 4XFXA 1J2JB 2Z5IA 1T3UA 3RK3C 1MZ9A 4JYBA 1JO5A 3C9IA 1RO2A 1YHQP 3M06A 3LIDA 1ZLLA 3M9QA 1IFJA 1D1DA 1E6JP 3CMEP 4N3YB 1N73B 1IFDA 2Z44A 4GT1A 1EQ7A 2ZXEB 1GL2B 2C0WA 2CPSA 3HE5B 3TK1A 1NH4A 3P05A 4LGDE 1QL2A 2CWOA 1QRJA 5AVZB 1FJKA 1M6NA 3HD7A 4U0EA 2H7HA 3O8ZA 1VQ7P 5AW2B 1YJ9P 3MTUE 1MV8A 4U0CA 3GHGB 5CCHC 1L0NK 3HUSB 2N1TB 1W2EA 3TNUA 4I6MC 3IFMA 1L4AB 5AVUB 3RG6C 1J1EC 3RK2B 4DOJA 3DS3A 1LTJA 1LT9C 3CC2P 2OTJP 3VRLC 4XA4A 2QM7A 4Y99B 1SFCA 3CCRP 3B5IA 1JOCA 4ZKUA 1CSBA 3N7NA 1QVGO 3I56P 3DS5A 2QEXP 5APQA 1J1DB 1H89A 2Z4EA 1SQPK 4XE5B 3CXCO 4WY4D 5AW7B 1A02F 5AVQB 4W7YA 5AVWB 2OYIA 1LTTC 5F2NA 2JYLA 5KJ7A 2FYZA 1HJBA 1LWUC 1JJ2O 3WMM0 3RK2D 5AVSB 1FZCB 1ZR4A 3DPHA 1YITP 2WT7A 2KB7P 2XKMA 1VQKP 3LW5H 3I55P 1RNIA 1SQBK 2IFMA 3NTNA 1BAJA 1YTZI 1S9KE 5BS1A 1K9MQ 2Q7CA 4M0IA 1VQPP 1GW3A 5CCHA 1HUCA 3BRVB 3H0DA 1RY3A 1NKNA 5AW1B 1M1JC 5AW4B 2P67A 2OYHA 3BVHA 2LF4A 4I2LC 3VOPA 3LRYA 1VPCA 2I1KA 1NJIQ 4IFFA 4WY4C 2HFED 3G3ZA 1KILB 1N86A 5BU5A 1RF1B 1OWAA 3B5NB 5APSA 3II6A 3DS0A 3CCVP 3NFQA 1G1IA 2H8PD 3CC4P 3RK3B 2M3BA 2ZFCA 3V2NA 1JMMA 2R32A 1XTCC 1NWQA 1G2CA 2IFNA 3RL0D 5KJ7D 2VRSA 2O01H 3CL3D 1JY3N 3HTKA 1ZN5A 2CPBA 3HD7C 4C7NB 2JJLA 1N73A 1HTLC 1WRGA 1RE4A 2Z46A 2FYUK 3L36A 3G26A 2GM4A 1X79B 1DEBA 1YJNP 5AW0B 1M90Q 3SWYA 2FXMA 1M1JA 5BS2A 1GD2E 1N8RQ 4IPYA 2HODB 1LTJC 1A43A 1Q7YQ 1VDFA 5AW3B 1SFCC 1MUUA 1T8ZA 1GZLA 1LT9B 1IFIA 3HUSA 2XDJA 1L4AA 2XT1A 4PH1A 2QM8A 1GDTA 2C9LY 4O9BA 1VQ8P 5AW8B 2OYIC 3RL0C 1JY3O 3CMAP 1HH0A 5KJ7C 1JTHA 1GK4A 1FZEA 4HYTB 4GKGA 2YKQA 5F2KA 4M3LA 3CCEP 2XU6A 3KYQA 3CCSP 2HPCB 2GUVA 3TYYA 4XFZA 3G4SP 1VQ5P 4U0FA 2FFDB 2M8LA 1GU5A 1M6EX 4ZKPA 5CHXA 2HG5D 2GUSA 4I1LA 2HYNA 2JEEA 2XXMA 3MUDA 3DS1A 3OJAB 3LIEA 1H8AA 1GW4A 3DS2A 1NO4A 3H32B 4WB4A 3EFGA 5APTA 2KLVA 2OYHC 3HE4A 2EFJA 3H6PA 1T2KD 1GL2D 2PEKA 1NOHA 3BATA 3SWFA 2XV5A 3U1CA 1N7SB 2KSJA 5APXA 2KP8A 1HBWA 2PEMA 1GU4A 3VMYA 4RESB 3CI9A 2L5GB 1RE3A 3WBHA 2ONTA 1Q82Q 2P1JA 1CI6B 4KHXA 2N1TD 2YMYA 1FJPA 2YNYA 4GR6A 1L4AD 4LC1A 3VP8A 2H43A 4XRQA 3KDPB 5HGNA 3V2PA 4AQRD 1JY2P 1LTGC 2POHA 3MD0A 1X9VA 1VQNP 5HGOA 1KILA 1LTAC 2W27A 1RF1A 1URQB 3U1AA 3CCQP 3DTJA 5AVVB 4PH0A 3VMZA 5AVYB 1YIJP 1N73C 3G29A 1WT6A 1RE4C 3G1GA 3HZQA 4U0DA 3HD7B 1GL2C 2KODA 1MFZA 3P8CD 2P2UA 2M8PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J59 M;  1SQQ K;  2WSE H;  1L0N K;  2O01 H;  3M9Q A;  2WSF H;  2OAR A;  3LW5 H;  2FYU K;  1SQV K;  3G3Z A;  1NTM K;  1SQX K;  1SQB K;  1NU1 K;  2LKM A;  4IFD K;  1L0L K;  5KLV K;  1NTK K;  3HZQ A;  3CLQ A;  1SQP K;  2WSC H;  1NTZ K; 
#chains in the Genus database with same CATH topology
 2PY8 A;  2NPS B;  1NU1 G;  3MP7 B;  1P84 H;  1IUQ A;  2FYU J;  3E1R A;  2O1J A;  1S5L E;  1KQG B;  2AXT E;  3BRT B;  2G3A A;  1NTM E;  2E75 D;  2W8Z A;  1H88 A;  4L74 A;  1K8A Q;  5APV A;  2WSF J;  1SQQ K;  2E1M A;  1EMV A;  1LTB C;  3WU2 H;  3GZM A;  1KD1 Q;  1GL2 A;  4H0L C;  1HGV A;  3CXH H;  4IFD K;  3FWL A;  2IYO A;  2E74 D;  2OYH B;  3CPW O;  1SVF A;  1A02 J;  2P9X A;  2N1T A;  2GZG A;  1RE3 C;  2OAR A;  4QNB A;  4U0B A;  1L0H A;  2WZ7 A;  2LPK A;  4H13 C;  1KYO H;  1OVR A;  1SQP D;  3HRN A;  4WWI A;  4H44 C;  5AVT B;  1YYC A;  4BRY B;  1E5W A;  5KLV K;  2N50 A;  1RF1 C;  3B4S A;  1CI6 A;  5HGM A;  3CCL P;  4F37 A;  3L73 G;  5B5E E;  1OXZ A;  1L0N E;  1QL1 A;  4JYC A;  1YTZ T;  3V6I A;  2E42 A;  2MJZ A;  3PP5 A;  2JU2 A;  2FVE A;  4EIJ A;  5KP8 B;  4U0A A;  3Q2Y A;  3G71 P;  3P8M C;  1IK9 A;  4PV1 C;  3H1L G;  2BHV A;  3F5H A;  3TGU E;  2QSI A;  3WUU A;  5CCG A;  2C0X A;  1M7L A;  2P58 A;  1K73 Q;  3KZI E;  2M3E A;  4COC A;  2AXC A;  3R4Y A;  3E2D A;  2A06 D;  2J59 M;  3V2Q A;  2M0B A;  3VMX A;  2YO2 A;  4IFM A;  2EHS A;  5DCK A;  1MZ8 A;  1IFN A;  1JY2 N;  2AVA A;  2WTY A;  3EQ2 A;  2KXP B;  3WUV A;  1JNM A;  3L74 J;  1JCD A;  5F2O A;  1J1D C;  1VQ6 P;  4UHP B;  3OW2 O;  2N9B A;  2YKO A;  3MGN A;  4JF7 A;  3H1J J;  2FYU E;  1VQ4 P;  2PP6 A;  1VQM P;  5KKZ C;  3L75 G;  2DNW A;  4B86 A;  1RF0 C;  4HH2 A;  2K37 A;  1QVF O;  3MIW A;  5E79 H;  3AED C;  4BXL A;  2M5R A;  2B87 B;  2ITA A;  4Z1M H;  1GPJ A;  2K92 A;  3VTP C;  1OW6 A;  1Q2N A;  3CCU P;  5AVX B;  3CC7 P;  1HY8 A;  5CCH D;  2QNW A;  2WPS A;  2CQ8 A;  1G2C B;  1RO0 A;  3H1K D;  2FYN C;  2HLO A;  1A8O A;  2Z5I A;  1T3U A;  3KHU A;  3RK3 E;  1MZ9 A;  3C9I A;  3O6Q A;  3LID A;  1ZLL A;  3CME P;  1GMJ A;  1AYI A;  2KG9 A;  2ZXE B;  2Y9Z A;  1GL2 B;  2C0W A;  2AFD A;  2CPS A;  3AEA C;  3P05 A;  4LGD E;  1QL2 A;  1QRJ A;  2JWD A;  1VL2 A;  3O8Z A;  3JCU E;  5KLI B;  1L0N K;  3HUS B;  2N1T B;  1W2E A;  1EDL A;  3IFM A;  1L4A B;  5AVU B;  1IMQ A;  3RK2 B;  2JWA A;  4DOJ A;  1LTJ A;  1LT9 C;  3CC2 P;  2OTJ P;  3PJS K;  2ZYG A;  2ZVO B;  4KT0 J;  5EW5 E;  4OGQ B;  4UB6 E;  1QVG O;  4D6T G;  2KOQ A;  2MY5 A;  2QEX P;  1SQP K;  1VKU A;  1A02 F;  5AVW B;  4W7Y A;  2OYI A;  2JYL A;  5KJ7 A;  1MKM A;  1SQQ J;  2XKM A;  2KW2 A;  2KOS A;  3L73 J;  1YTZ I;  3L74 D;  1K9M Q;  4M0I A;  4OVN F;  1M1J C;  5AW4 B;  2P67 A;  4ZNC A;  2L22 A;  3VOP A;  3GF3 A;  1AA0 A;  4IFF A;  4PD4 H;  4WY4 C;  1KIL B;  1SQP G;  4RJT A;  1VF5 C;  4BPH A;  3CCV P;  2YIU C;  2H8P D;  3CC4 P;  1P84 D;  3D6Z A;  1JMM A;  2PNG A;  2IBZ D;  3H1L J;  4DCK A;  2VRS A;  3AEB C;  2O01 H;  1ZRT D;  2QJK B;  3L74 E;  3HTK A;  3MHV A;  2CPB A;  1NU1 D;  1L2P A;  1PPJ D;  2FYU K;  2Z46 A;  1ZNV A;  2GM4 A;  5KAI H;  4R4M A;  4GOD A;  3CWB D;  3RG2 A;  1GD2 E;  1X3O A;  3H1J E;  1Q7Y Q;  1SFC C;  1MUU A;  1T8Z A;  3CXH D;  2XDJ A;  2XT1 A;  1L0L G;  2C9L Y;  3S4R A;  3RL0 C;  1JTH A;  2GZE A;  2O01 N;  4PJ0 H;  3D71 A;  2YKQ A;  3TDK A;  2ZYA A;  2GUV A;  1KYO D;  2FFD B;  2M8L A;  2A06 G;  3QWO C;  2WQY C;  4ZKP A;  1GU5 A;  1LJ2 A;  2GUS A;  4I1L A;  3DS1 A;  3L75 J;  3LIE A;  1H8A A;  1NO4 A;  2E76 D;  4HKG A;  1T2K D;  1GL2 D;  1NOH A;  3BAT A;  1N7S B;  4JPZ B;  1HBW A;  2JGP A;  4L73 A;  2PEM A;  1GU4 A;  3VMY A;  1T6A A;  1ZXG A;  2L5G B;  1RE3 A;  1Q82 Q;  4KHX A;  1YQ4 C;  2N1T D;  2YNY A;  1ZP0 C;  1L4A D;  4U3F D;  1SQV D;  2FAC A;  3EJB A;  4XRQ A;  3KDP B;  1Q90 D;  1X9V A;  1LTA C;  1UNK A;  1U7M A;  1RF1 A;  3U1A A;  4EI2 A;  5TIS H;  4EYY Q;  4OGQ D;  3DTJ A;  3L72 D;  4H2W C;  2KS1 B;  1N73 C;  1WT6 A;  3HZQ A;  2E75 B;  2KOD A;  2W90 A;  1KQL A;  2W6J H;  2ZVN B;  2Q6Q A;  2QJY C;  4GR2 A;  2EIA A;  1SQQ E;  1FOS E;  2PEI A;  4N78 D;  3G28 A;  2KOG A;  2XZ1 C;  5JPA A;  1D7M A;  1FDI A;  1DX7 A;  2CGQ A;  2FVA A;  1MFT A;  2KI7 B;  3L73 E;  3H1K G;  2KZJ A;  2OYI B;  2R3C A;  3PH0 A;  1KLP A;  1FZA A;  1YBK A;  1FR2 A;  2BAS A;  1G1J A;  3V4Q A;  2E43 A;  2K94 A;  2XZR A;  1KIL D;  2R5B A;  1LGH B;  3P7K A;  3M0A A;  1FDM A;  3MUD C;  3NXS A;  3OA7 A;  1U7J A;  4R0M A;  1KB9 H;  1BSH A;  3W68 A;  4XFJ A;  2KGA A;  1K30 A;  1FOS F;  3H1L E;  1FBM A;  3L70 D;  1ZMB A;  4IL6 H;  4I7Z C;  5M1B A;  3G1I A;  5HGL A;  3KQG A;  4HKZ H;  1LWU B;  2LKI A;  1KIL E;  2O01 J;  1SQP J;  3RBZ A;  1T8K A;  2JBG A;  2IYP A;  3HTK B;  2XNX A;  3T97 B;  4YXD C;  2KG6 A;  1DV5 A;  1ZW0 A;  3G0V A;  4MN4 C;  1RF0 A;  4EOT A;  2JQ4 A;  1NU1 K;  4BWN A;  2YO3 A;  1PGP A;  1FU1 A;  5APU A;  1IMP A;  1IZN B;  3VN0 A;  1QGK B;  2N9Y B;  2JB0 A;  3RGU A;  3V5B A;  2W6A A;  2LR2 A;  2WSS H;  1S9K D;  3A7O A;  2VLO A;  5AW9 B;  3L75 E;  2JR8 A;  1N7S D;  1JTH B;  1PGQ A;  2IX7 C;  4WBA A;  1L0L J;  2IBZ G;  2KOO A;  4Y28 J;  1S2E A;  4WYM A;  1NAF A;  2BEQ D;  1LP1 A;  4H0L B;  1PPJ G;  2VLN A;  3Q20 A;  5KAF E;  1KC8 Q;  5CZD B;  1NTK D;  3GHG C;  3CWB G;  3Q1M A;  1PZQ A;  2BUO A;  3USS A;  1M56 D;  3UIA A;  2KGE A;  4Y99 C;  4D6T D;  2K9Y A;  1LT9 A;  1M1K Q;  4H13 B;  2PEO A;  3LW5 J;  7CEI A;  1BDD A;  3M9H A;  2PGD A;  2WT7 B;  1SQV K;  3P8C E;  2GDW A;  1P84 I;  2R5D A;  5H2F E;  3SSU A;  1JY2 O;  2OGU A;  2MVV A;  2IBZ I;  1JUN A;  1URQ C;  4PD4 D;  3A0B E;  5AVR B;  2CNR A;  1NGM B;  1SLQ A;  4PWV B;  1HVV A;  1AJY A;  3M0D C;  4RKU J;  2JYG A;  1HWT C;  4D6T E;  3A3Y B;  1KOR A;  3GG2 A;  3H32 A;  2NPS C;  1NAY A;  2MF4 A;  1PV3 A;  2LXC B;  5K5G B;  3B5N C;  3CXH I;  4WY4 A;  4U3F G;  1SQV G;  3L4F A;  4XFX A;  3AEE C;  1J2J B;  3RK3 C;  4ZMD A;  2N6Z A;  3M9Q A;  1IFJ A;  3H1K J;  1IFD A;  3L72 G;  3F89 A;  2D2C C;  4GOF A;  2OQQ A;  1NH4 A;  5HV8 A;  2V7Q H;  1KYO I;  4BPG A;  4U0E A;  2H7H A;  1VQ7 P;  1YJ9 P;  1SQP E;  5CCH C;  3TNU A;  3RG6 C;  5KAI E;  1QEX A;  2KGC A;  3C8V A;  3VRL C;  2ZT9 C;  1L0L D;  1SFC A;  1FE6 A;  4GDO A;  1CSB A;  1BE3 D;  5CBO A;  3DS5 A;  1J1D B;  2Z4E A;  4NPD A;  4DG9 A;  3CXC O;  3H25 A;  3FWN A;  4HJG H;  5EJD A;  1JJ2 O;  2RH0 A;  5AVS B;  1H0T A;  2FAD A;  1ZR4 A;  2MVU A;  3DPH A;  3AE2 C;  2KB7 P;  5KKZ B;  1WMK A;  1X22 A;  1E0H A;  3U43 A;  1OR5 A;  3NTN A;  1BAJ A;  1L0L E;  1HUC A;  3BRV B;  2YXQ B;  2R3S A;  4H0L D;  2FQ2 A;  3L70 G;  1BDC A;  1VPC A;  2I8D A;  1BSN A;  2Y0E A;  1OWA A;  2A06 E;  3DS0 A;  2QJP B;  1NTZ D;  2M3B A;  2P10 A;  3V2N A;  2CK3 H;  4ASW A;  1XTC C;  3AE7 C;  1NWQ A;  3H1H D;  2IFN A;  4H13 D;  4H44 D;  4HB1 A;  3HD7 C;  2JJL A;  1N73 A;  1YJN P;  5AW0 B;  1M90 Q;  2LXB A;  3H1I D;  3FX0 A;  1NU1 J;  2FXM A;  5BS2 A;  1N8R Q;  1KN7 A;  2ROQ A;  1PP9 D;  3CWB J;  1GZL A;  1LT9 B;  1IFI A;  1GXH A;  2W83 C;  3CE7 A;  1OZH A;  3Q3D A;  1KB9 D;  2QM8 A;  4O9B A;  1FZE A;  5GTI H;  2E76 B;  5F2K A;  3WUT A;  2L0Q A;  3CCE P;  2NZ2 A;  2XU6 A;  4H2Y C;  2L4B A;  3TYY A;  4XFZ A;  4TT3 H;  2BCC D;  4PV1 D;  1NTM G;  1SQX G;  2RMZ A;  3Q5P A;  1L0I A;  2QIW A;  3BCC D;  3MUD A;  4QMA A;  3GW6 A;  1SQB D;  3DS2 A;  1NTK G;  3H32 B;  3EFG A;  3HE4 A;  2EFJ A;  2LL8 A;  3H6P A;  1S5L H;  3H1K E;  3SWF A;  2XV5 A;  1KB9 E;  4RES B;  3CI9 A;  3Q5R A;  1CI6 B;  1SS1 A;  1VF5 B;  1EDK A;  4AQR D;  5HGN A;  2YIU B;  3MD0 A;  1VQN P;  5HGO A;  1USD A;  2V7Q J;  5KP7 B;  2W27 A;  4U3F J;  1SQV J;  3CCQ P;  5AVV B;  3VMZ A;  1YIJ P;  3PRJ A;  3AE5 C;  1EXJ A;  3L72 J;  4U0D A;  1GL2 C;  1DNY A;  2WPR A;  2IDB A;  3TNU B;  2O3J A;  1EIA A;  5GTH H;  1S72 P;  1FS0 E;  2L91 A;  1FC2 C;  5KLI C;  3HUS C;  2IPP A;  3AEG C;  1IFM A;  1L4A C;  4AYC A;  3D70 A;  2ERH A;  3RK2 C;  5L8R J;  2HOD A;  1L0L K;  2KG8 A;  5HVC A;  2QA4 P;  2FBW C;  2Z45 A;  3VYI A;  2C9N Y;  2OTK E;  4C7R A;  4PXH B;  1H0T B;  3C1L A;  5CJ4 A;  5CJ0 A;  2X2B A;  1BGY D;  5B5E H;  1KZU B;  4XRO A;  4PD4 I;  4QKO A;  2Q3I A;  2WPT A;  1BCC D;  5BVZ A;  2VLP A;  4LLH A;  1Q86 Q;  1J1E B;  2I1J A;  2MR7 A;  1KQS O;  3OAK A;  1M74 A;  3RBX A;  3GHG A;  2WSE H;  2WMM A;  1P84 E;  3BAS A;  4DZO A;  1EZV D;  3EJD A;  2AEM A;  2IBZ E;  2Q9I A;  1R5S A;  1BE3 G;  3L70 J;  2G8Y A;  3PHL A;  1ZRT E;  2JU1 A;  5KTB A;  4NPE A;  1KIL C;  2WWW A;  1NU1 E;  1PPJ E;  3KZI H;  2QE7 H;  5AW6 B;  1KFM A;  3CWB E;  1FZF A;  3B71 A;  2PEQ A;  2FVF A;  2K93 A;  3WU2 E;  2K2Q A;  1URQ A;  2QJK C;  1AV1 A;  2YKP A;  4A7P A;  3CXH E;  4JQ0 D;  3PLN A;  1T3J A;  2JO0 A;  2A45 G;  3M0D A;  1HGZ A;  3DS4 A;  2QJY B;  2LIU A;  2Q1K A;  2NPS A;  3IN6 A;  2KLU A;  4GIF A;  3K5B A;  1VQ9 P;  3AE1 C;  5APY A;  2YMK A;  2L9F A;  3O6Q B;  3TSI A;  2V4H A;  1FZG A;  2A45 H;  1KYO E;  4YXW H;  3B5N A;  1NTZ G;  3MGE A;  4MRT C;  2NRG A;  2ZYD A;  4NPF X;  5EFW B;  3H1H G;  1RH5 B;  1IJD B;  3GF7 A;  1VF5 D;  1AFO A;  2FXP A;  1EDI A;  1NYH A;  4C7N A;  1KQF B;  2FFD C;  2WSF H;  1VQL P;  1LTJ B;  1R5L A;  3HE4 B;  1SQX J;  4C46 A;  3H1I G;  4AUW A;  3M9B A;  1CZQ A;  1R8E A;  2GZF A;  2KYV A;  1M57 D;  4U3F E;  1SQV E;  2A45 I;  2LKM A;  1OIP A;  2OTL P;  2VLQ A;  1PP9 G;  1NTK J;  2DGY A;  1DH3 A;  1N7S C;  2J58 A;  3AE3 C;  1XTG B;  3L72 E;  1JY3 P;  1E79 H;  1IO4 A;  1KV4 A;  2PAJ A;  4D6T J;  1KFN A;  2WPQ A;  1SFC D;  3CX5 H;  1FZC C;  2KOP A;  5CCG D;  2MKV A;  2RKL A;  3H47 A;  3Q5S A;  4BRY A;  1N2D C;  3A2A A;  2BCC G;  2Q3E A;  2HPC A;  1KTM A;  3U59 A;  4N78 E;  2Q5U A;  3V2R A;  3FXE A;  3BCC G;  1UIX A;  1SQB G;  2E75 C;  5CMZ A;  1FDO A;  1FAV A;  1Z56 A;  4DT0 A;  1W2B O;  3G6E P;  2W6B A;  1X0T A;  4WVZ A;  3JSV C;  3M91 A;  1SP4 A;  4OH8 B;  4COP A;  1KB9 I;  1BXI A;  1X8Y A;  4KJM A;  3MZW B;  4JYB A;  1JO5 A;  1RO2 A;  2B9B A;  1OMI A;  3M06 A;  1RHZ B;  1E6J P;  2AF8 A;  2JO1 A;  2LTE A;  4OWF A;  2E74 C;  3EFF K;  2JP3 A;  1JEK A;  2OYO A;  2SPZ A;  3L70 E;  2CWO A;  4H2X C;  2IZ0 A;  2WSE J;  3HD7 A;  2Y0C A;  3MTU E;  5E79 E;  1HJ0 A;  3GHG B;  4I6M C;  3DS3 A;  4XA4 A;  4Y99 B;  3B5I A;  1JOC A;  5APQ A;  3QH9 A;  5AW7 B;  3A0H H;  1BE3 J;  1LTT C;  3SFE C;  2FYZ A;  1HJB A;  1LWU C;  1NTM D;  1SQX D;  1BGY G;  2KK7 A;  2N5I A;  1YIT P;  3AE8 C;  1VQK P;  1OVU A;  2WPV B;  5GTI E;  1LNQ A;  1AVY A;  1S9K E;  5BS1 A;  2FXO A;  1BCC G;  1VQP P;  1NKN A;  3BVH A;  2LF4 A;  4I2L C;  1EZV G;  4IL6 X;  3LRY A;  3L71 G;  1M8O B;  2B87 A;  4H44 B;  2HFE D;  3G3Z A;  5BU5 A;  1RF1 B;  3B5N B;  2EHT A;  1SQX E;  3S9O A;  1G1I A;  2ZAE B;  3RK3 B;  2ZFC A;  3GJN A;  1G2C A;  1NTK E;  1NTZ J;  5KJ7 D;  2B89 A;  3B4Q A;  2D2C B;  3CL3 D;  1OVV A;  1JY3 N;  4CPG A;  1ZN5 A;  2XND H;  3H1H J;  4C7N B;  1HTL C;  1WRG A;  3G26 A;  1X79 B;  1DEB A;  5B66 H;  2K0D X;  3GMA A;  3PTZ A;  3SWY A;  1M1J A;  5DJT B;  1L0N D;  2N6Y A;  3H1I J;  2FAE A;  2ZT9 B;  1EZV I;  3HUS A;  5GTH E;  4PV1 B;  1PP9 J;  1L4A A;  5DJU B;  2K9J A;  2JDI H;  2KR5 A;  4PD4 E;  1GDT A;  5AW8 B;  4BPF A;  1JM0 A;  1IK7 A;  2GDY A;  2JKV A;  1SQQ G;  3KYQ A;  2H89 C;  3CCS P;  3NY7 B;  2HPC B;  3G4S P;  2K88 A;  1VQ5 P;  4U0F A;  1M6E X;  1DEE G;  3TGU D;  2HYN A;  2JEE A;  2XXM A;  1KMI Z;  2BCC J;  3ABV C;  4WB4 A;  2OYH C;  3BCC J;  1NQ4 A;  2PEK A;  3U1C A;  1SQB J;  2KSJ A;  4GOE A;  3WBH A;  2RN0 A;  2KUB A;  1FJP A;  3VP8 A;  4GR6 A;  1UJZ A;  3W67 A;  1LT1 A;  2K5X A;  1LTG C;  5KLV G;  1KIL A;  2UWJ E;  1RQV A;  4JBZ A;  4PH0 A;  4PJ0 E;  2PFX A;  1RE4 C;  1CEI A;  2CG5 B;  3G1G A;  3HD7 B;  1MFZ A;  1EDJ A;  2DW3 A;  2FYU D;  1AQT A;  3VP9 A;  1DD4 A;  3R2P A;  2QRX A;  1Q81 Q;  1BE3 E;  1URQ D;  3E7K A;  3ZDM A;  3S1K A;  4UB8 H;  2M8R A;  3CCM P;  1VQO P;  1S3J A;  3V4W A;  2FYN B;  3A5T A;  3L37 A;  1EOQ A;  3G9R A;  3AE6 C;  2Z5H A;  2NPS D;  1RQU A;  3P32 A;  1IC2 A;  2KIK A;  1LP1 B;  2AEF A;  3CCJ P;  1JMB A;  1FZB A;  3NTE A;  4W7Z A;  1UII A;  3B5N D;  2PEN A;  5TIS E;  1NTM K;  1SQX K;  3RK3 D;  1BGY J;  1LTI C;  3HE5 A;  3AE4 C;  1NTK K;  3CLQ A;  2K0Y A;  3CX5 D;  2FFD A;  2LIW A;  1GK6 A;  2B88 A;  1TU3 F;  2D2C D;  5TJH A;  1NTZ E;  1BCC J;  2AEJ A;  4L75 A;  2M8N A;  1AQ5 A;  1N7L A;  3H1H E;  1YQ3 C;  2IZ1 A;  3KPE A;  1N7S A;  3ITK A;  3L71 J;  5APW A;  1GTW A;  2J5U A;  1HQB A;  2ZJS E;  2WIT A;  3FGA D;  4W80 A;  2ZT9 D;  2QJP C;  3H1I E;  1ACP A;  1FZC A;  3D6Y A;  2PRR A;  2R44 A;  1PP9 E;  3CX5 E;  3L35 A;  5KAF H;  1LTS C;  4N6J A;  3M1M A;  2AXT H;  2KS1 A;  1M1J B;  3GZL A;  2FKW B;  2GZJ A;  1VHN A;  2KZI A;  4WY4 B;  1OFC X;  2GDX A;  2LOL A;  1CW5 A;  1ZR2 A;  3B8E B;  2K9J B;  2O1K A;  4IL6 E;  3EJE A;  3AEC C;  2BCC E;  1AUM A;  3BCC E;  2EG5 A;  5H2F H;  2KNC A;  4XFY A;  1SQB E;  3IF4 A;  4RO0 A;  3A0B H;  2E76 C;  2VSQ A;  3NMD A;  1T2K C;  1YJW P;  4IZ6 A;  1S1C X;  1YI2 P;  1Y47 A;  1ZV8 A;  1EC5 A;  2QVA A;  3I5C A;  1OW7 A;  5I4T G;  1SFC B;  2N1T C;  1NKZ B;  2XV6 A;  2NO8 A;  1L0N G;  3HD7 D;  3AEF C;  3CD6 P;  1Y8A A;  4OGQ C;  3RL0 B;  3H1J D;  2Y0D A;  1DD3 A;  2ZXX A;  1K04 A;  2GA1 A;  2P7J A;  3G21 A;  3HYB A;  1PGJ A;  1U57 A;  2L6E A;  2KWL A;  5BU8 B;  1NHL A;  1LWU A;  1Z6M A;  5KLV J;  3N4X A;  3A0H E;  3AE9 C;  4YTP C;  2WSC H;  2E5Y A;  2QG4 A;  3TGU G;  3TF5 A;  2Y9Y A;  1DIP A;  3LMO A;  1JCC A;  1S5L X;  3T97 A;  3L71 D;  5AW5 B;  1PL5 A;  3E1I A;  2K3R A;  2FY8 A;  1PFI A;  2GZI A;  1BGY E;  3IR9 A;  4YPC A;  2YXR B;  1NTZ K;  5CCG C;  2PEJ A;  3H4E A;  1YHQ P;  1D1D A;  1BCC E;  4N3Y B;  1N73 B;  2KSE A;  1IFP A;  2Z44 A;  2KGD A;  4GT1 A;  1EQ7 A;  2GYK A;  3HE5 B;  2M5A A;  3TK1 A;  3VMA A;  1EZV E;  5AVZ B;  3L71 E;  1FJK A;  1M6N A;  4CA3 A;  1QX8 A;  2FYU G;  5AW2 B;  2MR8 A;  1MV8 A;  4U0C A;  1J1E C;  1JB0 J;  5B66 E;  1AF8 A;  2QM7 A;  2N98 A;  3CCR P;  4L76 A;  4ZKU A;  3N7N A;  3I56 P;  1H89 A;  1AVO A;  1SQQ D;  4XE5 B;  4WY4 D;  5AVQ B;  1QLE D;  5F2N A;  1PGO A;  3WMM 0;  3RK2 D;  1FZC B;  2WT7 A;  3L73 D;  3LW5 H;  1F80 D;  3I55 P;  1NTM J;  1RNI A;  4NEO A;  1SQB K;  2IFM A;  2Q7C A;  1GW3 A;  1Y9B A;  5CCH A;  2BEZ F;  3EWK A;  1K05 A;  3H0D A;  1RY3 A;  3SFD C;  5AW1 B;  2OYH A;  4I7Z B;  2K0X A;  1USE A;  3GKL C;  2I1K A;  2FQ0 A;  1NVO A;  1NJI Q;  3FXD A;  2JAZ A;  1N86 A;  5KLV D;  5APS A;  3II6 A;  3JC2 2;  2MD9 A;  3H1L D;  3NFQ A;  2KNC B;  2AFE A;  4K35 A;  2FQ1 A;  2R32 A;  3RL0 D;  3IAO A;  2E74 B;  4TLF A;  3JCU H;  1GXG A;  2N5H A;  4R4L A;  1RE4 A;  3L36 A;  3CX5 I;  4IPY A;  2HOD B;  1LTJ C;  1A43 A;  1VDF A;  4UB6 H;  5AW3 B;  5KLV E;  1OX3 A;  1OW8 A;  1L0N J;  2WVR A;  4PH1 A;  4EDF A;  4UB8 E;  1VQ8 P;  2OYI C;  1JY3 O;  3CMA P;  1HH0 A;  5KJ7 C;  1GK4 A;  3RL0 g;  1W5C E;  4HYT B;  2WSC J;  4GKG A;  4ASV A;  4IOI H;  4M3L A;  3L75 D;  1S4X A;  1ZOY C;  5CHX A;  2HG5 D;  2XZ0 D;  2E5T A;  3OJA B;  4DJG A;  1GW4 A;  1PIX A;  5APT A;  3TGU J;  2KLV A;  1ZME C;  2H88 C;  1EXI A;  3L74 G;  5APX A;  2KP8 A;  2HR3 A;  4U7J A;  2FHS C;  2K1A A;  2ONT A;  2P1J A;  2YMY A;  3H1J G;  4LC1 A;  2H43 A;  3V2P A;  1JY2 P;  3GLM A;  2POH A;  3KXD A;  2KOR A;  1URQ B;  5CBN A;  4K3A A;  5AVY B;  2M5A B;  5C39 A;  3SWK A;  1HF9 A;  3G29 A;  5KP6 B;  2LML A;  3P8C D;  2P2U A;  2M8P A; 
#chains in the Genus database with same CATH homology
 1KQL A;  2PY8 A;  3VP9 A;  2WPR A;  3R2P A;  2NPS B;  1Q81 Q;  3TNU B;  1EIA A;  1URQ D;  4GR2 A;  1S72 P;  2EIA A;  1IUQ A;  2O1J A;  1FOS E;  2PEI A;  4N78 D;  3G28 A;  2KOG A;  3BRT B;  3HUS C;  2IPP A;  2M8R A;  1IFM A;  5JPA A;  1L4A C;  4AYC A;  3RK2 C;  3CCM P;  1DX7 A;  1VQO P;  2HOD A;  3V4W A;  1L0L K;  2QA4 P;  2Z45 A;  3A5T A;  3L37 A;  1H88 A;  1EOQ A;  3VYI A;  2Z5H A;  2C9N Y;  1K8A Q;  2NPS D;  2OYI B;  2R3C A;  3P32 A;  5APV A;  1IC2 A;  4C7R A;  1FZA A;  1SQQ K;  2BAS A;  2E1M A;  1G1J A;  5CJ4 A;  5CJ0 A;  3V4Q A;  2E43 A;  3CCJ P;  1FZB A;  3NTE A;  2XZR A;  4W7Z A;  1LTB C;  1KIL D;  2R5B A;  3B5N D;  1KD1 Q;  2PEN A;  1LGH B;  1KZU B;  1NTM K;  1SQX K;  3M0A A;  3P7K A;  1FDM A;  3NXS A;  3OA7 A;  1GL2 A;  4XRO A;  3RK3 D;  1LTI C;  1HGV A;  3HE5 A;  4IFD K;  1NTK K;  2Q3I A;  3CLQ A;  5BVZ A;  2FFD A;  1K30 A;  4LLH A;  1Q86 Q;  1J1E B;  2I1J A;  1GK6 A;  1KQS O;  3CPW O;  2OYH B;  1FOS F;  3OAK A;  1SVF A;  1M74 A;  3GHG A;  1A02 J;  1FBM A;  2WSE H;  2P9X A;  2N1T A;  1RE3 C;  3BAS A;  4DZO A;  2M8N A;  1AQ5 A;  2OAR A;  4QNB A;  1N7L A;  1ZMB A;  4U0B A;  2Q9I A;  2WZ7 A;  3KPE A;  1N7S A;  3G1I A;  5HGL A;  3KQG A;  3HRN A;  5AVT B;  5APW A;  1YYC A;  5KTB A;  1E5W A;  1GTW A;  1LWU B;  5KLV K;  1KIL C;  2WIT A;  2WWW A;  1RF1 C;  4W80 A;  1CI6 A;  5HGM A;  3CCL P;  5AW6 B;  1KFM A;  1FZC A;  1FZF A;  2PEQ A;  3HTK B;  1OXZ A;  1QL1 A;  2XNX A;  3L35 A;  1URQ A;  1LTS C;  4JYC A;  3M1M A;  3G0V A;  4N6J A;  1RF0 A;  1YTZ T;  4EOT A;  2YKP A;  2E42 A;  1NU1 K;  1M1J B;  2YO3 A;  1FU1 A;  2FKW B;  1T3J A;  2MJZ A;  5APU A;  2JO0 A;  2A45 G;  3M0D A;  1HGZ A;  3VN0 A;  3DS4 A;  3PP5 A;  4WY4 B;  4EIJ A;  2NPS A;  1CW5 A;  3V5B A;  2W6A A;  1S9K D;  1ZR2 A;  3A7O A;  3B8E B;  4GIF A;  4U0A A;  2O1K A;  1VQ9 P;  5AW9 B;  3G71 P;  3P8M C;  1IK9 A;  5APY A;  3TSI A;  1FZG A;  2A45 H;  1N7S D;  1JTH B;  2BHV A;  3B5N A;  5CCG A;  1AUM A;  2C0X A;  3MGE A;  2EG5 A;  2IX7 C;  4WBA A;  1M7L A;  1K73 Q;  4XFY A;  1IJD B;  3NMD A;  1T2K C;  1YJW P;  4WYM A;  4COC A;  1NAF A;  3E2D A;  1YI2 P;  1AFO A;  2J59 M;  3V2Q A;  3VMX A;  2YO2 A;  1ZV8 A;  4IFM A;  4C7N A;  3Q20 A;  2FFD C;  5DCK A;  2WSF H;  1VQL P;  1IFN A;  1LTJ B;  1JY2 N;  3HE4 B;  1KC8 Q;  3GHG C;  3I5C A;  4C46 A;  2WTY A;  3M9B A;  4AUW A;  3EQ2 A;  1SFC B;  5I4T G;  1CZQ A;  2N1T C;  2KYV A;  1NKZ B;  2A45 I;  2XV6 A;  2LKM A;  2BUO A;  2OTL P;  3UIA A;  3HD7 D;  2DGY A;  3CD6 P;  4Y99 C;  1JNM A;  1DH3 A;  1N7S C;  2J58 A;  1LT9 A;  1XTG B;  1M1K Q;  1JY3 P;  1JCD A;  3RL0 B;  5F2O A;  2PEO A;  1IO4 A;  1J1D C;  1VQ6 P;  2PAJ A;  3OW2 O;  2N9B A;  2YKO A;  3M9H A;  1KFN A;  2WT7 B;  3MGN A;  2WPQ A;  1SFC D;  1SQV K;  2P7J A;  4JF7 A;  3G21 A;  3HYB A;  3P8C E;  1FZC C;  5CCG D;  2R5D A;  2L6E A;  1VQ4 P;  3H47 A;  2PP6 A;  1JY2 O;  5BU8 B;  1NHL A;  1VQM P;  1LWU A;  1N2D C;  1JUN A;  3A2A A;  1URQ C;  3N4X A;  5AVR B;  2HPC A;  4B86 A;  1RF0 C;  1SLQ A;  2WSC H;  4HH2 A;  3U59 A;  4N78 E;  2Q5U A;  3V2R A;  1QVF O;  3MIW A;  1HVV A;  3M0D C;  1JCC A;  2JYG A;  5CMZ A;  1HWT C;  3T97 A;  3A3Y B;  1FAV A;  1Z56 A;  3H32 A;  1W2B O;  3VTP C;  2NPS C;  5AW5 B;  3G6E P;  2W6B A;  5AVX B;  3CCU P;  3CC7 P;  3E1I A;  5CCH D;  3M91 A;  1PFI A;  2WPS A;  1SP4 A;  3IR9 A;  4OH8 B;  3B5N C;  4COP A;  1G2C B;  4WY4 A;  1NTZ K;  1RO0 A;  5CCG C;  2HLO A;  1X8Y A;  2PEJ A;  3L4F A;  3H4E A;  1A8O A;  4XFX A;  1J2J B;  2Z5I A;  1T3U A;  3RK3 C;  1MZ9 A;  4JYB A;  1JO5 A;  3C9I A;  1RO2 A;  1YHQ P;  3M06 A;  3LID A;  1ZLL A;  3M9Q A;  1IFJ A;  1D1D A;  1E6J P;  3CME P;  4N3Y B;  1N73 B;  1IFD A;  2Z44 A;  4GT1 A;  1EQ7 A;  2ZXE B;  1GL2 B;  2C0W A;  2CPS A;  3HE5 B;  3TK1 A;  1NH4 A;  3P05 A;  4LGD E;  1QL2 A;  2CWO A;  1QRJ A;  5AVZ B;  1FJK A;  1M6N A;  3HD7 A;  4U0E A;  2H7H A;  3O8Z A;  1VQ7 P;  5AW2 B;  1YJ9 P;  3MTU E;  1MV8 A;  4U0C A;  3GHG B;  5CCH C;  1L0N K;  3HUS B;  2N1T B;  1W2E A;  3TNU A;  4I6M C;  3IFM A;  1L4A B;  5AVU B;  3RG6 C;  1J1E C;  3RK2 B;  4DOJ A;  3DS3 A;  1LTJ A;  1LT9 C;  3CC2 P;  2OTJ P;  3VRL C;  4XA4 A;  2QM7 A;  4Y99 B;  1SFC A;  3CCR P;  3B5I A;  1JOC A;  4ZKU A;  1CSB A;  3N7N A;  1QVG O;  3I56 P;  3DS5 A;  2QEX P;  5APQ A;  1J1D B;  1H89 A;  2Z4E A;  1SQP K;  4XE5 B;  3CXC O;  4WY4 D;  5AW7 B;  1A02 F;  5AVQ B;  4W7Y A;  5AVW B;  2OYI A;  1LTT C;  5F2N A;  2JYL A;  5KJ7 A;  2FYZ A;  1HJB A;  1LWU C;  1JJ2 O;  3WMM 0;  3RK2 D;  5AVS B;  1FZC B;  1ZR4 A;  3DPH A;  1YIT P;  2WT7 A;  2KB7 P;  2XKM A;  1VQK P;  3LW5 H;  3I55 P;  1RNI A;  1SQB K;  2IFM A;  3NTN A;  1BAJ A;  1YTZ I;  1S9K E;  5BS1 A;  1K9M Q;  2Q7C A;  4M0I A;  1VQP P;  1GW3 A;  5CCH A;  1HUC A;  3BRV B;  3H0D A;  1RY3 A;  1NKN A;  5AW1 B;  1M1J C;  5AW4 B;  2P67 A;  2OYH A;  3BVH A;  2LF4 A;  4I2L C;  3VOP A;  3LRY A;  1VPC A;  2I1K A;  1NJI Q;  4IFF A;  4WY4 C;  2HFE D;  3G3Z A;  1KIL B;  1N86 A;  5BU5 A;  1RF1 B;  1OWA A;  3B5N B;  5APS A;  3II6 A;  3DS0 A;  3CCV P;  3NFQ A;  1G1I A;  2H8P D;  3CC4 P;  3RK3 B;  2M3B A;  2ZFC A;  3V2N A;  1JMM A;  2R32 A;  1XTC C;  1NWQ A;  1G2C A;  2IFN A;  3RL0 D;  5KJ7 D;  2VRS A;  2O01 H;  3CL3 D;  1JY3 N;  3HTK A;  1ZN5 A;  2CPB A;  3HD7 C;  4C7N B;  2JJL A;  1N73 A;  1HTL C;  1WRG A;  1RE4 A;  2Z46 A;  2FYU K;  3L36 A;  3G26 A;  2GM4 A;  1X79 B;  1DEB A;  1YJN P;  5AW0 B;  1M90 Q;  3SWY A;  2FXM A;  1M1J A;  5BS2 A;  1GD2 E;  1N8R Q;  4IPY A;  2HOD B;  1LTJ C;  1A43 A;  1Q7Y Q;  1VDF A;  5AW3 B;  1SFC C;  1MUU A;  1T8Z A;  1GZL A;  1LT9 B;  1IFI A;  3HUS A;  2XDJ A;  1L4A A;  2XT1 A;  4PH1 A;  2QM8 A;  1GDT A;  2C9L Y;  4O9B A;  1VQ8 P;  5AW8 B;  2OYI C;  3RL0 C;  1JY3 O;  3CMA P;  1HH0 A;  5KJ7 C;  1JTH A;  1GK4 A;  1FZE A;  4HYT B;  4GKG A;  2YKQ A;  5F2K A;  4M3L A;  3CCE P;  2XU6 A;  3KYQ A;  3CCS P;  2HPC B;  2GUV A;  3TYY A;  4XFZ A;  3G4S P;  1VQ5 P;  4U0F A;  2FFD B;  2M8L A;  1GU5 A;  1M6E X;  4ZKP A;  5CHX A;  2HG5 D;  2GUS A;  4I1L A;  2HYN A;  2JEE A;  2XXM A;  3MUD A;  3DS1 A;  3OJA B;  3LIE A;  1H8A A;  1GW4 A;  3DS2 A;  1NO4 A;  3H32 B;  4WB4 A;  3EFG A;  5APT A;  2KLV A;  2OYH C;  3HE4 A;  2EFJ A;  3H6P A;  1T2K D;  1GL2 D;  2PEK A;  1NOH A;  3BAT A;  3SWF A;  2XV5 A;  3U1C A;  1N7S B;  2KSJ A;  5APX A;  2KP8 A;  1HBW A;  2PEM A;  1GU4 A;  3VMY A;  4RES B;  3CI9 A;  2L5G B;  1RE3 A;  3WBH A;  2ONT A;  1Q82 Q;  2P1J A;  1CI6 B;  4KHX A;  2N1T D;  2YMY A;  1FJP A;  2YNY A;  4GR6 A;  1L4A D;  4LC1 A;  3VP8 A;  2H43 A;  4XRQ A;  3KDP B;  5HGN A;  3V2P A;  4AQR D;  1JY2 P;  1LTG C;  2POH A;  3MD0 A;  1X9V A;  1VQN P;  5HGO A;  1KIL A;  1LTA C;  2W27 A;  1RF1 A;  1URQ B;  3U1A A;  3CCQ P;  3DTJ A;  5AVV B;  4PH0 A;  3VMZ A;  5AVY B;  1YIJ P;  1N73 C;  3G29 A;  1WT6 A;  1RE4 C;  3G1G A;  3HZQ A;  4U0D A;  3HD7 B;  1GL2 C;  2KOD A;  1MFZ A;  3P8C D;  2P2U A;  2M8P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...