2OARA

Mechanosensitive channel of large conductance (mscl)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
125
structure length
125
Chain Sequence
MLKGFKEFLARGNIVDLAVAVVIGTAFTALVTKFTDSIITPLINRIGVNAQSDVGILRIGIGGGQTIDLNVLLSAAINFFLIAFAVYFLVVLPYNTLRKKGEVEQPGDTQVVLLTEIRDLLAQTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Large-conductance mechanosensitive channel
publication title Structures of the Prokaryotic Mechanosensitive Channels MscL and MscS
pubmed rcsb
source organism Mycobacterium tuberculosis h37ra
molecule tags Membrane protein
total genus 42
structure length 125
sequence length 125
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2006-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01741 MscL Large-conductance mechanosensitive channel, MscL
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.120 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2oarA01
1.20.5.220 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2oarA02
2FYUK 3CLQA 1NU1K 1L0NK 1L0LK 1SQPK 2O01H 1NTKK 2WSCH 3G3ZA 4IFDK 1SQVK 2WSFH 2WSEH 1NTMK 3LW5H 2LKMA 3M9QA 1SQXK 1SQQK 1NTZK 2OARA 3HZQA 1SQBK 2J59M 5KLVK
chains in the Genus database with same CATH superfamily
4H13B 1S4XA 2W8ZA 2E76B 2HYNA 2JKVA 5F2OA 5L8RJ 2RMZA 3I55P 1G2CB 2O01J 1KQSO 5KP8B 2WITA 5BVZA 1SQQK 1K8AQ 3H4EA 2O01N 1HF9A 1PIXA 3JCUH 1BXIA 3DPHA 1EDIA 1M1JA 4NEOA 1Z6MA 3BCCD 3KQGA 3BVHA 1L0IA 2CPBA 2KLVA 1RE3C 2L9FA 4EOTA 3GKLC 4PD4E 2LF4A 2OARA 1N73A 1Q86Q 1J1EB 1IK7A 2IDBA 2OYHB 2OYOA 4H2WC 2Z4EA 2V4HA 1SQVE 2LIUA 1SQPK 2JJLA 1ZOYC 4XFZA 2WSFJ 2YIUC 1NJIQ 3IFMA 4DT0A 3V5BA 3L74D 4N6JA 5KP6B 1R5LA 3M0DA 3GZLA 5KJ7C 1CEIA 2SPZA 1FJKA 1N8RQ 2QM8A 4N78E 1IFJA 2DGYA 1RE3A 3H25A 4H0LC 3CXHD 1BCCD 5DCKA 1FDIA 1SQQD 2WSSH 3RG6C 2IYPA 1ZLLA 1VKUA 2FQ0A 1D7MA 3F89A 3WBHA 5KKZB 1YHQP 4U7JA 2XZ0D 1IUQA 2XNDH 2MD9A 3AE4C 4F37A 4YXWH 5HGLA 5DJUB 4U0CA 1L0NK 2YXQB 1HWTC 3GW6A 2WQYC 1DH3A 1NOHA 1P84D 1G1JA 5APYA 2GUVA 3M9QA 4OGQD 2YMYA 1WRGA 2W90A 1AQ5A 1H0TB 5KJ7A 2M5AA 4GT1A 1PP9E 2FFDB 2QJKB 4Y99C 3FXEA 4IL6E 2XDJA 1BAJA 1SQXJ 3CCUP 3B5NC 1QVGO 2MVUA 3L75D 1BSNA 5BS1A 3DS0A 2GA1A 2KW2A 1MFTA 4U3FG 4JPZB 1T3UA 1QX8A 1EZVG 3BASA 3Q5SA 2Z46A 2O01H 1AYIA 1KQFB 4QMAA 4IL6X 3C9IA 3A7OA 1EZVI 2K37A 2JYLA 2NO8A 2LOLA 3B8EB 3ITKA 5GTHH 3SWFA 7CEIA 1RNIA 2KR5A 3U1AA 3GMAA 1N7SB 2Y0DA 3RK3E 1NHLA 2QIWA 2P10A 1OW7A 2PEIA 1GU4A 1NTKD 1UJZA 3H1KJ 1HUCA 2KOSA 1PP9J 2L0QA 3H1HG 1OVVA 3TNUB 3B5NA 4TT3H 3VYIA 2Y0CA 3EJDA 1GL2C 5DJTB 4I1LA 2OYIC 3AE7C 4IFMA 3O6QA 5HVCA 1JY2P 1KFMA 3P7KA 2KG9A 2JEEA 4I7ZC 4U3FE 1DEEG 2WSFH 1N7LA 2IBZG 3DS2A 2Z5HA 1MZ8A 2PY8A 1Q2NA 3RBXA 3ABVC 3BCCE 2FYUD 4L74A 2ZVNB 1RQVA 5APXA 1NTMK 3P32A 1LTJA 4W7ZA 2I8DA 2FHSC 2W6BA 1PFIA 1LNQA 1M1KQ 1GL2A 4OH8B 2LXCB 4PXHB 2N1TA 1HTLC 1KC8Q 4GR2A 1VQ5P 5AVWB 3NMDA 5JPAA 4GOFA 1GTWA 2N50A 3EJBA 1HQBA 1FOSF 1GDTA 2JU2A 3HUSB 1FDOA 3HYBA 2R3SA 1K05A 3QH9A 2W6AA 3IN6A 3MP7B 1BCCE 4XRQA 3MUDA 1SQQE 1N86A 2CG5B 3R2PA 2MR8A 3WMM0 1AUMA 1U57A 3GHGB 1JOCA 1FZAA 1DD3A 2YMKA 3N4XA 1EDJA 3OJAB 1QL1A 2M3EA 1SQBJ 3NXSA 4RESB 2JWAA 3C8VA 1NU1J 1M90Q 2X2BA 4N3YB 2JDIH 2LXBA 3E1RA 2ZAEB 1NO4A 3C1LA 3P05A 1ZMBA 1A02J 1KILD 4OGQC 1MUUA 3L74J 2OTLP 2N9BA 3E7KA 3DTJA 4NPFX 4HJGH 3KHUA 1J1EC 2OYHC 3V2NA 2XZRA 1BCCJ 3VOPA 1SQQJ 2Y9YA 3L73J 2Z44A 1Q81Q 2GZEA 3Q1MA 3AEBC 1VQ8P 5APWA 2FACA 2GZGA 2G3AA 3JCUE 3DS3A 1X79B 1YYCA 2QJYC 2HODA 1JCDA 1LT9A 2KSEA 2Q7CA 1OZHA 3U1CA 2WWWA 2Q9IA 1NTKE 1UIIA 3PRJA 1E79H 1BGYG 1MZ9A 1PV3A 5CCGC 1URQB 2KOQA 3DS1A 4W80A 4KT0J 5E79H 1SFCD 5KLVG 1SP4A 1YQ4C 3G71P 2AXCA 2K2QA 1T2KD 1W2BO 1CSBA 3L75J 2E74B 4BPGA 1IK9A 1ZXGA 3RL0B 2KODA 3VP8A 1USEA 5KJ7D 2KZIA 1YJNP 1AV1A 3M1MA 3WUTA 3E2DA 4R4LA 2XV5A 3HE4B 1PPJG 2A06D 2N6YA 1EOQA 2AFDA 1IFMA 2QJKC 1SQXD 4K3AA 1LWUB 1JNMA 2Y9ZA 2AEFA 2HG5D 1YJ9P 2FYUE 3CX5I 1M56D 5F2NA 2L6EA 3L72J 5HGNA 2O1KA 1L0NJ 3D71A 1BE3J 3JSVC 2KNCB 2KGDA 3HD7B 2QG4A 2E75B 4D6TG 2DW3A 5BS2A 1HGVA 4RJTA 3K5BA 2AVAA 1U7MA 4C7NA 1J1DC 1NH4A 2FQ1A 5KLVE 5AVXB 2LMLA 3CC2P 3L4FA 3Q5RA 4AUWA 3RK3B 1AVOA 3T97B 2E5YA 3H1IJ 2HPCB 5AVYB 4ZNCA 5CMZA 3H1KD 2MVVA 2N9YB 2M0BA 5KLIB 1YITP 3F5HA 1YBKA 1EQ7A 1OMIA 2XNXA 2MF4A 2H89C 2IYOA 3WUVA 1AVYA 2FYUJ 2K9JB 3II6A 3CXHH 1Q90D 3BATA 1DX7A 3GF7A 1EXIA 3FWNA 1AFOA 1BDCA 2ZT9B 2PEKA 4EYYQ 2K88A 1K04A 2PEQA 5HGMA 3H32A 5GTHE 2A45G 3NY7B 5AVTB 3PLNA 1FOSE 1KB9H 1AA0A 2CNRA 1RF0C 2QM7A 1E5WA 4ZKUA 2KWLA 1P84H 2OTJP 2A45I 2E5TA 2EIAA 1LTBC 3OA7A 5AW4B 1KILE 2KS1B 1FZCB 1Y8AA 1JY2O 1ACPA 3NFQA 5BU5A 5B5EH 4PD4I 1SQVG 3KZIH 1X0TA 5CZDB 2JWDA 2XKMA 3PJSK 4R4MA 3TYYA 2NPSB 1AJYA 2WT7A 1FDMA 2P9XA 1RF0A 1GZLA 3HUSC 1A02F 2Q1KA 2KUBA 1CI6B 1GXGA 1M7LA 1NTMJ 3AE2C 4UHPB 2FXPA 1BSHA 3O8ZA 3A0BH 2W83C 1KILA 1X9VA 1K9MQ 1J2JB 1IO4A 2NZ2A 4DJGA 4IZ6A 3GHGC 2FVAA 1L0HA 1SQBD 3RK2B 2R5BA 2KOOA 3RL0g 1NU1D 1L0LD 3EFFK 4K35A 2MKVA 1JY3P 1SFCC 5KAFE 2O1JA 1T2KC 1FZFA 1VQ9P 4H44B 3L35A 1T6AA 1PP9G 4A7PA 1M6EX 1L4AB 5APVA 1USDA 2M8NA 4XFXA 1KORA 2H8PD 4L75A 1MFZA 4QNBA 4PH0A 2A06E 1SQXE 1VF5B 1M57D 1RO0A 4H13D 3AE9C 3A2AA 3MGEA 2E76D 2FY8A 3L73D 2D2CB 1JY2N 2IX7C 2K0XA 1LJ2A 4IFFA 2J59M 2PRRA 4XE5B 1GW3A 4BWNA 3AEGC 1K73Q 1H8AA 1SFCA 4BXLA 1KB9D 3G3ZA 1QL2A 1LP1A 3RBZA 3ZDMA 5KP7B 4I2LC 1OVUA 3H1KE 3L70D 1EIAA 1KQLA 1SQPD 2JO0A 5AW5B 1GK6A 3CCSP 3HE5A 2M3BA 2POHA 3SFDC 4WVZA 2AFEA 1RE4C 3WU2H 3G1IA 3TGUD 4PWVB 2P2UA 3S4RA 1EC5A 4BPFA 2E74C 3RL0C 1GU5A 3G21A 2PAJA 2EHTA 4RO0A 5CJ0A 3G6EP 4PV1B 4XFJA 4QKOA 2ZXXA 3BCCG 2YKPA 1RH5B 1U7JA 5EW5E 1S9KD 4XA4A 1VQKP 3L72D 5CCGD 4JBZA 1L0ND 1BE3D 5AW8B 3MZWB 2JR8A 3M06A 1VQ7P 1EMVA 5E79E 5K5GB 2CWOA 3CCLP 3QWOC 3HD7C 3GG2A 1RE4A 1T3JA 3P8CD 4UB8H 2KG6A 2GDWA 1N2DC 1NAFA 2KGAA 2E75C 1NTZK 1FR2A 3PP5A 5AW3B 2IZ1A 4BRYB 5CCHC 3MD0A 3BRTB 3H1ID 2BHVA 3L74G 2B87A 4WY4B 2LR2A 2R44A 1ZP0C 4IOIH 4HH2A 1PGJA 2K0YA 1BCCG 2L22A 5H2FH 1SQQG 3L73G 4UB6H 2IBZI 3VMYA 1KYOH 3B4SA 1JTHA 2E1MA 5AVZB 1D1DA 1Y47A 1PGOA 3CI9A 1SQBE 4GODA 2CQ8A 2K5XA 2OYIA 1X3OA 4JYBA 4IPYA 1LTTC 1NU1E 1L0LE 1M1JB 1JO5A 2I1KA 1ZRTD 4YXDC 2IZ0A 1VQ6P 4AYCA 1N7SD 2GM4A 1RF1C 2EFJA 2L5GB 2LPKA 5KAFH 3MHVA 1ZV8A 1N73B 3V2QA 1NTZD 5AW2B 3L74E 3HTKA 1MKMA 1LTGC 5APSA 2PP6A 3TDKA 3CLQA 3L75G 3CXHE 2LTEA 2PNGA 3L73E 3L36A 2FADA 2LKIA 4H13C 3WUUA 2E76C 2M8PA 5AW1B 2KYVA 3PTZA 1M74A 3G1GA 1VQMP 3CX5D 3H1LD 3HZQA 1KB9E 5AVSB 2KOPA 1L0LJ 5CBOA 3H0DA 1RF1A 3VMAA 1P84E 2K1AA 2R32A 3TK1A 1VQ4P 2BASA 4Y28J 1QEXA 1NTMD 5HGOA 3VMXA 1NTKG 5AVVB 3B71A 3CWBD 4HYTB 5B5EE 3Q3DA 3L70E 1HGZA 1SQPE 3H1HJ 2EHSA 2I1JA 1RO2A 3KZIE 3H1JD 2ZVOB 4EIJA 4COCA 2ERHA 5AVUB 4JQ0D 3RK2C 2YIUB 2N5HA 1SQVK 2ZYDA 1H89A 2KIKA 3L75E 2BCCD 3E1IA 2H43A 1G2CA 1LGHB 2M5AB 3G0VA 1IFIA 2MJZA 1NKZB 2Q3IA 1FAVA 4H0LB 1KTMA 4H44C 2VLQA 3Q20A 2AXTE 3SFEC 3EJEA 2FXOA 4LC1A 2FYNB 2M8RA 2FYUG 1KYOD 1S9KE 1LTSC 3A0BE 3L72E 4WWIA 5AW0B 1FE6A 1L0NE 1BE3E 1JY3O 4GKGA 1EDLA 1GMJA 2WPSA 3L70J 5KTBA 1ZMEC 1SQPJ 2OYHA 1VPCA 1DNYA 5KKZC 3P8CE 2AEJA 3H47A 1OW8A 1AF8A 1NYHA 1DV5A 2DNWA 1KFNA 1VQPP 4U0EA 4YTPC 5F2KA 3U43A 4I6MC 2WSEJ 1FJPA 3SSUA 3TGUJ 1YI2P 4Y99B 2LL8A 4U0BA 2ZJSE 3FGAD 2Q3EA 3H1IE 4EDFA 2PFXA 2B88A 3D6YA 2PGDA 1NWQA 1M8OB 3B5NB 4ZKPA 4JF7A 4EI2A 1T8KA 2FFDC 2K92A 4MN4C 4WBAA 3M9HA 3O6QB 2YXRB 2HR3A 1YQ3C 5CCGA 1Z56A 2LIWA 4ZMDA 2XXMA 3AE1C 5EFWB 1IFDA 2XU6A 4N78D 4COPA 2FBWC 3JC22 1NTMG 4PV1C 1ZRTE 1A43A 1BDDA 2ZYAA 5B66H 1DIPA 4TLFA 1H0TA 3RG2A 1LTJB 4PH1A 2GZFA 1N7SC 1NTZE 2FFDA 4IFDK 1URQD 1GL2B 2XV6A 1JJ2O 1YTZI 2N1TB 2HLOA 2PENA 2V7QJ 3WU2E 4L73A 1LT1A 3A3YB 2E74D 1LTAC 3RL0D 1JY3N 1UNKA 3U59A 1ZR2A 1HJBA 1Y9BA 1VQLP 2J5UA 2R5DA 2JBGA 1NVOA 3L37A 3BRVB 1OFCX 2QE7H 2B89A 1NTME 1N7SA 3A0HH 2XT1A 1MV8A 1VQOP 5CBNA 3CWBE 1K30A 3HD7D 3M0AA 4PJ0H 2ROQA 1NTZJ 4UB8E 3CCJP 2E75D 3TNUA 3M9BA 2GUSA 3EQ2A 1Q7YQ 4GOEA 3GZMA 2PEOA 2AEMA 2KGCA 3KXDA 4XROA 1M1JC 2FAEA 5CCHD 3RK3D 2CK3H 2BCCE 4YPCA 2WSEH 1E6JP 3MTUE 2JGPA 2LKMA 3GF3A 4U0AA 3VRLC 4RKUJ 3H1LJ 3L71J 2A06G 1KV4A 1RHZB 3MIWA 5H2FE 1SQXG 2QNWA 2K3RA 4UB6E 1ZNVA 2AXTH 2C0XA 2XZ1C 3CMAP 1KYOE 2KXPB 3IF4A 4LLHA 4U3FD 5TISH 2IFMA 3RGUA 1KMIZ 2KOGA 3SWKA 5KAIH 2ZT9D 2ZXEB 3CWBJ 2WMMA 3KYQA 1EZVD 2L91A 1R5SA 1FZGA 3CXCO 2QRXA 4D6TJ 2QEXP 3H1JJ 1HBWA 1S5LH 2HODB 3M0DC 1LT9B 2PEJA 2KI7B 4OGQB 5M1BA 4DCKA 4HKGA 2WPRA 3FWLA 1GPJA 2BCCJ 5AW7B 2JP3A 3SWYA 3H1KG 3NTEA 2M5RA 2G8YA 3HUSA 3H1HD 5BU8B 2P7JA 1SLQA 3LRYA 1YJWP 2WZ7A 2V7QH 3V4WA 1X22A 1FZEA 2L4BA 3GHGA 2RN0A 2NPSD 1PZQA 2QJYB 1F80D 2IBZD 4ASWA 1FU1A 2RKLA 4KJMA 2E42A 3AECC 1JEKA 3B5IA 4XFYA 2OQQA 1QVFO 3CC4P 4B86A 3LW5J 2FYNC 3D6ZA 2JB0A 2HFED 2C9NY 5I4TG 3CMEP 1SQVJ 1NTKK 3FX0A 3RK2D 5GTIH 1GK4A 4C7NB 2JAZA 3OW2O 2VLNA 1URQC 2YKQA 1FZBA 1KZUB 1IMPA 3Q2YA 1FS0E 4H44D 3KDPB 2QJPB 1KQGB 1L4AD 4GIFA 4O9BA 1IMQA 2NRGA 2YO3A 3D70A 1T8ZA 1VF5D 2IPPA 1DEBA 3CX5H 2B9BA 1JUNA 3G29A 2RH0A 4ASVA 2D2CD 3G4SP 1LWUC 1YIJP 1KLPA 3NTNA 1SVFA 2FYUK 3USSA 1H88A 2JU1A 3PHLA 1E0HA 2WVRA 1J1DB 1SQBG 2GZIA 1URQA 3H32B 1NQ4A 2MY5A 1NU1G 2KK7A 1L0LG 2WTYA 3I56P 1SS1A 1RY3A 2YKOA 3S9OA 5KLVK 1GW4A 2KB7P 3Q5PA 1OR5A 4WYMA 2VRSA 3RK3C 2O3JA 4MRTC 3HE4A 1LTJC 3P8MC 1W5CE 2VLPA 1EXJA 1LWUA 4C7RA 2N1TC 5KLIC 4H2YC 2C9LY 2GZJA 1TU3F 3IR9A 2P67A 3CXHI 3LIDA 3DS4A 2CGQA 2KNCA 3HD7A 1EZVE 1VHNA 1NAYA 2WT7B 1S2EA 5HV8A 2KZJA 1FBMA 2KORA 2ONTA 2ZYGA 3TF5A 2ZT9C 4PV1D 2Z5IA 1IFPA 2R3CA 2A45H 2Z45A 5B66E 1KB9I 2K94A 5CCHA 1R8EA 1IZNB 3T97A 3MUDC 1P84I 3LMOA 1LTIC 3AEEC 2K9YA 2JO1A 1KILB 2HPCA 3CPWO 3LW5H 3L70G 3CE7A 4PD4H 3N7NA 1SQPG 5AW9B 1BGYD 3EFGA 2N5IA 3H1HE 1FZCC 3V4QA 2KG8A 3AE6C 1S1CX 5KLVD 2OGUA 2KGEA 2C0WA 1CW5A 1JMBA 1DD4A 3TGUG 3B4QA 1AQTA 1HVVA 1ZR4A 2K9JA 2K93A 3FXDA 4U3FJ 3HRNA 5APQA 3GLMA 2WPQA 2WSCJ 2BUOA 4WY4D 5APTA 1JB0J 1EDKA 2IBZE 2W27A 4DG9A 1FC2C 1PL5A 1PGQA 3W67A 2BEQD 3L71D 1PPJD 2NPSC 2K0DX 4AQRD 3AEAC 3BCCJ 3A0HE 5AVQB 3L72G 1GD2E 1VL2A 2GYKA 1A8OA 2VSQA 1L0NG 4PJ0E 1BE3G 2KS1A 1FZCA 1VQNP 4W7YA 2VLOA 4KHXA 1ZW0A 5AVRB 2FXMA 2QSIA 5AW6B 2JQ4A 2QVAA 4D6TD 3VTPC 1SFCB 1NGMB 3CC7P 3M91A 2H7HA 3I5CA 1OW6A 1LP1B 5CJ4A 1LT9C 1OIPA 3TGUE 4DOJA 3H1IG 1HH0A 2NPSA 4U0DA 2M8LA 4HB1A 4NPEA 3HE5B 1PGPA 1L4AC 3R4YA 1KN7A 4IL6H 1Q82Q 1CI6A 1HJ0A 5TISE 2EG5A 1SQXK 2E43A 5KAIE 1VF5C 3OAKA 4DZOA 2W6JH 2D2CC 3G9RA 1S5LE 2YNYA 4CPGA 1W2EA 5APUA 1IC2A 3W68A 2H88C 3CCRP 2Y0EA 3TSIA 3S1KA 2P1JA 1IFNA 1XTCC 2MR7A 2YO2A 4PD4D 1S72P 3V2PA 1NTZG 3LIEA 1S5LX 1L4AA 1HY8A 4OWFA 2PEMA 4CA3A 4M0IA 2WPVB 1SQVD 2FVFA 2CPSA 2GDYA 5C39A 1WT6A 2OTKE 1YTZT 1RQUA 4M3LA 3G26A 4L76A 3CD6P 1GXHA 2B87B 1XTGB 4H0LD 2GDXA 2WSCH 3H1LG 3L71G 2KLUA 1UIXA 2QJPC 1KD1Q 3AE3C 1OXZA 3KPEA 3PH0A 1WMKA 1L2PA 1ZN5A 3VN0A 3IAOA 3CWBG 3H6PA 1IJDB 1JTHB 1NTKJ 4GR6A 2Q6QA 3V6IA 1BGYE 2JYGA 2N98A 1JMMA 5GTIE 2N6ZA 3H1JG 4JYCA 2OYIB 3CCQP 2FVEA 4HKZH 3VP9A 5EJDA 3AEFC 4I7ZB 4R0MA 2BCCG 3CCVP 1NKNA 4WB4A 1QLED 1PP9D 3HTKB 4GDOA 3B5ND 2FYZA 2KP8A 1M6NA 4BPHA 1QRJA 2WPTA 3CX5E 3H1LE 3L71E 3AE5C 1PPJE 4WY4C 3VMZA 3V2RA 4C46A 3DS5A 3CCMP 3GJNA 1OX3A 4LGDE 2FKWB 1JCCA 1QGKB 1KYOI 3EWKA 1G1IA 1BGYJ 2BEZF 4Z1MH 1S3JA 4D6TE 3H1JE 5KLVJ 1RF1B 3AEDC 1SQBK 3CL3D 4NPDA 5CHXA 4H2XC 2J58A 2Q5UA 1NU1K 2ZFCA 1L0LK 1X8YA 3AE8C 1JM0A 2P58A 2QA4P 4U0FA 5TJHA 3MGNA 4BRYA 2AF8A 3UIAA 4WY4A 4OVNF 2IFNA 3A5TA 1GL2D 1OVRA 2FQ2A 1KILC 1CZQA 2N1TD 2ITAA 2UWJE 3CCEP 1OWAA 1N73C 1VDFA 2KSJA 3G28A
chains in the Genus database with same CATH topology
3M1MA 3CLQA 1L4AD 4GIFA 4O9BA 3E2DA 2YO3A 2XV5A 2HYNA 3HE4B 3L36A 5F2OA 1T8ZA 3I55P 1G2CB 1EOQA 1IFMA 1KQSO 2IPPA 1LWUB 2WITA 1DEBA 5BVZA 1SQQK 1JNMA 1K8AQ 2M8PA 5AW1B 2KYVA 3H4EA 1YJ9P 2HG5D 1JUNA 3G29A 1M74A 5F2NA 3G1GA 2L6EA 1VQMP 3G4SP 5HGNA 1LWUC 2O1KA 1YIJP 3DPHA 3HZQA 5AVSB 3NTNA 1SVFA 1M1JA 2FYUK 1H88A 3H0DA 1RF1A 3HD7B 3KQGA 2R32A 3TK1A 3BVHA 1VQ4P 2BASA 1J1DB 2CPBA 1URQA 2KLVA 3H32B 1RE3C 5HGOA 4EOTA 5BS2A 1HGVA 3VMXA 2WTYA 4C7NA 3I56P 5AVVB 2LF4A 4HYTB 1J1DC 1NH4A 1RY3A 2YKOA 2OARA 1N73A 5AVXB 1Q86Q 3CC2P 1HGZA 3L4FA 1J1EB 2OYHB 2I1JA 4AUWA 3RK3B 1RO2A 5KLVK 2Z4EA 1GW4A 4EIJA 2KB7P 4COCA 2HPCB 1SQPK 5AVUB 5AVYB 4WYMA 2JJLA 5CMZA 2VRSA 3RK3C 3RK2C 1SQVK 1H89A 3E1IA 4XFZA 3HE4A 1YITP 1LTJC 3P8MC 2H43A 1G2CA 1LGHB 3G0VA 1IFIA 1LWUA 1NJIQ 2MJZA 3IFMA 4C7RA 3V5BA 2N1TC 1EQ7A 1NKZB 4N6JA 2Q3IA 2C9LY 2XNXA 1FAVA 3M0DA 3Q20A 5KJ7C 3II6A 1FJKA 3BATA 1N8RQ 1DX7A 2QM8A 3IR9A 4N78E 1IFJA 2DGYA 1RE3A 2P67A 3LIDA 1AFOA 3DS4A 4LC1A 3HD7A 3KDPB 2PEKA 2M8RA 2WT7B 5DCKA 3RG6C 1FBMA 2PEQA 1S9KE 2ONTA 5HGMA 1LTSC 3H32A 1ZLLA 2Z5IA 5AW0B 3WBHA 2A45G 1YHQP 2R3CA 1IUQA 1JY3O 4GKGA 5AVTB 1FOSE 2WPSA 5HGLA 2A45H 1RF0C 5KTBA 2QM7A 1E5WA 2Z45A 4ZKUA 2OYHA 1VPCA 4U0CA 1L0NK 5CCHA 2OTJP 2A45I 3T97A 3P8CE 1HWTC 2EIAA 1LTBC 3H47A 3OA7A 5AW4B 1LTIC 1FZCB 1NOHA 1KILB 1DH3A 2HPCA 1G1JA 3CPWO 1JY2O 1VQPP 1KFNA 3LW5H 4U0EA 5APYA 5F2KA 2GUVA 3M9QA 3N7NA 3NFQA 5AW9B 4I6MC 5BU5A 3EFGA 1FJPA 1YI2P 1WRGA 2YMYA 1FZCC 4Y99B 1AQ5A 4U0BA 3V4QA 5KJ7A 4GT1A 1CW5A 2C0WA 1NWQA 2FFDB 3B5NB 4Y99C 1HVVA 1ZR4A 4ZKPA 4JF7A 3HRNA 5APQA 2XDJA 1BAJA 2XKMA 3CCUP 2WPQA 2FFDC 3TYYA 3B5NC 4WBAA 2BUOA 4WY4D 5APTA 3M9HA 2NPSB 1QVGO 2WT7A 5BS1A 3DS0A 1FDMA 2W27A 2P9XA 1RF0A 1T3UA 1GZLA 2NPSC 5CCGA 3HUSC 1A02F 1Z56A 4AQRD 1CI6B 3BASA 2Z46A 1M7LA 2O01H 5AVQB 2XXMA 1GD2E 1IFDA 1A8OA 2XU6A 3C9IA 4N78D 4COPA 3A7OA 2JYLA 3O8ZA 1FZCA 1VQNP 1KILA 1X9VA 3B8EB 1K9MQ 1J2JB 3SWFA 1IO4A 4W7YA 4KHXA 2PP6A 1A43A 1RNIA 3GHGC 5AVRB 2FXMA 3U1AA 5AW6B 1N7SB 1NHLA 3RK2B 3VTPC 1SFCB 2R5BA 2PEIA 1GU4A 3CC7P 3M91A 2H7HA 1HUCA 1LTJB 3I5CA 4PH1A 1N7SC 1JY3P 5CJ4A 2FFDA 4IFDK 1URQD 3TNUB 1GL2B 1SFCC 3B5NA 1LT9C 2O1JA 2XV6A 1JJ2O 1YTZI 2N1TB 2HLOA 2PENA 3VYIA 1T2KC 4DOJA 1FZFA 1VQ9P 3L35A 1GL2C 1HH0A 4I1LA 2OYIC 4IFMA 2NPSA 1M6EX 1L4AB 5APVA 1JY2P 4U0DA 2M8NA 4XFXA 2M8LA 1KFMA 3A3YB 3P7KA 2H8PD 1MFZA 1LTAC 4QNBA 3RL0D 1JY3N 4PH0A 2JEEA 3HE5B 3U59A 1L4AC 1ZR2A 1HJBA 1VQLP 1RO0A 1Q82Q 1CI6A 2R5DA 2WSFH 3A2AA 3MGEA 1N7LA 3DS2A 2Z5HA 2PY8A 2EG5A 1SQXK 2E43A 3L37A 3OAKA 1JY2N 2IX7C 3BRVB 4DZOA 4IFFA 2J59M 4XE5B 1GW3A 2YNYA 1N7SA 1K73Q 2XT1A 1W2EA 1H8AA 1SFCA 1MV8A 5APUA 1VQOP 1IC2A 1K30A 3G3ZA 3HD7D 3M0AA 1QL2A 5APXA 1NTMK 3P32A 1LTJA 3CCRP 4W7ZA 2W6BA 3CCJP 3TSIA 1PFIA 1M1KQ 1GL2A 3TNUA 3M9BA 2GUSA 4OH8B 3EQ2A 2N1TA 1HTLC 1KC8Q 2P1JA 1IFNA 4I2LC 1XTCC 1Q7YQ 4GR2A 2YO2A 1VQ5P 2PEOA 1S72P 3V2PA 5AVWB 3NMDA 3LIEA 1EIAA 1L4AA 1KQLA 4XROA 1M1JC 5JPAA 2JO0A 5AW5B 3RK3D 2PEMA 5CCHD 4M0IA 1GK6A 1GTWA 3CCSP 2WSEH 3HE5A 1E6JP 2CPSA 3MTUE 2LKMA 2M3BA 1FOSF 2POHA 1GDTA 1RE4C 4U0AA 1WT6A 3VRLC 3G1IA 3HUSB 3HYBA 1YTZT 4M3LA 2P2UA 3MIWA 3G26A 2W6AA 3CD6P 2C0XA 4XRQA 1XTGB 3RL0C 3MUDA 3CMAP 1GU5A 1N86A 2WSCH 3G21A 2PAJA 4LLHA 3R2PA 5CJ0A 3WMM0 3G6EP 1AUMA 2IFMA 3GHGB 1KD1Q 1JOCA 1FZAA 2KOGA 2ZXEB 2YKPA 3KYQA 3N4XA 1OXZA 3OJAB 3KPEA 1QL1A 1FZGA 3CXCO 3NXSA 1ZN5A 4RESB 3VN0A 1S9KD 2QEXP 4XA4A 1VQKP 1HBWA 5CCGD 3H6PA 1M90Q 1IJDB 1JTHB 2HODB 3M0DC 4N3YB 1LT9B 5AW8B 2PEJA 3M06A 4GR6A 1VQ7P 2JYGA 2CWOA 1JMMA 3CCLP 1NO4A 2WPRA 3HD7C 4JYCA 1RE4A 2OYIB 1T3JA 3P8CD 3CCQP 3P05A 5AW7B 1N2DC 1ZMBA 3SWYA 3VP9A 1NAFA 1A02J 1KILD 1MUUA 1NTZK 3NTEA 3PP5A 2OTLP 5AW3B 2N9BA 3HUSA 3DTJA 5BU8B 3CCVP 2P7JA 1SLQA 3LRYA 1YJWP 1NKNA 4WB4A 1J1EC 2OYHC 3V2NA 2WZ7A 5CCHC 3MD0A 3BRTB 2XZRA 2BHVA 4WY4B 3HTKB 3VOPA 3B5ND 2FYZA 2Z44A 1M6NA 2KP8A 3V4WA 1Q81Q 4HH2A 1QRJA 1VQ8P 1FZEA 4WY4C 3GHGA 5APWA 3VMZA 2NPSD 3V2RA 4C46A 3DS5A 3DS3A 3VMYA 1FU1A 3CCMP 1X79B 2E42A 4LGDE 2FKWB 1JCCA 1YYCA 1JTHA 2HODA 1JCDA 2E1MA 5AVZB 1D1DA 3B5IA 1LT9A 4XFYA 2Q7CA 1G1IA 1QVFO 3CC4P 3CI9A 4B86A 2OYIA 3U1CA 4JYBA 4IPYA 1LTTC 1M1JB 2WWWA 2Q9IA 1RF1B 1JO5A 1SQBK 2HFED 3CL3D 2I1KA 5CHXA 2C9NY 1MZ9A 5I4TG 2J58A 5CCGC 1URQB 3CMEP 1VQ6P 1NU1K 1L0LK 2Q5UA 1N7SD 2ZFCA 4AYCA 1X8YA 3DS1A 2GM4A 1NTKK 4W80A 1RF1C 2EFJA 3RK2D 1SFCD 2L5GB 1GK4A 1SP4A 2QA4P 4U0FA 4C7NB 3OW2O 3MGNA 3G71P 1URQC 1ZV8A 2YKQA 3UIAA 1T2KD 1W2BO 1FZBA 1KZUB 4WY4A 3V2QA 1N73B 1CSBA 5AW2B 2IFNA 3HTKA 3A5TA 1GL2D 1KILC 1IK9A 1CZQA 2N1TD 3RL0B 2KODA 1LTGC 3CCEP 1OWAA 1N73C 3VP8A 5APSA 5KJ7D 1VDFA 1YJNP 2KSJA 3G28A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FYU K;  3CLQ A;  1NU1 K;  1L0N K;  1L0L K;  1SQP K;  2O01 H;  1NTK K;  2WSC H;  3G3Z A;  4IFD K;  1SQV K;  2WSF H;  2WSE H;  1NTM K;  3LW5 H;  2LKM A;  3M9Q A;  1SQX K;  1SQQ K;  1NTZ K;  2OAR A;  3HZQ A;  1SQB K;  2J59 M;  5KLV K; 
#chains in the Genus database with same CATH topology
 4H13 B;  1S4X A;  2W8Z A;  2E76 B;  2HYN A;  2JKV A;  5F2O A;  5L8R J;  2RMZ A;  3I55 P;  1G2C B;  2O01 J;  1KQS O;  5KP8 B;  2WIT A;  5BVZ A;  1SQQ K;  1K8A Q;  3H4E A;  2O01 N;  1HF9 A;  1PIX A;  3JCU H;  1BXI A;  3DPH A;  1EDI A;  1M1J A;  4NEO A;  1Z6M A;  3BCC D;  3KQG A;  3BVH A;  1L0I A;  2CPB A;  2KLV A;  1RE3 C;  2L9F A;  4EOT A;  3GKL C;  4PD4 E;  2LF4 A;  2OAR A;  1N73 A;  1Q86 Q;  1J1E B;  1IK7 A;  2IDB A;  2OYH B;  2OYO A;  4H2W C;  2Z4E A;  2V4H A;  1SQV E;  2LIU A;  1SQP K;  2JJL A;  1ZOY C;  4XFZ A;  2WSF J;  2YIU C;  1NJI Q;  3IFM A;  4DT0 A;  3V5B A;  3L74 D;  4N6J A;  5KP6 B;  1R5L A;  3M0D A;  3GZL A;  5KJ7 C;  1CEI A;  2SPZ A;  1FJK A;  1N8R Q;  2QM8 A;  4N78 E;  1IFJ A;  2DGY A;  1RE3 A;  3H25 A;  4H0L C;  3CXH D;  1BCC D;  5DCK A;  1FDI A;  1SQQ D;  2WSS H;  3RG6 C;  2IYP A;  1ZLL A;  1VKU A;  2FQ0 A;  1D7M A;  3F89 A;  3WBH A;  5KKZ B;  1YHQ P;  4U7J A;  2XZ0 D;  1IUQ A;  2XND H;  2MD9 A;  3AE4 C;  4F37 A;  4YXW H;  5HGL A;  5DJU B;  4U0C A;  1L0N K;  2YXQ B;  1HWT C;  3GW6 A;  2WQY C;  1DH3 A;  1NOH A;  1P84 D;  1G1J A;  5APY A;  2GUV A;  3M9Q A;  4OGQ D;  2YMY A;  1WRG A;  2W90 A;  1AQ5 A;  1H0T B;  5KJ7 A;  2M5A A;  4GT1 A;  1PP9 E;  2FFD B;  2QJK B;  4Y99 C;  3FXE A;  4IL6 E;  2XDJ A;  1BAJ A;  1SQX J;  3CCU P;  3B5N C;  1QVG O;  2MVU A;  3L75 D;  1BSN A;  5BS1 A;  3DS0 A;  2GA1 A;  2KW2 A;  1MFT A;  4U3F G;  4JPZ B;  1T3U A;  1QX8 A;  1EZV G;  3BAS A;  3Q5S A;  2Z46 A;  2O01 H;  1AYI A;  1KQF B;  4QMA A;  4IL6 X;  3C9I A;  3A7O A;  1EZV I;  2K37 A;  2JYL A;  2NO8 A;  2LOL A;  3B8E B;  3ITK A;  5GTH H;  3SWF A;  7CEI A;  1RNI A;  2KR5 A;  3U1A A;  3GMA A;  1N7S B;  2Y0D A;  3RK3 E;  1NHL A;  2QIW A;  2P10 A;  1OW7 A;  2PEI A;  1GU4 A;  1NTK D;  1UJZ A;  3H1K J;  1HUC A;  2KOS A;  1PP9 J;  2L0Q A;  3H1H G;  1OVV A;  3TNU B;  3B5N A;  4TT3 H;  3VYI A;  2Y0C A;  3EJD A;  1GL2 C;  5DJT B;  4I1L A;  2OYI C;  3AE7 C;  4IFM A;  3O6Q A;  5HVC A;  1JY2 P;  1KFM A;  3P7K A;  2KG9 A;  2JEE A;  4I7Z C;  4U3F E;  1DEE G;  2WSF H;  1N7L A;  2IBZ G;  3DS2 A;  2Z5H A;  1MZ8 A;  2PY8 A;  1Q2N A;  3RBX A;  3ABV C;  3BCC E;  2FYU D;  4L74 A;  2ZVN B;  1RQV A;  5APX A;  1NTM K;  3P32 A;  1LTJ A;  4W7Z A;  2I8D A;  2FHS C;  2W6B A;  1PFI A;  1LNQ A;  1M1K Q;  1GL2 A;  4OH8 B;  2LXC B;  4PXH B;  2N1T A;  1HTL C;  1KC8 Q;  4GR2 A;  1VQ5 P;  5AVW B;  3NMD A;  5JPA A;  4GOF A;  1GTW A;  2N50 A;  3EJB A;  1HQB A;  1FOS F;  1GDT A;  2JU2 A;  3HUS B;  1FDO A;  3HYB A;  2R3S A;  1K05 A;  3QH9 A;  2W6A A;  3IN6 A;  3MP7 B;  1BCC E;  4XRQ A;  3MUD A;  1SQQ E;  1N86 A;  2CG5 B;  3R2P A;  2MR8 A;  3WMM 0;  1AUM A;  1U57 A;  3GHG B;  1JOC A;  1FZA A;  1DD3 A;  2YMK A;  3N4X A;  1EDJ A;  3OJA B;  1QL1 A;  2M3E A;  1SQB J;  3NXS A;  4RES B;  2JWA A;  3C8V A;  1NU1 J;  1M90 Q;  2X2B A;  4N3Y B;  2JDI H;  2LXB A;  3E1R A;  2ZAE B;  1NO4 A;  3C1L A;  3P05 A;  1ZMB A;  1A02 J;  1KIL D;  4OGQ C;  1MUU A;  3L74 J;  2OTL P;  2N9B A;  3E7K A;  3DTJ A;  4NPF X;  4HJG H;  3KHU A;  1J1E C;  2OYH C;  3V2N A;  2XZR A;  1BCC J;  3VOP A;  1SQQ J;  2Y9Y A;  3L73 J;  2Z44 A;  1Q81 Q;  2GZE A;  3Q1M A;  3AEB C;  1VQ8 P;  5APW A;  2FAC A;  2GZG A;  2G3A A;  3JCU E;  3DS3 A;  1X79 B;  1YYC A;  2QJY C;  2HOD A;  1JCD A;  1LT9 A;  2KSE A;  2Q7C A;  1OZH A;  3U1C A;  2WWW A;  2Q9I A;  1NTK E;  1UII A;  3PRJ A;  1E79 H;  1BGY G;  1MZ9 A;  1PV3 A;  5CCG C;  1URQ B;  2KOQ A;  3DS1 A;  4W80 A;  4KT0 J;  5E79 H;  1SFC D;  5KLV G;  1SP4 A;  1YQ4 C;  3G71 P;  2AXC A;  2K2Q A;  1T2K D;  1W2B O;  1CSB A;  3L75 J;  2E74 B;  4BPG A;  1IK9 A;  1ZXG A;  3RL0 B;  2KOD A;  3VP8 A;  1USE A;  5KJ7 D;  2KZI A;  1YJN P;  1AV1 A;  3M1M A;  3WUT A;  3E2D A;  4R4L A;  2XV5 A;  3HE4 B;  1PPJ G;  2A06 D;  2N6Y A;  1EOQ A;  2AFD A;  1IFM A;  2QJK C;  1SQX D;  4K3A A;  1LWU B;  1JNM A;  2Y9Z A;  2AEF A;  2HG5 D;  1YJ9 P;  2FYU E;  3CX5 I;  1M56 D;  5F2N A;  2L6E A;  3L72 J;  5HGN A;  2O1K A;  1L0N J;  3D71 A;  1BE3 J;  3JSV C;  2KNC B;  2KGD A;  3HD7 B;  2QG4 A;  2E75 B;  4D6T G;  2DW3 A;  5BS2 A;  1HGV A;  4RJT A;  3K5B A;  2AVA A;  1U7M A;  4C7N A;  1J1D C;  1NH4 A;  2FQ1 A;  5KLV E;  5AVX B;  2LML A;  3CC2 P;  3L4F A;  3Q5R A;  4AUW A;  3RK3 B;  1AVO A;  3T97 B;  2E5Y A;  3H1I J;  2HPC B;  5AVY B;  4ZNC A;  5CMZ A;  3H1K D;  2MVV A;  2N9Y B;  2M0B A;  5KLI B;  1YIT P;  3F5H A;  1YBK A;  1EQ7 A;  1OMI A;  2XNX A;  2MF4 A;  2H89 C;  2IYO A;  3WUV A;  1AVY A;  2FYU J;  2K9J B;  3II6 A;  3CXH H;  1Q90 D;  3BAT A;  1DX7 A;  3GF7 A;  1EXI A;  3FWN A;  1AFO A;  1BDC A;  2ZT9 B;  2PEK A;  4EYY Q;  2K88 A;  1K04 A;  2PEQ A;  5HGM A;  3H32 A;  5GTH E;  2A45 G;  3NY7 B;  5AVT B;  3PLN A;  1FOS E;  1KB9 H;  1AA0 A;  2CNR A;  1RF0 C;  2QM7 A;  1E5W A;  4ZKU A;  2KWL A;  1P84 H;  2OTJ P;  2A45 I;  2E5T A;  2EIA A;  1LTB C;  3OA7 A;  5AW4 B;  1KIL E;  2KS1 B;  1FZC B;  1Y8A A;  1JY2 O;  1ACP A;  3NFQ A;  5BU5 A;  5B5E H;  4PD4 I;  1SQV G;  3KZI H;  1X0T A;  5CZD B;  2JWD A;  2XKM A;  3PJS K;  4R4M A;  3TYY A;  2NPS B;  1AJY A;  2WT7 A;  1FDM A;  2P9X A;  1RF0 A;  1GZL A;  3HUS C;  1A02 F;  2Q1K A;  2KUB A;  1CI6 B;  1GXG A;  1M7L A;  1NTM J;  3AE2 C;  4UHP B;  2FXP A;  1BSH A;  3O8Z A;  3A0B H;  2W83 C;  1KIL A;  1X9V A;  1K9M Q;  1J2J B;  1IO4 A;  2NZ2 A;  4DJG A;  4IZ6 A;  3GHG C;  2FVA A;  1L0H A;  1SQB D;  3RK2 B;  2R5B A;  2KOO A;  3RL0 g;  1NU1 D;  1L0L D;  3EFF K;  4K35 A;  2MKV A;  1JY3 P;  1SFC C;  5KAF E;  2O1J A;  1T2K C;  1FZF A;  1VQ9 P;  4H44 B;  3L35 A;  1T6A A;  1PP9 G;  4A7P A;  1M6E X;  1L4A B;  5APV A;  1USD A;  2M8N A;  4XFX A;  1KOR A;  2H8P D;  4L75 A;  1MFZ A;  4QNB A;  4PH0 A;  2A06 E;  1SQX E;  1VF5 B;  1M57 D;  1RO0 A;  4H13 D;  3AE9 C;  3A2A A;  3MGE A;  2E76 D;  2FY8 A;  3L73 D;  2D2C B;  1JY2 N;  2IX7 C;  2K0X A;  1LJ2 A;  4IFF A;  2J59 M;  2PRR A;  4XE5 B;  1GW3 A;  4BWN A;  3AEG C;  1K73 Q;  1H8A A;  1SFC A;  4BXL A;  1KB9 D;  3G3Z A;  1QL2 A;  1LP1 A;  3RBZ A;  3ZDM A;  5KP7 B;  4I2L C;  1OVU A;  3H1K E;  3L70 D;  1EIA A;  1KQL A;  1SQP D;  2JO0 A;  5AW5 B;  1GK6 A;  3CCS P;  3HE5 A;  2M3B A;  2POH A;  3SFD C;  4WVZ A;  2AFE A;  1RE4 C;  3WU2 H;  3G1I A;  3TGU D;  4PWV B;  2P2U A;  3S4R A;  1EC5 A;  4BPF A;  2E74 C;  3RL0 C;  1GU5 A;  3G21 A;  2PAJ A;  2EHT A;  4RO0 A;  5CJ0 A;  3G6E P;  4PV1 B;  4XFJ A;  4QKO A;  2ZXX A;  3BCC G;  2YKP A;  1RH5 B;  1U7J A;  5EW5 E;  1S9K D;  4XA4 A;  1VQK P;  3L72 D;  5CCG D;  4JBZ A;  1L0N D;  1BE3 D;  5AW8 B;  3MZW B;  2JR8 A;  3M06 A;  1VQ7 P;  1EMV A;  5E79 E;  5K5G B;  2CWO A;  3CCL P;  3QWO C;  3HD7 C;  3GG2 A;  1RE4 A;  1T3J A;  3P8C D;  4UB8 H;  2KG6 A;  2GDW A;  1N2D C;  1NAF A;  2KGA A;  2E75 C;  1NTZ K;  1FR2 A;  3PP5 A;  5AW3 B;  2IZ1 A;  4BRY B;  5CCH C;  3MD0 A;  3BRT B;  3H1I D;  2BHV A;  3L74 G;  2B87 A;  4WY4 B;  2LR2 A;  2R44 A;  1ZP0 C;  4IOI H;  4HH2 A;  1PGJ A;  2K0Y A;  1BCC G;  2L22 A;  5H2F H;  1SQQ G;  3L73 G;  4UB6 H;  2IBZ I;  3VMY A;  1KYO H;  3B4S A;  1JTH A;  2E1M A;  5AVZ B;  1D1D A;  1Y47 A;  1PGO A;  3CI9 A;  1SQB E;  4GOD A;  2CQ8 A;  2K5X A;  2OYI A;  1X3O A;  4JYB A;  4IPY A;  1LTT C;  1NU1 E;  1L0L E;  1M1J B;  1JO5 A;  2I1K A;  1ZRT D;  4YXD C;  2IZ0 A;  1VQ6 P;  4AYC A;  1N7S D;  2GM4 A;  1RF1 C;  2EFJ A;  2L5G B;  2LPK A;  5KAF H;  3MHV A;  1ZV8 A;  1N73 B;  3V2Q A;  1NTZ D;  5AW2 B;  3L74 E;  3HTK A;  1MKM A;  1LTG C;  5APS A;  2PP6 A;  3TDK A;  3CLQ A;  3L75 G;  3CXH E;  2LTE A;  2PNG A;  3L73 E;  3L36 A;  2FAD A;  2LKI A;  4H13 C;  3WUU A;  2E76 C;  2M8P A;  5AW1 B;  2KYV A;  3PTZ A;  1M74 A;  3G1G A;  1VQM P;  3CX5 D;  3H1L D;  3HZQ A;  1KB9 E;  5AVS B;  2KOP A;  1L0L J;  5CBO A;  3H0D A;  1RF1 A;  3VMA A;  1P84 E;  2K1A A;  2R32 A;  3TK1 A;  1VQ4 P;  2BAS A;  4Y28 J;  1QEX A;  1NTM D;  5HGO A;  3VMX A;  1NTK G;  5AVV B;  3B71 A;  3CWB D;  4HYT B;  5B5E E;  3Q3D A;  3L70 E;  1HGZ A;  1SQP E;  3H1H J;  2EHS A;  2I1J A;  1RO2 A;  3KZI E;  3H1J D;  2ZVO B;  4EIJ A;  4COC A;  2ERH A;  5AVU B;  4JQ0 D;  3RK2 C;  2YIU B;  2N5H A;  1SQV K;  2ZYD A;  1H89 A;  2KIK A;  3L75 E;  2BCC D;  3E1I A;  2H43 A;  1G2C A;  1LGH B;  2M5A B;  3G0V A;  1IFI A;  2MJZ A;  1NKZ B;  2Q3I A;  1FAV A;  4H0L B;  1KTM A;  4H44 C;  2VLQ A;  3Q20 A;  2AXT E;  3SFE C;  3EJE A;  2FXO A;  4LC1 A;  2FYN B;  2M8R A;  2FYU G;  1KYO D;  1S9K E;  1LTS C;  3A0B E;  3L72 E;  4WWI A;  5AW0 B;  1FE6 A;  1L0N E;  1BE3 E;  1JY3 O;  4GKG A;  1EDL A;  1GMJ A;  2WPS A;  3L70 J;  5KTB A;  1ZME C;  1SQP J;  2OYH A;  1VPC A;  1DNY A;  5KKZ C;  3P8C E;  2AEJ A;  3H47 A;  1OW8 A;  1AF8 A;  1NYH A;  1DV5 A;  2DNW A;  1KFN A;  1VQP P;  4U0E A;  4YTP C;  5F2K A;  3U43 A;  4I6M C;  2WSE J;  1FJP A;  3SSU A;  3TGU J;  1YI2 P;  4Y99 B;  2LL8 A;  4U0B A;  2ZJS E;  3FGA D;  2Q3E A;  3H1I E;  4EDF A;  2PFX A;  2B88 A;  3D6Y A;  2PGD A;  1NWQ A;  1M8O B;  3B5N B;  4ZKP A;  4JF7 A;  4EI2 A;  1T8K A;  2FFD C;  2K92 A;  4MN4 C;  4WBA A;  3M9H A;  3O6Q B;  2YXR B;  2HR3 A;  1YQ3 C;  5CCG A;  1Z56 A;  2LIW A;  4ZMD A;  2XXM A;  3AE1 C;  5EFW B;  1IFD A;  2XU6 A;  4N78 D;  4COP A;  2FBW C;  3JC2 2;  1NTM G;  4PV1 C;  1ZRT E;  1A43 A;  1BDD A;  2ZYA A;  5B66 H;  1DIP A;  4TLF A;  1H0T A;  3RG2 A;  1LTJ B;  4PH1 A;  2GZF A;  1N7S C;  1NTZ E;  2FFD A;  4IFD K;  1URQ D;  1GL2 B;  2XV6 A;  1JJ2 O;  1YTZ I;  2N1T B;  2HLO A;  2PEN A;  2V7Q J;  3WU2 E;  4L73 A;  1LT1 A;  3A3Y B;  2E74 D;  1LTA C;  3RL0 D;  1JY3 N;  1UNK A;  3U59 A;  1ZR2 A;  1HJB A;  1Y9B A;  1VQL P;  2J5U A;  2R5D A;  2JBG A;  1NVO A;  3L37 A;  3BRV B;  1OFC X;  2QE7 H;  2B89 A;  1NTM E;  1N7S A;  3A0H H;  2XT1 A;  1MV8 A;  1VQO P;  5CBN A;  3CWB E;  1K30 A;  3HD7 D;  3M0A A;  4PJ0 H;  2ROQ A;  1NTZ J;  4UB8 E;  3CCJ P;  2E75 D;  3TNU A;  3M9B A;  2GUS A;  3EQ2 A;  1Q7Y Q;  4GOE A;  3GZM A;  2PEO A;  2AEM A;  2KGC A;  3KXD A;  4XRO A;  1M1J C;  2FAE A;  5CCH D;  3RK3 D;  2CK3 H;  2BCC E;  4YPC A;  2WSE H;  1E6J P;  3MTU E;  2JGP A;  2LKM A;  3GF3 A;  4U0A A;  3VRL C;  4RKU J;  3H1L J;  3L71 J;  2A06 G;  1KV4 A;  1RHZ B;  3MIW A;  5H2F E;  1SQX G;  2QNW A;  2K3R A;  4UB6 E;  1ZNV A;  2AXT H;  2C0X A;  2XZ1 C;  3CMA P;  1KYO E;  2KXP B;  3IF4 A;  4LLH A;  4U3F D;  5TIS H;  2IFM A;  3RGU A;  1KMI Z;  2KOG A;  3SWK A;  5KAI H;  2ZT9 D;  2ZXE B;  3CWB J;  2WMM A;  3KYQ A;  1EZV D;  2L91 A;  1R5S A;  1FZG A;  3CXC O;  2QRX A;  4D6T J;  2QEX P;  3H1J J;  1HBW A;  1S5L H;  2HOD B;  3M0D C;  1LT9 B;  2PEJ A;  2KI7 B;  4OGQ B;  5M1B A;  4DCK A;  4HKG A;  2WPR A;  3FWL A;  1GPJ A;  2BCC J;  5AW7 B;  2JP3 A;  3SWY A;  3H1K G;  3NTE A;  2M5R A;  2G8Y A;  3HUS A;  3H1H D;  5BU8 B;  2P7J A;  1SLQ A;  3LRY A;  1YJW P;  2WZ7 A;  2V7Q H;  3V4W A;  1X22 A;  1FZE A;  2L4B A;  3GHG A;  2RN0 A;  2NPS D;  1PZQ A;  2QJY B;  1F80 D;  2IBZ D;  4ASW A;  1FU1 A;  2RKL A;  4KJM A;  2E42 A;  3AEC C;  1JEK A;  3B5I A;  4XFY A;  2OQQ A;  1QVF O;  3CC4 P;  4B86 A;  3LW5 J;  2FYN C;  3D6Z A;  2JB0 A;  2HFE D;  2C9N Y;  5I4T G;  3CME P;  1SQV J;  1NTK K;  3FX0 A;  3RK2 D;  5GTI H;  1GK4 A;  4C7N B;  2JAZ A;  3OW2 O;  2VLN A;  1URQ C;  2YKQ A;  1FZB A;  1KZU B;  1IMP A;  3Q2Y A;  1FS0 E;  4H44 D;  3KDP B;  2QJP B;  1KQG B;  1L4A D;  4GIF A;  4O9B A;  1IMQ A;  2NRG A;  2YO3 A;  3D70 A;  1T8Z A;  1VF5 D;  2IPP A;  1DEB A;  3CX5 H;  2B9B A;  1JUN A;  3G29 A;  2RH0 A;  4ASV A;  2D2C D;  3G4S P;  1LWU C;  1YIJ P;  1KLP A;  3NTN A;  1SVF A;  2FYU K;  3USS A;  1H88 A;  2JU1 A;  3PHL A;  1E0H A;  2WVR A;  1J1D B;  1SQB G;  2GZI A;  1URQ A;  3H32 B;  1NQ4 A;  2MY5 A;  1NU1 G;  2KK7 A;  1L0L G;  2WTY A;  3I56 P;  1SS1 A;  1RY3 A;  2YKO A;  3S9O A;  5KLV K;  1GW4 A;  2KB7 P;  3Q5P A;  1OR5 A;  4WYM A;  2VRS A;  3RK3 C;  2O3J A;  4MRT C;  3HE4 A;  1LTJ C;  3P8M C;  1W5C E;  2VLP A;  1EXJ A;  1LWU A;  4C7R A;  2N1T C;  5KLI C;  4H2Y C;  2C9L Y;  2GZJ A;  1TU3 F;  3IR9 A;  2P67 A;  3CXH I;  3LID A;  3DS4 A;  2CGQ A;  2KNC A;  3HD7 A;  1EZV E;  1VHN A;  1NAY A;  2WT7 B;  1S2E A;  5HV8 A;  2KZJ A;  1FBM A;  2KOR A;  2ONT A;  2ZYG A;  3TF5 A;  2ZT9 C;  4PV1 D;  2Z5I A;  1IFP A;  2R3C A;  2A45 H;  2Z45 A;  5B66 E;  1KB9 I;  2K94 A;  5CCH A;  1R8E A;  1IZN B;  3T97 A;  3MUD C;  1P84 I;  3LMO A;  1LTI C;  3AEE C;  2K9Y A;  2JO1 A;  1KIL B;  2HPC A;  3CPW O;  3LW5 H;  3L70 G;  3CE7 A;  4PD4 H;  3N7N A;  1SQP G;  5AW9 B;  1BGY D;  3EFG A;  2N5I A;  3H1H E;  1FZC C;  3V4Q A;  2KG8 A;  3AE6 C;  1S1C X;  5KLV D;  2OGU A;  2KGE A;  2C0W A;  1CW5 A;  1JMB A;  1DD4 A;  3TGU G;  3B4Q A;  1AQT A;  1HVV A;  1ZR4 A;  2K9J A;  2K93 A;  3FXD A;  4U3F J;  3HRN A;  5APQ A;  3GLM A;  2WPQ A;  2WSC J;  2BUO A;  4WY4 D;  5APT A;  1JB0 J;  1EDK A;  2IBZ E;  2W27 A;  4DG9 A;  1FC2 C;  1PL5 A;  1PGQ A;  3W67 A;  2BEQ D;  3L71 D;  1PPJ D;  2NPS C;  2K0D X;  4AQR D;  3AEA C;  3BCC J;  3A0H E;  5AVQ B;  3L72 G;  1GD2 E;  1VL2 A;  2GYK A;  1A8O A;  2VSQ A;  1L0N G;  4PJ0 E;  1BE3 G;  2KS1 A;  1FZC A;  1VQN P;  4W7Y A;  2VLO A;  4KHX A;  1ZW0 A;  5AVR B;  2FXM A;  2QSI A;  5AW6 B;  2JQ4 A;  2QVA A;  4D6T D;  3VTP C;  1SFC B;  1NGM B;  3CC7 P;  3M91 A;  2H7H A;  3I5C A;  1OW6 A;  1LP1 B;  5CJ4 A;  1LT9 C;  1OIP A;  3TGU E;  4DOJ A;  3H1I G;  1HH0 A;  2NPS A;  4U0D A;  2M8L A;  4HB1 A;  4NPE A;  3HE5 B;  1PGP A;  1L4A C;  3R4Y A;  1KN7 A;  4IL6 H;  1Q82 Q;  1CI6 A;  1HJ0 A;  5TIS E;  2EG5 A;  1SQX K;  2E43 A;  5KAI E;  1VF5 C;  3OAK A;  4DZO A;  2W6J H;  2D2C C;  3G9R A;  1S5L E;  2YNY A;  4CPG A;  1W2E A;  5APU A;  1IC2 A;  3W68 A;  2H88 C;  3CCR P;  2Y0E A;  3TSI A;  3S1K A;  2P1J A;  1IFN A;  1XTC C;  2MR7 A;  2YO2 A;  4PD4 D;  1S72 P;  3V2P A;  1NTZ G;  3LIE A;  1S5L X;  1L4A A;  1HY8 A;  4OWF A;  2PEM A;  4CA3 A;  4M0I A;  2WPV B;  1SQV D;  2FVF A;  2CPS A;  2GDY A;  5C39 A;  1WT6 A;  2OTK E;  1YTZ T;  1RQU A;  4M3L A;  3G26 A;  4L76 A;  3CD6 P;  1GXH A;  2B87 B;  1XTG B;  4H0L D;  2GDX A;  2WSC H;  3H1L G;  3L71 G;  2KLU A;  1UIX A;  2QJP C;  1KD1 Q;  3AE3 C;  1OXZ A;  3KPE A;  3PH0 A;  1WMK A;  1L2P A;  1ZN5 A;  3VN0 A;  3IAO A;  3CWB G;  3H6P A;  1IJD B;  1JTH B;  1NTK J;  4GR6 A;  2Q6Q A;  3V6I A;  1BGY E;  2JYG A;  2N98 A;  1JMM A;  5GTI E;  2N6Z A;  3H1J G;  4JYC A;  2OYI B;  3CCQ P;  2FVE A;  4HKZ H;  3VP9 A;  5EJD A;  3AEF C;  4I7Z B;  4R0M A;  2BCC G;  3CCV P;  1NKN A;  4WB4 A;  1QLE D;  1PP9 D;  3HTK B;  4GDO A;  3B5N D;  2FYZ A;  2KP8 A;  1M6N A;  4BPH A;  1QRJ A;  2WPT A;  3CX5 E;  3H1L E;  3L71 E;  3AE5 C;  1PPJ E;  4WY4 C;  3VMZ A;  3V2R A;  4C46 A;  3DS5 A;  3CCM P;  3GJN A;  1OX3 A;  4LGD E;  2FKW B;  1JCC A;  1QGK B;  1KYO I;  3EWK A;  1G1I A;  1BGY J;  2BEZ F;  4Z1M H;  1S3J A;  4D6T E;  3H1J E;  5KLV J;  1RF1 B;  3AED C;  1SQB K;  3CL3 D;  4NPD A;  5CHX A;  4H2X C;  2J58 A;  2Q5U A;  1NU1 K;  2ZFC A;  1L0L K;  1X8Y A;  3AE8 C;  1JM0 A;  2P58 A;  2QA4 P;  4U0F A;  5TJH A;  3MGN A;  4BRY A;  2AF8 A;  3UIA A;  4WY4 A;  4OVN F;  2IFN A;  3A5T A;  1GL2 D;  1OVR A;  2FQ2 A;  1KIL C;  1CZQ A;  2N1T D;  2ITA A;  2UWJ E;  3CCE P;  1OWA A;  1N73 C;  1VDF A;  2KSJ A;  3G28 A; 
#chains in the Genus database with same CATH homology
 3M1M A;  3CLQ A;  1L4A D;  4GIF A;  4O9B A;  3E2D A;  2YO3 A;  2XV5 A;  2HYN A;  3HE4 B;  3L36 A;  5F2O A;  1T8Z A;  3I55 P;  1G2C B;  1EOQ A;  1IFM A;  1KQS O;  2IPP A;  1LWU B;  2WIT A;  1DEB A;  5BVZ A;  1SQQ K;  1JNM A;  1K8A Q;  2M8P A;  5AW1 B;  2KYV A;  3H4E A;  1YJ9 P;  2HG5 D;  1JUN A;  3G29 A;  1M74 A;  5F2N A;  3G1G A;  2L6E A;  1VQM P;  3G4S P;  5HGN A;  1LWU C;  2O1K A;  1YIJ P;  3DPH A;  3HZQ A;  5AVS B;  3NTN A;  1SVF A;  1M1J A;  2FYU K;  1H88 A;  3H0D A;  1RF1 A;  3HD7 B;  3KQG A;  2R32 A;  3TK1 A;  3BVH A;  1VQ4 P;  2BAS A;  1J1D B;  2CPB A;  1URQ A;  2KLV A;  3H32 B;  1RE3 C;  5HGO A;  4EOT A;  5BS2 A;  1HGV A;  3VMX A;  2WTY A;  4C7N A;  3I56 P;  5AVV B;  2LF4 A;  4HYT B;  1J1D C;  1NH4 A;  1RY3 A;  2YKO A;  2OAR A;  1N73 A;  5AVX B;  1Q86 Q;  3CC2 P;  1HGZ A;  3L4F A;  1J1E B;  2OYH B;  2I1J A;  4AUW A;  3RK3 B;  1RO2 A;  5KLV K;  2Z4E A;  1GW4 A;  4EIJ A;  2KB7 P;  4COC A;  2HPC B;  1SQP K;  5AVU B;  5AVY B;  4WYM A;  2JJL A;  5CMZ A;  2VRS A;  3RK3 C;  3RK2 C;  1SQV K;  1H89 A;  3E1I A;  4XFZ A;  3HE4 A;  1YIT P;  1LTJ C;  3P8M C;  2H43 A;  1G2C A;  1LGH B;  3G0V A;  1IFI A;  1LWU A;  1NJI Q;  2MJZ A;  3IFM A;  4C7R A;  3V5B A;  2N1T C;  1EQ7 A;  1NKZ B;  4N6J A;  2Q3I A;  2C9L Y;  2XNX A;  1FAV A;  3M0D A;  3Q20 A;  5KJ7 C;  3II6 A;  1FJK A;  3BAT A;  1N8R Q;  1DX7 A;  2QM8 A;  3IR9 A;  4N78 E;  1IFJ A;  2DGY A;  1RE3 A;  2P67 A;  3LID A;  1AFO A;  3DS4 A;  4LC1 A;  3HD7 A;  3KDP B;  2PEK A;  2M8R A;  2WT7 B;  5DCK A;  3RG6 C;  1FBM A;  2PEQ A;  1S9K E;  2ONT A;  5HGM A;  1LTS C;  3H32 A;  1ZLL A;  2Z5I A;  5AW0 B;  3WBH A;  2A45 G;  1YHQ P;  2R3C A;  1IUQ A;  1JY3 O;  4GKG A;  5AVT B;  1FOS E;  2WPS A;  5HGL A;  2A45 H;  1RF0 C;  5KTB A;  2QM7 A;  1E5W A;  2Z45 A;  4ZKU A;  2OYH A;  1VPC A;  4U0C A;  1L0N K;  5CCH A;  2OTJ P;  2A45 I;  3T97 A;  3P8C E;  1HWT C;  2EIA A;  1LTB C;  3H47 A;  3OA7 A;  5AW4 B;  1LTI C;  1FZC B;  1NOH A;  1KIL B;  1DH3 A;  2HPC A;  1G1J A;  3CPW O;  1JY2 O;  1VQP P;  1KFN A;  3LW5 H;  4U0E A;  5APY A;  5F2K A;  2GUV A;  3M9Q A;  3N7N A;  3NFQ A;  5AW9 B;  4I6M C;  5BU5 A;  3EFG A;  1FJP A;  1YI2 P;  1WRG A;  2YMY A;  1FZC C;  4Y99 B;  1AQ5 A;  4U0B A;  3V4Q A;  5KJ7 A;  4GT1 A;  1CW5 A;  2C0W A;  1NWQ A;  2FFD B;  3B5N B;  4Y99 C;  1HVV A;  1ZR4 A;  4ZKP A;  4JF7 A;  3HRN A;  5APQ A;  2XDJ A;  1BAJ A;  2XKM A;  3CCU P;  2WPQ A;  2FFD C;  3TYY A;  3B5N C;  4WBA A;  2BUO A;  4WY4 D;  5APT A;  3M9H A;  2NPS B;  1QVG O;  2WT7 A;  5BS1 A;  3DS0 A;  1FDM A;  2W27 A;  2P9X A;  1RF0 A;  1T3U A;  1GZL A;  2NPS C;  5CCG A;  3HUS C;  1A02 F;  1Z56 A;  4AQR D;  1CI6 B;  3BAS A;  2Z46 A;  1M7L A;  2O01 H;  5AVQ B;  2XXM A;  1GD2 E;  1IFD A;  1A8O A;  2XU6 A;  3C9I A;  4N78 D;  4COP A;  3A7O A;  2JYL A;  3O8Z A;  1FZC A;  1VQN P;  1KIL A;  1X9V A;  3B8E B;  1K9M Q;  1J2J B;  3SWF A;  1IO4 A;  4W7Y A;  4KHX A;  2PP6 A;  1A43 A;  1RNI A;  3GHG C;  5AVR B;  2FXM A;  3U1A A;  5AW6 B;  1N7S B;  1NHL A;  3RK2 B;  3VTP C;  1SFC B;  2R5B A;  2PEI A;  1GU4 A;  3CC7 P;  3M91 A;  2H7H A;  1HUC A;  1LTJ B;  3I5C A;  4PH1 A;  1N7S C;  1JY3 P;  5CJ4 A;  2FFD A;  4IFD K;  1URQ D;  3TNU B;  1GL2 B;  1SFC C;  3B5N A;  1LT9 C;  2O1J A;  2XV6 A;  1JJ2 O;  1YTZ I;  2N1T B;  2HLO A;  2PEN A;  3VYI A;  1T2K C;  4DOJ A;  1FZF A;  1VQ9 P;  3L35 A;  1GL2 C;  1HH0 A;  4I1L A;  2OYI C;  4IFM A;  2NPS A;  1M6E X;  1L4A B;  5APV A;  1JY2 P;  4U0D A;  2M8N A;  4XFX A;  2M8L A;  1KFM A;  3A3Y B;  3P7K A;  2H8P D;  1MFZ A;  1LTA C;  4QNB A;  3RL0 D;  1JY3 N;  4PH0 A;  2JEE A;  3HE5 B;  3U59 A;  1L4A C;  1ZR2 A;  1HJB A;  1VQL P;  1RO0 A;  1Q82 Q;  1CI6 A;  2R5D A;  2WSF H;  3A2A A;  3MGE A;  1N7L A;  3DS2 A;  2Z5H A;  2PY8 A;  2EG5 A;  1SQX K;  2E43 A;  3L37 A;  3OAK A;  1JY2 N;  2IX7 C;  3BRV B;  4DZO A;  4IFF A;  2J59 M;  4XE5 B;  1GW3 A;  2YNY A;  1N7S A;  1K73 Q;  2XT1 A;  1W2E A;  1H8A A;  1SFC A;  1MV8 A;  5APU A;  1VQO P;  1IC2 A;  1K30 A;  3G3Z A;  3HD7 D;  3M0A A;  1QL2 A;  5APX A;  1NTM K;  3P32 A;  1LTJ A;  3CCR P;  4W7Z A;  2W6B A;  3CCJ P;  3TSI A;  1PFI A;  1M1K Q;  1GL2 A;  3TNU A;  3M9B A;  2GUS A;  4OH8 B;  3EQ2 A;  2N1T A;  1HTL C;  1KC8 Q;  2P1J A;  1IFN A;  4I2L C;  1XTC C;  1Q7Y Q;  4GR2 A;  2YO2 A;  1VQ5 P;  2PEO A;  1S72 P;  3V2P A;  5AVW B;  3NMD A;  3LIE A;  1EIA A;  1L4A A;  1KQL A;  4XRO A;  1M1J C;  5JPA A;  2JO0 A;  5AW5 B;  3RK3 D;  2PEM A;  5CCH D;  4M0I A;  1GK6 A;  1GTW A;  3CCS P;  2WSE H;  3HE5 A;  1E6J P;  2CPS A;  3MTU E;  2LKM A;  2M3B A;  1FOS F;  2POH A;  1GDT A;  1RE4 C;  4U0A A;  1WT6 A;  3VRL C;  3G1I A;  3HUS B;  3HYB A;  1YTZ T;  4M3L A;  2P2U A;  3MIW A;  3G26 A;  2W6A A;  3CD6 P;  2C0X A;  4XRQ A;  1XTG B;  3RL0 C;  3MUD A;  3CMA P;  1GU5 A;  1N86 A;  2WSC H;  3G21 A;  2PAJ A;  4LLH A;  3R2P A;  5CJ0 A;  3WMM 0;  3G6E P;  1AUM A;  2IFM A;  3GHG B;  1KD1 Q;  1JOC A;  1FZA A;  2KOG A;  2ZXE B;  2YKP A;  3KYQ A;  3N4X A;  1OXZ A;  3OJA B;  3KPE A;  1QL1 A;  1FZG A;  3CXC O;  3NXS A;  1ZN5 A;  4RES B;  3VN0 A;  1S9K D;  2QEX P;  4XA4 A;  1VQK P;  1HBW A;  5CCG D;  3H6P A;  1M90 Q;  1IJD B;  1JTH B;  2HOD B;  3M0D C;  4N3Y B;  1LT9 B;  5AW8 B;  2PEJ A;  3M06 A;  4GR6 A;  1VQ7 P;  2JYG A;  2CWO A;  1JMM A;  3CCL P;  1NO4 A;  2WPR A;  3HD7 C;  4JYC A;  1RE4 A;  2OYI B;  1T3J A;  3P8C D;  3CCQ P;  3P05 A;  5AW7 B;  1N2D C;  1ZMB A;  3SWY A;  3VP9 A;  1NAF A;  1A02 J;  1KIL D;  1MUU A;  1NTZ K;  3NTE A;  3PP5 A;  2OTL P;  5AW3 B;  2N9B A;  3HUS A;  3DTJ A;  5BU8 B;  3CCV P;  2P7J A;  1SLQ A;  3LRY A;  1YJW P;  1NKN A;  4WB4 A;  1J1E C;  2OYH C;  3V2N A;  2WZ7 A;  5CCH C;  3MD0 A;  3BRT B;  2XZR A;  2BHV A;  4WY4 B;  3HTK B;  3VOP A;  3B5N D;  2FYZ A;  2Z44 A;  1M6N A;  2KP8 A;  3V4W A;  1Q81 Q;  4HH2 A;  1QRJ A;  1VQ8 P;  1FZE A;  4WY4 C;  3GHG A;  5APW A;  3VMZ A;  2NPS D;  3V2R A;  4C46 A;  3DS5 A;  3DS3 A;  3VMY A;  1FU1 A;  3CCM P;  1X79 B;  2E42 A;  4LGD E;  2FKW B;  1JCC A;  1YYC A;  1JTH A;  2HOD A;  1JCD A;  2E1M A;  5AVZ B;  1D1D A;  3B5I A;  1LT9 A;  4XFY A;  2Q7C A;  1G1I A;  1QVF O;  3CC4 P;  3CI9 A;  4B86 A;  2OYI A;  3U1C A;  4JYB A;  4IPY A;  1LTT C;  1M1J B;  2WWW A;  2Q9I A;  1RF1 B;  1JO5 A;  1SQB K;  2HFE D;  3CL3 D;  2I1K A;  5CHX A;  2C9N Y;  1MZ9 A;  5I4T G;  2J58 A;  5CCG C;  1URQ B;  3CME P;  1VQ6 P;  1NU1 K;  1L0L K;  2Q5U A;  1N7S D;  2ZFC A;  4AYC A;  1X8Y A;  3DS1 A;  2GM4 A;  1NTK K;  4W80 A;  1RF1 C;  2EFJ A;  3RK2 D;  1SFC D;  2L5G B;  1GK4 A;  1SP4 A;  2QA4 P;  4U0F A;  4C7N B;  3OW2 O;  3MGN A;  3G71 P;  1URQ C;  1ZV8 A;  2YKQ A;  3UIA A;  1T2K D;  1W2B O;  1FZB A;  1KZU B;  4WY4 A;  3V2Q A;  1N73 B;  1CSB A;  5AW2 B;  2IFN A;  3HTK A;  3A5T A;  1GL2 D;  1KIL C;  1IK9 A;  1CZQ A;  2N1T D;  3RL0 B;  2KOD A;  1LTG C;  3CCE P;  1OWA A;  1N73 C;  3VP8 A;  5APS A;  5KJ7 D;  1VDF A;  1YJN P;  2KSJ A;  3G28 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...