2OARA

Mechanosensitive channel of large conductance (mscl)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
125
structure length
125
Chain Sequence
b'MLKGFKEFLARGNIVDLAVAVVIGTAFTALVTKFTDSIITPLINRIGVNAQSDVGILRIGIGGGQTIDLNVLLSAAINFFLIAFAVYFLVVLPYNTLRKKGEVEQPGDTQVVLLTEIRDLLAQTN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Large-conductance mechanosensitive channel
publication title Structures of the Prokaryotic Mechanosensitive Channels MscL and MscS
pubmed rcsb
source organism Mycobacterium tuberculosis h37ra
molecule tags Membrane protein
total genus 42
structure length 125
sequence length 125
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2006-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01741 MscL Large-conductance mechanosensitive channel, MscL
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.120 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2oarA01
1.20.5.220 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2oarA02
5KLVK 4IFDK 1SQQK 3LW5H 1L0LK 1NTMK 3M9QA 2J59M 3CLQA 1NTKK 1NTZK 2OARA 3HZQA 1NU1K 1SQXK 1SQBK 2LKMA 1SQPK 2WSFH 2O01H 3G3ZA 1SQVK 2WSCH 2WSEH 2FYUK 1L0NK
chains in the Genus database with same CATH superfamily
1M57D 2D2CD 3L70E 3MGNA 2K5XA 2AEJA 2EG5A 1NTKE 1NO4A 2N9BA 1NYHA 1GK6A 5K5GB 2KS1A 1OMIA 2IBZD 2FQ2A 1SQVD 1MKMA 2WT7B 4R4MA 2RKLA 3HUSC 1P84E 1G1IA 2JP3A 4PV1D 3G28A 4H13C 3L71D 2V7QJ 1RH5B 2JJLA 2FACA 2XV5A 1KB9E 2WWWA 3H1JD 1ZN5A 2EFJA 1OW8A 1S9KE 1JJ2O 2O01J 2QM8A 2WSEH 3QH9A 4WY4A 3HYBA 1YYCA 1GXHA 1S3JA 3GG2A 2FAEA 4GR6A 2WPRA 1G2CA 2N5IA 3U1CA 3F89A 2Y9ZA 3Q3DA 1Q81Q 4D6TD 3B4SA 1SQBJ 1GZLA 4WY4C 2ZJSE 3HE4B 4PH0A 1KZUB 1IC2A 3GHGB 3H1LE 3DS1A 1F80D 2RH0A 2M5AA 2J5UA 3CCJP 3FWLA 1NKNA 1YJWP 2YMKA 1IFPA 3VP9A 3VMYA 3ABVC 3WU2H 1GW4A 3JSVC 1DNYA 2AXTH 2BUOA 3CC4P 1YQ3C 4GOEA 3H6PA 3RK3B 1P84H 2KGDA 1KLPA 2Q5UA 1H0TA 2WITA 1KYOD 2E74B 2Y0EA 1AA0A 1JY3O 2QJPC 3U43A 1AV1A 3V2PA 1KB9H 2EHTA 1GDTA 1OX3A 2GZIA 3HD7B 2AEFA 5CCGD 3KDPB 4OH8B 4F37A 1HH0A 3CX5I 2FBWC 2OYHA 1Q86Q 3Q1MA 3N4XA 5KLIB 2P2UA 3S9OA 2GUSA 2YIUC 1DD3A 1YQ4C 3H32A 1OVRA 2I1KA 4YXDC 4Z1MH 1T3UA 2P67A 2W27A 2XNXA 5JPAA 4I2LC 1VF5C 2OYHC 1FOSE 2KOOA 5AW4B 1BGYE 1W2BO 1HF9A 3SWYA 4N78E 2W6JH 4QNBA 4H0LD 1RF1B 1DH3A 1IUQA 1NTZD 4COCA 1DIPA 1PPJG 1Q90D 4UHPB 5GTHH 2R3CA 3CC2P 1PP9G 1SQVJ 2M8RA 2LMLA 1GL2A 2CPBA 2LF4A 1E5WA 1KN7A 1YIJP 4U0CA 3B71A 3L70J 3L71J 2NPSD 3P05A 4UB8H 1LTJA 4ASVA 1HJBA 2R32A 1XTCC 1ZMBA 3V4WA 2K0XA 3V2QA 4COPA 4U7JA 1FZAA 2BASA 3NXSA 1N7SB 1LTJC 5AVTB 2PAJA 2WVRA 4YPCA 3DS2A 1JM0A 2LL8A 1KC8Q 1BXIA 4H2YC 4U0EA 1QVFO 3RK2C 4D6TJ 1OZHA 1WMKA 1URQB 3HUSB 1T8KA 1KFMA 2AEMA 2P7JA 5E79E 3KXDA 3BVHA 1AYIA 1SQQK 2YO3A 4C7NA 1VQPP 5DCKA 2YKPA 4CPGA 1KILD 2BCCG 3CXHE 4BPGA 1JNMA 4C46A 2K9JB 2IDBA 4DOJA 3G71P 5AW6B 2IBZI 1TU3F 4GIFA 2WSSH 1EOQA 1QLED 4HYTB 1M6EX 1KQFB 1NU1G 2MKVA 1PP9E 1M1JC 2XNDH 1T2KD 2CNRA 2B87A 1BAJA 1S5LH 2M5RA 2ZT9B 1Q2NA 2E75C 1PPJD 2L4BA 4WY4B 2ERHA 1SQVK 5CCHA 2QE7H 5EW5E 3PJSK 5B5EE 1JY2O 4OGQD 1RY3A 4NPFX 2MD9A 2ONTA 3CXCO 2MF4A 2G3AA 3NTNA 4MN4C 5CHXA 2KYVA 1W5CE 5APSA 4KT0J 3CMAP 2MR8A 1SLQA 2PFXA 4H2WC 3CC7P 3L36A 3IFMA 3L73E 4AQRD 1AVYA 3H1HE 3GMAA 3G0VA 2M3EA 3AE3C 2FYUD 2GM4A 2XXMA 2BCCE 2D2CC 1MFZA 1KQLA 1FDOA 2GZFA 2IPPA 3B5ND 2YIUB 2N6YA 2FXMA 5AVZB 2W90A 3IAOA 3A3YB 3BCCD 1K04A 3PH0A 2OYHB 4PV1C 3CI9A 3RBXA 3Q5PA 1ZLLA 2HR3A 2P1JA 5B5EH 2GDXA 4WB4A 4WVZA 1NU1D 3AE2C 2OYIA 3G4SP 1LP1B 4EOTA 1IMQA 1M7LA 4M0IA 2L91A 2UWJE 3RBZA 4L75A 4NPDA 3TGUG 1K30A 2OYIC 3W68A 1Y9BA 2KGEA 2J58A 5KAFE 2YXQB 4GKGA 3LRYA 5AVSB 3DS5A 3E1IA 3G21A 4U0FA 1SQQG 3CX5E 3MGEA 1WRGA 3M0DC 1GL2D 2NZ2A 1FR2A 2KI7B 3V2RA 2JU2A 2K93A 2K0DX 2Q3EA 3BRVB 5CJ0A 3P8CD 3AEBC 3K5BA 1LTJB 1NTZK 2Q6QA 3I5CA 2FFDA 1HBWA 4IFMA 1A02J 1FOSF 1U7JA 5CCGA 1RO0A 2ZVOB 3GZLA 1X0TA 3L75G 3KZIH 2IBZG 1SQPG 2IFNA 2N6ZA 2FFDC 1PP9J 2QRXA 5APQA 4YTPC 1VL2A 4IL6X 4LLHA 2P10A 2PENA 1SQXG 4JBZA 5TJHA 3DTJA 5HGOA 2KOGA 2A06G 3H1JG 2V7QH 1KV4A 3GF7A 5KAFH 2K37A 3L74G 1M1JB 4XRQA 2G8YA 2MR7A 1KTMA 1L4AD 2VLPA 1E6JP 4XA4A 4PD4H 2O01H 2CPSA 3D70A 4H0LC 2W6BA 1SQQE 3O6QB 3C9IA 5AW3B 3L73J 1FBMA 1S2EA 2O01N 2R3SA 1GPJA 1EZVE 2B87B 5DJUB 2CQ8A 3H1HJ 3TGUD 4L74A 4W7ZA 2A45H 2NPSA 2MVVA 1RQUA 1SFCB 2Q7CA 1PZQA 2H88C 2IZ1A 1JTHA 3MP7B 3DS0A 1CZQA 2IYOA 2BCCJ 1NKZB 2JQ4A 3RGUA 2NPSC 2VLNA 3VOPA 3M0AA 4LC1A 1D1DA 3OA7A 3NMDA 3H25A 3KQGA 2BEZF 1IMPA 1NU1J 2Q9IA 2IBZE 2HODB 1D7MA 1SQVE 3V4QA 2XU6A 2C9LY 1J1EC 1DX7A 1S4XA 2VLQA 1OW7A 3L71E 2N1TA 3LIEA 3H1KG 1JB0J 3MZWB 3MTUE 2VLOA 3TYYA 4C7RA 3H1ID 1NAYA 1H89A 3L75D 3V6IA 3H1JE 2JWDA 1KILA 1SQPD 2BHVA 3HE5B 3B8EB 4PV1B 1M1KQ 2FVFA 2GZEA 2LR2A 2EIAA 1Z6MA 1T6AA 2AFEA 3SWFA 2KNCB 1KILC 2JKVA 1SQXD 4A7PA 5KTBA 2C0WA 4NPEA 2KUBA 2A06D 1VDFA 3CCQP 1Y8AA 1ZW0A 4D6TE 3L74D 2M0BA 4ZKPA 1VQNP 3C8VA 3P32A 1NTZG 2FYUK 2XKMA 3AE8C 2FQ1A 3RL0B 1RE3A 1NTKD 1T2KC 2P58A 1JY3N 4GR2A 1HGVA 2JEEA 1PV3A 2K94A 5L8RJ 2K9YA 5B66H 2E43A 1FDIA 4OGQC 3GZMA 3SWKA 1QVGO 4GODA 1KYOE 1HUCA 1FU1A 1BCCG 1UIIA 2I8DA 1NVOA 2LIWA 1NU1K 2W8ZA 2PEOA 3H4EA 1DEEG 4HKGA 5KLVD 2LPKA 3VTPC 4IOIH 1LWUB 5DJTB 2HPCB 3M1MA 1W2EA 3HTKB 5KP6B 3C1LA 3CL3D 3WUUA 4EI2A 3B5NA 2KIKA 3TGUJ 2QSIA 1OVUA 3H1KD 3II6A 5H2FE 3RK3D 2KORA 1UIXA 3U59A 2E74D 3B5NC 1SQQJ 3LW5J 3BASA 2KOPA 2LKIA 1NTZE 1M6NA 4O9BA 2FVAA 4HKZH 2VSQA 4H2XC 3HD7D 5AW0B 1MZ9A 1YI2P 3BATA 3VYIA 2QNWA 1LT9A 1FZCA 1VQ9P 4H0LB 1KYOH 1M90Q 3NFQA 1BDCA 2HFED 1FC2C 2WTYA 2JDIH 3L75J 1SQPJ 2L0QA 3G29A 2N9YB 2DGYA 2GDWA 5F2NA 2WSFJ 2LXBA 3RL0g 3VMAA 2XV6A 5AW8B 5CJ4A 4AYCA 4Y99C 5APUA 2FY8A 4W80A 1GL2C 1J1DC 1RNIA 2MJZA 4PWVB 3H1JJ 2E76B 1BCCD 5AW7B 1BSNA 3ITKA 5CZDB 2IFMA 4I7ZC 4K3AA 1YBKA 1BDDA 2OYOA 4UB6E 3DS4A 1BE3G 3CWBD 1L0NG 4GT1A 1FAVA 2FYUG 1VQLP 3CLQA 1KILE 3GW6A 1RF0A 2E5TA 1VQ8P 1X8YA 4BWNA 3FXEA 4U0AA 1X79B 1JCDA 4L76A 1N7LA 1GMJA 2NO8A 1N7SD 1AJYA 2N1TD 3CD6P 3BCCG 3EQ2A 3TNUA 4H13B 1RF0C 2KS1B 3L4FA 1Q7YQ 1KILB 3T97A 1IO4A 2PRRA 1QGKB 1L4AA 1PPJE 1R5SA 3I55P 5AVWB 1URQD 1HJ0A 4Y28J 5AVVB 4IL6E 4RESB 3SFEC 1DEBA 4K35A 1L4AC 5HVCA 1VKUA 5BS2A 1FZEA 4BRYA 3GKLC 1FJKA 1RHZB 2FYNC 3H1KJ 2JBGA 1SQPK 4ZNCA 3WMM0 1OXZA 3M9HA 1EDJA 3G1IA 2W6AA 3P8MC 4L73A 4PXHB 4U3FD 3GF3A 4GDOA 1G2CB 4UB6H 2JYGA 2KZJA 1QL2A 1AVOA 1YITP 2GA1A 1X22A 2ZT9D 1SQXK 2JO1A 5CCHC 4PJ0E 3Q5SA 3JCUE 2FYUE 2LKMA 3RG2A 1N73A 1X9VA 2AXCA 5EFWB 1L0LD 1P84I 2M8PA 2B89A 4MRTC 3B4QA 2M5AB 5E79H 3Q20A 4YXWH 3CMEP 1KB9I 1NTZJ 1NTKK 2LXCB 2FKWB 2QJPB 2DNWA 1BE3D 1N73C 3CXHH 2XZ0D 3BCCE 3V2NA 2PGDA 2O1KA 1VQOP 2LIUA 1L0ND 1GU4A 3AE4C 3L35A 2KOQA 1H0TB 1OVVA 1U7MA 1MFTA 1IK9A 3B5NB 4IL6H 1NQ4A 3OW2O 1NU1E 1OW6A 1QX8A 1X3OA 2AVAA 2GUVA 3AE7C 5AVYB 2WT7A 1VF5B 1IZNB 5APWA 1BCCJ 1NTMD 1GU5A 3AEEC 5KLVK 2POHA 1KORA 2WPQA 2Q3IA 3H32B 2QVAA 5C39A 3M91A 2Z5IA 3L72D 3P7KA 1ZXGA 3U1AA 2Z46A 1MZ8A 4PJ0H 1FZFA 3SSUA 1ZRTD 5CBNA 1HQBA 2QA4P 4GOFA 2OTJP 3P8CE 1CW5A 1Z56A 5BVZA 2ZYGA 1HVVA 2K2QA 3WBHA 2JWAA 1PGJA 4Y99B 1USDA 5HGMA 5AW2B 1S5LX 1GL2B 1J1DB 3VMXA 2JB0A 3AEDC 2PEQA 3HE4A 3GHGA 2KWLA 4XROA 4WYMA 1E0HA 4I7ZB 2YXRB 5KJ7A 3CE7A 1JMBA 2Q1KA 5F2OA 3Q2YA 1NOHA 2W83C 3S1KA 3MUDA 3VN0A 3GHGC 3TSIA 1IFMA 4JQ0D 1ACPA 1R5LA 4XFZA 3RK2B 4N6JA 3A7OA 5AVQB 1EDKA 3H1IG 3OAKA 4EYYQ 3CCRP 2XZ1C 1LGHB 2XDJA 1VQ6P 4XFYA 4PD4D 5CCGC 2GZGA 2CWOA 4HH2A 5KAIE 3RK3C 3HD7A 3AEGC 1L0IA 4TLFA 2E74C 1M74A 1IFJA 1AQ5A 2Y0DA 4C7NB 2E1MA 3G6EP 1ZMEC 3W67A 3OJAB 3QWOC 2JR8A 1H8AA 3TGUE 3HD7C 1SQBD 1L4AB 1IFDA 1GD2E 1BE3J 3TDKA 5GTIE 2H89C 2E75B 3CX5H 1NTKG 2FYUJ 5KLIC 2FYNB 4TT3H 4H44D 2QG4A 3EFFK 1IJDB 5AVRB 2KXPB 2HG5D 4DJGA 4LGDE 4BRYB 1LTIC 3E2DA 3BCCJ 5CMZA 2P9XA 2WPTA 4NEOA 1SS1A 1IFIA 2LOLA 1XTGB 1USEA 2R44A 2FVEA 3CCUP 4R0MA 3CCEP 1OIPA 3PRJA 3H1IE 5KLVG 1ZR2A 1LTGC 3L75E 1SFCD 1SQPE 3A0BE 1N73B 2FHSC 5KAIH 1A02F 1HWTC 3SFDC 3WUTA 4BXLA 2D2CB 1L2PA 1A43A 1N7SA 2OGUA 2WQYC 4XFJA 2M8LA 1ZOYC 3H1LG 2PEIA 1SQXE 3PHLA 2OARA 1Q82Q 2A06E 3L37A 1KD1Q 3L74E 5GTIH 1BSHA 1N7SC 3AEFC 2N1TC 2R5DA 1URQA 3HUSA 1HGZA 3LW5H 1L0LK 3WU2E 4BPFA 2L9FA 2K0YA 1K9MQ 2AXTE 3TK1A 1Y47A 5KP7B 4EDFA 3D6YA 3AECC 2K9JA 1CI6A 3AE1C 5HGNA 2AF8A 2JO0A 2DW3A 1H88A 1URQC 1NWQA 2PEJA 1AFOA 1AF8A 2WSCJ 1L0NK 4B86A 3L70D 2O3JA 2OYIB 4ZMDA 4AUWA 4I6MC 5APTA 4R4LA 3CCLP 2OTLP 2PEMA 3D71A 2BEQD 3A0BH 1P84D 2WSFH 5AVUB 3NTEA 5KLVE 1RE3C 1R8EA 3TF5A 2I1JA 4BPHA 3RL0D 3CCVP 2QIWA 1NTMK 2WPSA 1KB9D 2AFDA 3UIAA 2OQQA 1BGYG 2ZT9C 2VRSA 4KJMA 1PIXA 1SP4A 1S9KD 1LTBC 3H1KE 3BRTB 5HGLA 2N50A 2YMYA 3CWBG 3RK3E 5KJ7D 1LTSC 2OTKE 1CEIA 2YKQA 1IK7A 5GTHE 5HV8A 1GXGA 2FFDB 2LTEA 1T8ZA 3USSA 3AE5C 1LJ2A 4JF7A 5APXA 2CG5B 3H1LD 1FZBA 3G9RA 1VQKP 2FYZA 2JYLA 1L0HA 1M56D 2XT1A 4UB8E 1EC5A 1ZR4A 1J2JB 1EMVA 4QMAA 4WWIA 2KLVA 1DV5A 5CBOA 2WZ7A 4PD4I 2Z44A 1CSBA 1KQGB 1VQ7P 1YJ9P 3EJDA 1NH4A 1GTWA 1UNKA 2A45I 2WMMA 4JYBA 1GK4A 1NGMB 4JPZB 1JOCA 1LT9C 1LP1A 3H1IJ 1KQSO 3E1RA 1FZCC 5I4TG 1BCCE 1ZV8A 4U3FG 1YTZI 2GYKA 2PY8A 1FJPA 2FXOA 2WSEJ 3B5IA 5KKZC 1JCCA 2L6EA 3LIDA 1IFNA 2C0XA 3CWBE 1MUUA 1JEKA 1NAFA 3GJNA 2NPSB 2ZVNB 1SQXJ 3LMOA 1YTZT 2QJYC 1L0LG 1JTHB 4CA3A 3VRLC 3PTZA 1SQBK 1BGYD 1G1JA 2QEXP 1JO5A 4N78D 5H2FH 3CPWO 3L74J 2Y9YA 1J1EB 2ZYAA 2KSJA 1JMMA 1S5LE 1NTKJ 2E5YA 1KMIZ 4OWFA 4IZ6A 1S1CX 2E76D 1A8OA 4I1LA 2X2BA 3G3ZA 2R5BA 1HTLC 2B88A 1LNQA 1JY2N 2N1TB 3CCMP 3DS3A 1EIAA 2K92A 3M9BA 1EZVI 2KR5A 3V5BA 3L73G 5APVA 4DT0A 5BU5A 3G26A 1PGQA 1NTMG 3H1HG 2ZYDA 3KHUA 1ZP0C 2QM7A 5KLVJ 3L72G 1K05A 4IFDK 4U3FE 4H13D 1UJZA 1FDMA 2JAZA 2ZAEB 3Q5RA 2N98A 2YO2A 1M1JA 1CI6B 1PGPA 1JUNA 3MIWA 3M06A 3CCSP 2ROQA 4XE5B 4H44C 2KK7A 2WPVB 3H1LJ 1L0LE 3D6ZA 3O6QA 4OGQB 4KHXA 3CXHD 5BS1A 4HJGH 1BE3E 4DCKA 3EJEA 2YNYA 1L0NE 1SFCA 2GZJA 2K3RA 4WY4D 5AVXB 1RE4A 1PP9D 4RKUJ 3VMZA 2KZIA 1OFCX 2CK3H 1SFCC 2C9NY 3MD0A 1RE4C 3AE9C 1PL5A 2KODA 2HODA 2B9BA 4RO0A 1YHQP 2KGCA 2ZXEB 4WBAA 3IF4A 3ZDMA 1NTME 3R2PA 1VHNA 1RO2A 1M8OB 5APYA 3FXDA 2QJKC 2KGAA 3M9QA 3RG6C 2ZFCA 3R4YA 5M1BA 2FXPA 3L72E 3F5HA 2V4HA 2RMZA 4N3YB 2E42A 4PH1A 2HLOA 3HE5A 3A5TA 3L73D 2GDYA 2A45G 3WUVA 1JY3P 3AE6C 4IFFA 1BGYJ 1ZRTE 1VPCA 4HB1A 3I56P 3H1HD 1SQBG 2PP6A 3PP5A 1KYOI 3G1GA 1N86A 2KNCA 3CWBJ 1QL1A 3JC22 1VQ4P 3O8ZA 2KP8A 5EJDA 1ZNVA 1LT9B 1VF5D 1NJIQ 2BCCD 3AEAC 3GLMA 3JCUH 4W7YA 1FZCB 3KZIE 3NY7B 3IR9A 1SVFA 5TISE 5KKZB 2IZ0A 2N5HA 4JYCA 4DG9A 1FS0E 1AQTA 2J59M 1T3JA 5AW9B 1AUMA 1PGOA 2QJYB 2H7HA 1QEXA 2L5GB 2ZXXA 1K8AQ 4U0DA 1E79H 3M0DA 1YJNP 2EHSA 3RL0C 1PFIA 3PLNA 2ITAA 3KPEA 3EFGA 1VQMP 3H0DA 2PEKA 2Z45A 1NHLA 1LT1A 1VQ5P 2K1AA 2HYNA 2KG8A 4PD4E 2Z5HA 1EZVG 2NRGA 1OR5A 4ASWA 5KJ7C 1FZGA 3FGAD 4XFXA 1EDIA 3DPHA 1S72P 2L22A 4OVNF 1DD4A 1LWUA 2HPCA 3MUDC 4QKOA 3HTKA 2YKOA 3A2AA 4U3FJ 3S4RA 2H8PD 1SQBE 5F2KA 2K88A 3EWKA 3A0HH 3CX5D 5AW1B 1FE6A 2KLUA 1LWUC 3RK2D 5AW5B 4EIJA 3TNUB 1L0LJ 5TISH 2M8NA 1SQVG 3T97B 2KW2A 1EXIA 4RJTA 4ZKUA 1LTAC 1KFNA 1WT6A 2KSEA 1EXJA 3L70G 3L71G 3N7NA 3A0HE 2WSCH 1L0NJ 1EDLA 1GW3A 3E7KA 2KG9A 5KP8B 2MY5A 4H44B 2KOSA 2MVUA 1OWAA 3H47A 3VP8A 1RF1A 2RN0A 1LTTC 2PNGA 1N2DC 1N8RQ 2E75D 1MV8A 1HY8A 1RF1C 2JGPA 3FWNA 4M3LA 1QRJA 7CEIA 2M3BA 1NTMJ 4D6TG 2XZRA 1EQ7A 3HZQA 3L72J 3CXHI 1JY2P 5CCHD 1K73Q 4DZOA 3MHVA 1SQQD 2H43A 2CGQA 2FQ0A 2Y0CA 5BU8B 2JU1A 1EZVD 2Z4EA 3FX0A 4U0BA 3HRNA 2QJKB 4IPYA 2FADA 1RQVA 2O1JA 2KB7P 2KG6A 2IX7C 2SPZA 3IN6A 2E76C 2IYPA 3EJBA 5B66E 3KYQA 1U57A
chains in the Genus database with same CATH topology
1VQ7P 3M9HA 3MGNA 3G1IA 2W6AA 3BRVB 1YJ9P 3P8MC 5CJ0A 3P8CD 1G2CB 2EG5A 1LTJB 1NH4A 2N9BA 1NO4A 1GTWA 2JYGA 1GK6A 1QL2A 2A45I 4JYBA 1YITP 1NTZK 1GK4A 3I5CA 2FFDA 1JOCA 1LT9C 1SQXK 1HBWA 2WT7B 5CCHC 1KQSO 4IFMA 2LKMA 5I4TG 1FZCC 1ZV8A 1A02J 1FOSF 3HUSC 1RO0A 5CCGA 1YTZI 1N73A 2PY8A 1G1IA 1X9VA 1FJPA 3B5IA 2M8PA 3G28A 1JCCA 2L6EA 3LIDA 1IFNA 2JJLA 2IFNA 2C0XA 1MUUA 1NAFA 2XV5A 2FFDC 2NPSB 5APQA 3Q20A 3CMEP 1NTKK 2WWWA 2FKWB 1ZN5A 2EFJA 1N73C 1YTZT 1JTHB 3V2NA 2O1KA 3VRLC 1VQOP 1S9KE 1SQBK 1GU4A 4LLHA 3L35A 1G1JA 2QEXP 1JJ2O 1JO5A 4N78D 2QM8A 3CPWO 2WSEH 2PENA 4WY4A 3DTJA 3HYBA 1YYCA 5HGOA 2KOGA 1J1EB 1IK9A 2KSJA 3B5NB 4GR6A 1JMMA 2WPRA 1G2CA 1M1JB 4XRQA 3OW2O 3U1CA 1L4AD 1Q81Q 2GUVA 1E6JP 1A8OA 4I1LA 5AVYB 1GZLA 4WY4C 4XA4A 3HE4B 4PH0A 2WT7A 1KZUB 1IC2A 3GHGB 2O01H 5APWA 3G3ZA 2CPSA 2R5BA 1HTLC 2W6BA 3DS1A 3C9IA 5AW3B 1GU5A 1FBMA 5KLVK 1JY2N 2N1TB 2POHA 3CCMP 2WPQA 2Q3IA 3DS3A 3H32B 1EIAA 3M9BA 3CCJP 3M91A 1NKNA 2Z5IA 4W7ZA 2A45H 3V5BA 1YJWP 3P7KA 2NPSA 5APVA 3VP9A 3U1AA 3VMYA 1GW4A 5BU5A 3G26A 2BUOA 2Z46A 1SFCB 2Q7CA 1JTHA 3CC4P 3H6PA 3DS0A 3RK3B 1CZQA 1FZFA 2QM7A 2Q5UA 1NKZB 2WITA 2NPSC 4IFDK 3VOPA 2QA4P 3M0AA 2OTJP 3P8CE 1D1DA 4LC1A 1CW5A 1Z56A 3OA7A 5BVZA 1FDMA 1JY3O 3NMDA 1HVVA 3KQGA 3V2PA 2YO2A 3WBHA 1M1JA 2Q9IA 1CI6B 1GDTA 1JUNA 3MIWA 4Y99B 3M06A 3CCSP 2HODB 3HD7B 5HGMA 5AW2B 5CCGD 1GL2B 1J1DB 3V4QA 3VMXA 3KDPB 4OH8B 2XU6A 1HH0A 2C9LY 4XE5B 2PEQA 3HE4A 2OYHA 1J1EC 3GHGA 1Q86Q 3N4XA 1DX7A 4XROA 4WYMA 5KJ7A 2P2UA 2GUSA 2N1TA 3LIEA 5F2OA 4KHXA 1NOHA 3H32A 2I1KA 3MTUE 1T3UA 2P67A 3TYYA 4C7RA 3MUDA 1H89A 2W27A 2XNXA 5BS1A 1KILA 5JPAA 4I2LC 2OYHC 1FOSE 2BHVA 3VN0A 3GHGC 3HE5B 3TSIA 2YNYA 1SFCA 1IFMA 5AW4B 3B8EB 1W2BO 4WY4D 5AVXB 4XFZA 1RE4A 3RK2B 1M1KQ 4N78E 4N6JA 3SWYA 3A7OA 4QNBA 5AVQB 2EIAA 1RF1B 1DH3A 1IUQA 3OAKA 3SWFA 3VMZA 4COCA 3CCRP 1KILC 1LGHB 2XDJA 1VQ6P 4XFYA 5KTBA 2C0WA 1SFCC 2C9NY 3MD0A 1VDFA 3CCQP 5CCGC 2CWOA 1RE4C 2R3CA 4HH2A 3RK3C 2KODA 2HODA 3HD7A 3CC2P 2M8RA 1GL2A 4ZKPA 1VQNP 1YHQP 2ZXEB 3P32A 4WBAA 2CPBA 2FYUK 2XKMA 2LF4A 1M74A 1IFJA 3R2PA 1AQ5A 1E5WA 1YIJP 1RO2A 4U0CA 2E1MA 3G6EP 5APYA 4C7NB 3RL0B 1RE3A 3OJAB 3M9QA 1T2KC 3RG6C 2NPSD 1JY3N 2ZFCA 4GR2A 1HGVA 1H8AA 3P05A 3HD7C 1LTJA 1HJBA 2JEEA 1L4AB 2R32A 4N3YB 2E42A 1IFDA 1XTCC 1ZMBA 4PH1A 1GD2E 2HLOA 3V4WA 3HE5A 3A5TA 3V2QA 2E43A 4COPA 2A45G 1JY3P 4IFFA 1FZAA 2BASA 3NXSA 1QVGO 1VPCA 1N7SB 3I56P 2PP6A 1LTJC 3PP5A 1HUCA 1IJDB 5AVTB 1FU1A 5AVRB 2PAJA 3G1GA 2HG5D 1N86A 3DS2A 1QL1A 1KC8Q 4LGDE 1NU1K 1VQ4P 2PEOA 3H4EA 1LTIC 2KP8A 3E2DA 3O8ZA 4U0EA 1QVFO 1LT9B 1NJIQ 3RK2C 5CMZA 1FZCB 4W7YA 3VTPC 1URQB 3HUSB 2P9XA 1KFMA 1LWUB 2HPCB 3IR9A 1IFIA 1SVFA 2P7JA 3M1MA 1XTGB 3BVHA 1SQQK 1W2EA 2YO3A 3HTKB 3CL3D 4JYCA 4C7NA 1VQPP 5DCKA 3CCUP 2YKPA 3B5NA 1KILD 2J59M 1JNMA 3CCEP 4C46A 1T3JA 4DOJA 1ZR2A 3G71P 1LTGC 5AW9B 1AUMA 1SFCD 5AW6B 1N73B 2H7HA 3II6A 2L5GB 4GIFA 3RK3D 1EOQA 1K8AQ 4U0DA 4HYTB 1M6EX 1A02F 1HWTC 3M0DA 1YJNP 3U59A 3RL0C 1PFIA 3B5NC 3KPEA 1A43A 1N7SA 3BASA 1M1JC 3EFGA 1VQMP 3H0DA 2PEKA 2M8LA 1M6NA 2Z45A 4O9BA 1NHLA 2PEIA 1T2KD 1VQ5P 1BAJA 2HYNA 2OARA 1Q82Q 3HD7D 5AW0B 3L37A 1MZ9A 1YI2P 2Z5HA 3BATA 3VYIA 1KD1Q 4WY4B 5KJ7C 1LT9A 1FZGA 1N7SC 1SQVK 5CCHA 4XFXA 3DPHA 2N1TC 2R5DA 1FZCA 1VQ9P 1S72P 1JY2O 1URQA 3HUSA 1HGZA 1LWUA 2HPCA 1RY3A 3LW5H 1L0LK 2ONTA 3CXCO 3HTKA 1M90Q 2YKOA 3A2AA 3NFQA 1K9MQ 3NTNA 2HFED 3TK1A 2H8PD 5CHXA 2WTYA 2KYVA 5F2KA 5APSA 3CMAP 1CI6A 1H88A 5HGNA 2JO0A 1SLQA 5AW1B 3G29A 2DGYA 1URQC 1NWQA 3CC7P 5F2NA 2PEJA 1LWUC 1AFOA 3L36A 3IFMA 3RK2D 1L0NK 5AW5B 4B86A 4AQRD 4EIJA 3TNUB 2OYIB 2M8NA 2XV6A 5AW8B 3G0VA 5CJ4A 4AUWA 4ZKUA 4AYCA 4Y99C 4I6MC 1LTAC 5APTA 5APUA 3CCLP 1KFNA 1WT6A 4W80A 2OTLP 1GL2C 1J1DC 1RNIA 2PEMA 2MJZA 5AW7B 2GM4A 3N7NA 2WSFH 2XXMA 3NTEA 5AVUB 2WSCH 1MFZA 2IFMA 1RE3C 1GW3A 1KQLA 2I1JA 1OWAA 3H47A 3DS4A 3RL0D 3CCVP 2IPPA 1NTMK 2WPSA 3VP8A 3B5ND 1RF1A 4GT1A 1FAVA 2FXMA 5AVZB 3UIAA 1VQLP 3CLQA 2VRSA 1SP4A 3A3YB 1LTTC 1RF0A 1S9KD 1VQ8P 1X8YA 1LTBC 3BRTB 2OYHB 4U0AA 1N2DC 1X79B 3CI9A 1N8RQ 1JCDA 5HGLA 1MV8A 1N7LA 2YMYA 1ZLLA 5KJ7D 1RF1C 1N7SD 2P1JA 4M3LA 1QRJA 2N1TD 2M3BA 1LTSC 3CD6P 3EQ2A 4WB4A 3TNUA 2YKQA 1RF0C 2XZRA 2OYIA 3L4FA 1Q7YQ 1EQ7A 1KILB 3T97A 1IO4A 2FFDB 3G4SP 1T8ZA 4EOTA 3HZQA 1JY2P 1L4AA 5CCHD 1M7LA 4JF7A 5APXA 4M0IA 1K73Q 3I55P 5AVWB 1FZBA 4DZOA 1URQD 1VQKP 2H43A 1K30A 2FYZA 2JYLA 2OYIC 5BU8B 5AVVB 2J58A 2Z4EA 4U0BA 4RESB 1DEBA 3HRNA 4IPYA 2XT1A 2O1JA 2KB7P 4GKGA 1ZR4A 3LRYA 1L4AC 2IX7C 5AVSB 3DS5A 1J2JB 3E1IA 3G21A 4U0FA 2KLVA 5BS2A 1FZEA 3MGEA 1WRGA 2WZ7A 1GL2D 3M0DC 1FJKA 1SQPK 2Z44A 1CSBA 3WMM0 3KYQA 1OXZA 3V2RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KLV K;  4IFD K;  1SQQ K;  3LW5 H;  1L0L K;  1NTM K;  3M9Q A;  2J59 M;  3CLQ A;  1NTK K;  1NTZ K;  2OAR A;  3HZQ A;  1NU1 K;  1SQX K;  1SQB K;  2LKM A;  1SQP K;  2WSF H;  2O01 H;  3G3Z A;  1SQV K;  2WSC H;  2WSE H;  2FYU K;  1L0N K; 
#chains in the Genus database with same CATH topology
 1M57 D;  2D2C D;  3L70 E;  3MGN A;  2K5X A;  2AEJ A;  2EG5 A;  1NTK E;  1NO4 A;  2N9B A;  1NYH A;  1GK6 A;  5K5G B;  2KS1 A;  1OMI A;  2IBZ D;  2FQ2 A;  1SQV D;  1MKM A;  2WT7 B;  4R4M A;  2RKL A;  3HUS C;  1P84 E;  1G1I A;  2JP3 A;  4PV1 D;  3G28 A;  4H13 C;  3L71 D;  2V7Q J;  1RH5 B;  2JJL A;  2FAC A;  2XV5 A;  1KB9 E;  2WWW A;  3H1J D;  1ZN5 A;  2EFJ A;  1OW8 A;  1S9K E;  1JJ2 O;  2O01 J;  2QM8 A;  2WSE H;  3QH9 A;  4WY4 A;  3HYB A;  1YYC A;  1GXH A;  1S3J A;  3GG2 A;  2FAE A;  4GR6 A;  2WPR A;  1G2C A;  2N5I A;  3U1C A;  3F89 A;  2Y9Z A;  3Q3D A;  1Q81 Q;  4D6T D;  3B4S A;  1SQB J;  1GZL A;  4WY4 C;  2ZJS E;  3HE4 B;  4PH0 A;  1KZU B;  1IC2 A;  3GHG B;  3H1L E;  3DS1 A;  1F80 D;  2RH0 A;  2M5A A;  2J5U A;  3CCJ P;  3FWL A;  1NKN A;  1YJW P;  2YMK A;  1IFP A;  3VP9 A;  3VMY A;  3ABV C;  3WU2 H;  1GW4 A;  3JSV C;  1DNY A;  2AXT H;  2BUO A;  3CC4 P;  1YQ3 C;  4GOE A;  3H6P A;  3RK3 B;  1P84 H;  2KGD A;  1KLP A;  2Q5U A;  1H0T A;  2WIT A;  1KYO D;  2E74 B;  2Y0E A;  1AA0 A;  1JY3 O;  2QJP C;  3U43 A;  1AV1 A;  3V2P A;  1KB9 H;  2EHT A;  1GDT A;  1OX3 A;  2GZI A;  3HD7 B;  2AEF A;  5CCG D;  3KDP B;  4OH8 B;  4F37 A;  1HH0 A;  3CX5 I;  2FBW C;  2OYH A;  1Q86 Q;  3Q1M A;  3N4X A;  5KLI B;  2P2U A;  3S9O A;  2GUS A;  2YIU C;  1DD3 A;  1YQ4 C;  3H32 A;  1OVR A;  2I1K A;  4YXD C;  4Z1M H;  1T3U A;  2P67 A;  2W27 A;  2XNX A;  5JPA A;  4I2L C;  1VF5 C;  2OYH C;  1FOS E;  2KOO A;  5AW4 B;  1BGY E;  1W2B O;  1HF9 A;  3SWY A;  4N78 E;  2W6J H;  4QNB A;  4H0L D;  1RF1 B;  1DH3 A;  1IUQ A;  1NTZ D;  4COC A;  1DIP A;  1PPJ G;  1Q90 D;  4UHP B;  5GTH H;  2R3C A;  3CC2 P;  1PP9 G;  1SQV J;  2M8R A;  2LML A;  1GL2 A;  2CPB A;  2LF4 A;  1E5W A;  1KN7 A;  1YIJ P;  4U0C A;  3B71 A;  3L70 J;  3L71 J;  2NPS D;  3P05 A;  4UB8 H;  1LTJ A;  4ASV A;  1HJB A;  2R32 A;  1XTC C;  1ZMB A;  3V4W A;  2K0X A;  3V2Q A;  4COP A;  4U7J A;  1FZA A;  2BAS A;  3NXS A;  1N7S B;  1LTJ C;  5AVT B;  2PAJ A;  2WVR A;  4YPC A;  3DS2 A;  1JM0 A;  2LL8 A;  1KC8 Q;  1BXI A;  4H2Y C;  4U0E A;  1QVF O;  3RK2 C;  4D6T J;  1OZH A;  1WMK A;  1URQ B;  3HUS B;  1T8K A;  1KFM A;  2AEM A;  2P7J A;  5E79 E;  3KXD A;  3BVH A;  1AYI A;  1SQQ K;  2YO3 A;  4C7N A;  1VQP P;  5DCK A;  2YKP A;  4CPG A;  1KIL D;  2BCC G;  3CXH E;  4BPG A;  1JNM A;  4C46 A;  2K9J B;  2IDB A;  4DOJ A;  3G71 P;  5AW6 B;  2IBZ I;  1TU3 F;  4GIF A;  2WSS H;  1EOQ A;  1QLE D;  4HYT B;  1M6E X;  1KQF B;  1NU1 G;  2MKV A;  1PP9 E;  1M1J C;  2XND H;  1T2K D;  2CNR A;  2B87 A;  1BAJ A;  1S5L H;  2M5R A;  2ZT9 B;  1Q2N A;  2E75 C;  1PPJ D;  2L4B A;  4WY4 B;  2ERH A;  1SQV K;  5CCH A;  2QE7 H;  5EW5 E;  3PJS K;  5B5E E;  1JY2 O;  4OGQ D;  1RY3 A;  4NPF X;  2MD9 A;  2ONT A;  3CXC O;  2MF4 A;  2G3A A;  3NTN A;  4MN4 C;  5CHX A;  2KYV A;  1W5C E;  5APS A;  4KT0 J;  3CMA P;  2MR8 A;  1SLQ A;  2PFX A;  4H2W C;  3CC7 P;  3L36 A;  3IFM A;  3L73 E;  4AQR D;  1AVY A;  3H1H E;  3GMA A;  3G0V A;  2M3E A;  3AE3 C;  2FYU D;  2GM4 A;  2XXM A;  2BCC E;  2D2C C;  1MFZ A;  1KQL A;  1FDO A;  2GZF A;  2IPP A;  3B5N D;  2YIU B;  2N6Y A;  2FXM A;  5AVZ B;  2W90 A;  3IAO A;  3A3Y B;  3BCC D;  1K04 A;  3PH0 A;  2OYH B;  4PV1 C;  3CI9 A;  3RBX A;  3Q5P A;  1ZLL A;  2HR3 A;  2P1J A;  5B5E H;  2GDX A;  4WB4 A;  4WVZ A;  1NU1 D;  3AE2 C;  2OYI A;  3G4S P;  1LP1 B;  4EOT A;  1IMQ A;  1M7L A;  4M0I A;  2L91 A;  2UWJ E;  3RBZ A;  4L75 A;  4NPD A;  3TGU G;  1K30 A;  2OYI C;  3W68 A;  1Y9B A;  2KGE A;  2J58 A;  5KAF E;  2YXQ B;  4GKG A;  3LRY A;  5AVS B;  3DS5 A;  3E1I A;  3G21 A;  4U0F A;  1SQQ G;  3CX5 E;  3MGE A;  1WRG A;  3M0D C;  1GL2 D;  2NZ2 A;  1FR2 A;  2KI7 B;  3V2R A;  2JU2 A;  2K93 A;  2K0D X;  2Q3E A;  3BRV B;  5CJ0 A;  3P8C D;  3AEB C;  3K5B A;  1LTJ B;  1NTZ K;  2Q6Q A;  3I5C A;  2FFD A;  1HBW A;  4IFM A;  1A02 J;  1FOS F;  1U7J A;  5CCG A;  1RO0 A;  2ZVO B;  3GZL A;  1X0T A;  3L75 G;  3KZI H;  2IBZ G;  1SQP G;  2IFN A;  2N6Z A;  2FFD C;  1PP9 J;  2QRX A;  5APQ A;  4YTP C;  1VL2 A;  4IL6 X;  4LLH A;  2P10 A;  2PEN A;  1SQX G;  4JBZ A;  5TJH A;  3DTJ A;  5HGO A;  2KOG A;  2A06 G;  3H1J G;  2V7Q H;  1KV4 A;  3GF7 A;  5KAF H;  2K37 A;  3L74 G;  1M1J B;  4XRQ A;  2G8Y A;  2MR7 A;  1KTM A;  1L4A D;  2VLP A;  1E6J P;  4XA4 A;  4PD4 H;  2O01 H;  2CPS A;  3D70 A;  4H0L C;  2W6B A;  1SQQ E;  3O6Q B;  3C9I A;  5AW3 B;  3L73 J;  1FBM A;  1S2E A;  2O01 N;  2R3S A;  1GPJ A;  1EZV E;  2B87 B;  5DJU B;  2CQ8 A;  3H1H J;  3TGU D;  4L74 A;  4W7Z A;  2A45 H;  2NPS A;  2MVV A;  1RQU A;  1SFC B;  2Q7C A;  1PZQ A;  2H88 C;  2IZ1 A;  1JTH A;  3MP7 B;  3DS0 A;  1CZQ A;  2IYO A;  2BCC J;  1NKZ B;  2JQ4 A;  3RGU A;  2NPS C;  2VLN A;  3VOP A;  3M0A A;  4LC1 A;  1D1D A;  3OA7 A;  3NMD A;  3H25 A;  3KQG A;  2BEZ F;  1IMP A;  1NU1 J;  2Q9I A;  2IBZ E;  2HOD B;  1D7M A;  1SQV E;  3V4Q A;  2XU6 A;  2C9L Y;  1J1E C;  1DX7 A;  1S4X A;  2VLQ A;  1OW7 A;  3L71 E;  2N1T A;  3LIE A;  3H1K G;  1JB0 J;  3MZW B;  3MTU E;  2VLO A;  3TYY A;  4C7R A;  3H1I D;  1NAY A;  1H89 A;  3L75 D;  3V6I A;  3H1J E;  2JWD A;  1KIL A;  1SQP D;  2BHV A;  3HE5 B;  3B8E B;  4PV1 B;  1M1K Q;  2FVF A;  2GZE A;  2LR2 A;  2EIA A;  1Z6M A;  1T6A A;  2AFE A;  3SWF A;  2KNC B;  1KIL C;  2JKV A;  1SQX D;  4A7P A;  5KTB A;  2C0W A;  4NPE A;  2KUB A;  2A06 D;  1VDF A;  3CCQ P;  1Y8A A;  1ZW0 A;  4D6T E;  3L74 D;  2M0B A;  4ZKP A;  1VQN P;  3C8V A;  3P32 A;  1NTZ G;  2FYU K;  2XKM A;  3AE8 C;  2FQ1 A;  3RL0 B;  1RE3 A;  1NTK D;  1T2K C;  2P58 A;  1JY3 N;  4GR2 A;  1HGV A;  2JEE A;  1PV3 A;  2K94 A;  5L8R J;  2K9Y A;  5B66 H;  2E43 A;  1FDI A;  4OGQ C;  3GZM A;  3SWK A;  1QVG O;  4GOD A;  1KYO E;  1HUC A;  1FU1 A;  1BCC G;  1UII A;  2I8D A;  1NVO A;  2LIW A;  1NU1 K;  2W8Z A;  2PEO A;  3H4E A;  1DEE G;  4HKG A;  5KLV D;  2LPK A;  3VTP C;  4IOI H;  1LWU B;  5DJT B;  2HPC B;  3M1M A;  1W2E A;  3HTK B;  5KP6 B;  3C1L A;  3CL3 D;  3WUU A;  4EI2 A;  3B5N A;  2KIK A;  3TGU J;  2QSI A;  1OVU A;  3H1K D;  3II6 A;  5H2F E;  3RK3 D;  2KOR A;  1UIX A;  3U59 A;  2E74 D;  3B5N C;  1SQQ J;  3LW5 J;  3BAS A;  2KOP A;  2LKI A;  1NTZ E;  1M6N A;  4O9B A;  2FVA A;  4HKZ H;  2VSQ A;  4H2X C;  3HD7 D;  5AW0 B;  1MZ9 A;  1YI2 P;  3BAT A;  3VYI A;  2QNW A;  1LT9 A;  1FZC A;  1VQ9 P;  4H0L B;  1KYO H;  1M90 Q;  3NFQ A;  1BDC A;  2HFE D;  1FC2 C;  2WTY A;  2JDI H;  3L75 J;  1SQP J;  2L0Q A;  3G29 A;  2N9Y B;  2DGY A;  2GDW A;  5F2N A;  2WSF J;  2LXB A;  3RL0 g;  3VMA A;  2XV6 A;  5AW8 B;  5CJ4 A;  4AYC A;  4Y99 C;  5APU A;  2FY8 A;  4W80 A;  1GL2 C;  1J1D C;  1RNI A;  2MJZ A;  4PWV B;  3H1J J;  2E76 B;  1BCC D;  5AW7 B;  1BSN A;  3ITK A;  5CZD B;  2IFM A;  4I7Z C;  4K3A A;  1YBK A;  1BDD A;  2OYO A;  4UB6 E;  3DS4 A;  1BE3 G;  3CWB D;  1L0N G;  4GT1 A;  1FAV A;  2FYU G;  1VQL P;  3CLQ A;  1KIL E;  3GW6 A;  1RF0 A;  2E5T A;  1VQ8 P;  1X8Y A;  4BWN A;  3FXE A;  4U0A A;  1X79 B;  1JCD A;  4L76 A;  1N7L A;  1GMJ A;  2NO8 A;  1N7S D;  1AJY A;  2N1T D;  3CD6 P;  3BCC G;  3EQ2 A;  3TNU A;  4H13 B;  1RF0 C;  2KS1 B;  3L4F A;  1Q7Y Q;  1KIL B;  3T97 A;  1IO4 A;  2PRR A;  1QGK B;  1L4A A;  1PPJ E;  1R5S A;  3I55 P;  5AVW B;  1URQ D;  1HJ0 A;  4Y28 J;  5AVV B;  4IL6 E;  4RES B;  3SFE C;  1DEB A;  4K35 A;  1L4A C;  5HVC A;  1VKU A;  5BS2 A;  1FZE A;  4BRY A;  3GKL C;  1FJK A;  1RHZ B;  2FYN C;  3H1K J;  2JBG A;  1SQP K;  4ZNC A;  3WMM 0;  1OXZ A;  3M9H A;  1EDJ A;  3G1I A;  2W6A A;  3P8M C;  4L73 A;  4PXH B;  4U3F D;  3GF3 A;  4GDO A;  1G2C B;  4UB6 H;  2JYG A;  2KZJ A;  1QL2 A;  1AVO A;  1YIT P;  2GA1 A;  1X22 A;  2ZT9 D;  1SQX K;  2JO1 A;  5CCH C;  4PJ0 E;  3Q5S A;  3JCU E;  2FYU E;  2LKM A;  3RG2 A;  1N73 A;  1X9V A;  2AXC A;  5EFW B;  1L0L D;  1P84 I;  2M8P A;  2B89 A;  4MRT C;  3B4Q A;  2M5A B;  5E79 H;  3Q20 A;  4YXW H;  3CME P;  1KB9 I;  1NTZ J;  1NTK K;  2LXC B;  2FKW B;  2QJP B;  2DNW A;  1BE3 D;  1N73 C;  3CXH H;  2XZ0 D;  3BCC E;  3V2N A;  2PGD A;  2O1K A;  1VQO P;  2LIU A;  1L0N D;  1GU4 A;  3AE4 C;  3L35 A;  2KOQ A;  1H0T B;  1OVV A;  1U7M A;  1MFT A;  1IK9 A;  3B5N B;  4IL6 H;  1NQ4 A;  3OW2 O;  1NU1 E;  1OW6 A;  1QX8 A;  1X3O A;  2AVA A;  2GUV A;  3AE7 C;  5AVY B;  2WT7 A;  1VF5 B;  1IZN B;  5APW A;  1BCC J;  1NTM D;  1GU5 A;  3AEE C;  5KLV K;  2POH A;  1KOR A;  2WPQ A;  2Q3I A;  3H32 B;  2QVA A;  5C39 A;  3M91 A;  2Z5I A;  3L72 D;  3P7K A;  1ZXG A;  3U1A A;  2Z46 A;  1MZ8 A;  4PJ0 H;  1FZF A;  3SSU A;  1ZRT D;  5CBN A;  1HQB A;  2QA4 P;  4GOF A;  2OTJ P;  3P8C E;  1CW5 A;  1Z56 A;  5BVZ A;  2ZYG A;  1HVV A;  2K2Q A;  3WBH A;  2JWA A;  1PGJ A;  4Y99 B;  1USD A;  5HGM A;  5AW2 B;  1S5L X;  1GL2 B;  1J1D B;  3VMX A;  2JB0 A;  3AED C;  2PEQ A;  3HE4 A;  3GHG A;  2KWL A;  4XRO A;  4WYM A;  1E0H A;  4I7Z B;  2YXR B;  5KJ7 A;  3CE7 A;  1JMB A;  2Q1K A;  5F2O A;  3Q2Y A;  1NOH A;  2W83 C;  3S1K A;  3MUD A;  3VN0 A;  3GHG C;  3TSI A;  1IFM A;  4JQ0 D;  1ACP A;  1R5L A;  4XFZ A;  3RK2 B;  4N6J A;  3A7O A;  5AVQ B;  1EDK A;  3H1I G;  3OAK A;  4EYY Q;  3CCR P;  2XZ1 C;  1LGH B;  2XDJ A;  1VQ6 P;  4XFY A;  4PD4 D;  5CCG C;  2GZG A;  2CWO A;  4HH2 A;  5KAI E;  3RK3 C;  3HD7 A;  3AEG C;  1L0I A;  4TLF A;  2E74 C;  1M74 A;  1IFJ A;  1AQ5 A;  2Y0D A;  4C7N B;  2E1M A;  3G6E P;  1ZME C;  3W67 A;  3OJA B;  3QWO C;  2JR8 A;  1H8A A;  3TGU E;  3HD7 C;  1SQB D;  1L4A B;  1IFD A;  1GD2 E;  1BE3 J;  3TDK A;  5GTI E;  2H89 C;  2E75 B;  3CX5 H;  1NTK G;  2FYU J;  5KLI C;  2FYN B;  4TT3 H;  4H44 D;  2QG4 A;  3EFF K;  1IJD B;  5AVR B;  2KXP B;  2HG5 D;  4DJG A;  4LGD E;  4BRY B;  1LTI C;  3E2D A;  3BCC J;  5CMZ A;  2P9X A;  2WPT A;  4NEO A;  1SS1 A;  1IFI A;  2LOL A;  1XTG B;  1USE A;  2R44 A;  2FVE A;  3CCU P;  4R0M A;  3CCE P;  1OIP A;  3PRJ A;  3H1I E;  5KLV G;  1ZR2 A;  1LTG C;  3L75 E;  1SFC D;  1SQP E;  3A0B E;  1N73 B;  2FHS C;  5KAI H;  1A02 F;  1HWT C;  3SFD C;  3WUT A;  4BXL A;  2D2C B;  1L2P A;  1A43 A;  1N7S A;  2OGU A;  2WQY C;  4XFJ A;  2M8L A;  1ZOY C;  3H1L G;  2PEI A;  1SQX E;  3PHL A;  2OAR A;  1Q82 Q;  2A06 E;  3L37 A;  1KD1 Q;  3L74 E;  5GTI H;  1BSH A;  1N7S C;  3AEF C;  2N1T C;  2R5D A;  1URQ A;  3HUS A;  1HGZ A;  3LW5 H;  1L0L K;  3WU2 E;  4BPF A;  2L9F A;  2K0Y A;  1K9M Q;  2AXT E;  3TK1 A;  1Y47 A;  5KP7 B;  4EDF A;  3D6Y A;  3AEC C;  2K9J A;  1CI6 A;  3AE1 C;  5HGN A;  2AF8 A;  2JO0 A;  2DW3 A;  1H88 A;  1URQ C;  1NWQ A;  2PEJ A;  1AFO A;  1AF8 A;  2WSC J;  1L0N K;  4B86 A;  3L70 D;  2O3J A;  2OYI B;  4ZMD A;  4AUW A;  4I6M C;  5APT A;  4R4L A;  3CCL P;  2OTL P;  2PEM A;  3D71 A;  2BEQ D;  3A0B H;  1P84 D;  2WSF H;  5AVU B;  3NTE A;  5KLV E;  1RE3 C;  1R8E A;  3TF5 A;  2I1J A;  4BPH A;  3RL0 D;  3CCV P;  2QIW A;  1NTM K;  2WPS A;  1KB9 D;  2AFD A;  3UIA A;  2OQQ A;  1BGY G;  2ZT9 C;  2VRS A;  4KJM A;  1PIX A;  1SP4 A;  1S9K D;  1LTB C;  3H1K E;  3BRT B;  5HGL A;  2N50 A;  2YMY A;  3CWB G;  3RK3 E;  5KJ7 D;  1LTS C;  2OTK E;  1CEI A;  2YKQ A;  1IK7 A;  5GTH E;  5HV8 A;  1GXG A;  2FFD B;  2LTE A;  1T8Z A;  3USS A;  3AE5 C;  1LJ2 A;  4JF7 A;  5APX A;  2CG5 B;  3H1L D;  1FZB A;  3G9R A;  1VQK P;  2FYZ A;  2JYL A;  1L0H A;  1M56 D;  2XT1 A;  4UB8 E;  1EC5 A;  1ZR4 A;  1J2J B;  1EMV A;  4QMA A;  4WWI A;  2KLV A;  1DV5 A;  5CBO A;  2WZ7 A;  4PD4 I;  2Z44 A;  1CSB A;  1KQG B;  1VQ7 P;  1YJ9 P;  3EJD A;  1NH4 A;  1GTW A;  1UNK A;  2A45 I;  2WMM A;  4JYB A;  1GK4 A;  1NGM B;  4JPZ B;  1JOC A;  1LT9 C;  1LP1 A;  3H1I J;  1KQS O;  3E1R A;  1FZC C;  5I4T G;  1BCC E;  1ZV8 A;  4U3F G;  1YTZ I;  2GYK A;  2PY8 A;  1FJP A;  2FXO A;  2WSE J;  3B5I A;  5KKZ C;  1JCC A;  2L6E A;  3LID A;  1IFN A;  2C0X A;  3CWB E;  1MUU A;  1JEK A;  1NAF A;  3GJN A;  2NPS B;  2ZVN B;  1SQX J;  3LMO A;  1YTZ T;  2QJY C;  1L0L G;  1JTH B;  4CA3 A;  3VRL C;  3PTZ A;  1SQB K;  1BGY D;  1G1J A;  2QEX P;  1JO5 A;  4N78 D;  5H2F H;  3CPW O;  3L74 J;  2Y9Y A;  1J1E B;  2ZYA A;  2KSJ A;  1JMM A;  1S5L E;  1NTK J;  2E5Y A;  1KMI Z;  4OWF A;  4IZ6 A;  1S1C X;  2E76 D;  1A8O A;  4I1L A;  2X2B A;  3G3Z A;  2R5B A;  1HTL C;  2B88 A;  1LNQ A;  1JY2 N;  2N1T B;  3CCM P;  3DS3 A;  1EIA A;  2K92 A;  3M9B A;  1EZV I;  2KR5 A;  3V5B A;  3L73 G;  5APV A;  4DT0 A;  5BU5 A;  3G26 A;  1PGQ A;  1NTM G;  3H1H G;  2ZYD A;  3KHU A;  1ZP0 C;  2QM7 A;  5KLV J;  3L72 G;  1K05 A;  4IFD K;  4U3F E;  4H13 D;  1UJZ A;  1FDM A;  2JAZ A;  2ZAE B;  3Q5R A;  2N98 A;  2YO2 A;  1M1J A;  1CI6 B;  1PGP A;  1JUN A;  3MIW A;  3M06 A;  3CCS P;  2ROQ A;  4XE5 B;  4H44 C;  2KK7 A;  2WPV B;  3H1L J;  1L0L E;  3D6Z A;  3O6Q A;  4OGQ B;  4KHX A;  3CXH D;  5BS1 A;  4HJG H;  1BE3 E;  4DCK A;  3EJE A;  2YNY A;  1L0N E;  1SFC A;  2GZJ A;  2K3R A;  4WY4 D;  5AVX B;  1RE4 A;  1PP9 D;  4RKU J;  3VMZ A;  2KZI A;  1OFC X;  2CK3 H;  1SFC C;  2C9N Y;  3MD0 A;  1RE4 C;  3AE9 C;  1PL5 A;  2KOD A;  2HOD A;  2B9B A;  4RO0 A;  1YHQ P;  2KGC A;  2ZXE B;  4WBA A;  3IF4 A;  3ZDM A;  1NTM E;  3R2P A;  1VHN A;  1RO2 A;  1M8O B;  5APY A;  3FXD A;  2QJK C;  2KGA A;  3M9Q A;  3RG6 C;  2ZFC A;  3R4Y A;  5M1B A;  2FXP A;  3L72 E;  3F5H A;  2V4H A;  2RMZ A;  4N3Y B;  2E42 A;  4PH1 A;  2HLO A;  3HE5 A;  3A5T A;  3L73 D;  2GDY A;  2A45 G;  3WUV A;  1JY3 P;  3AE6 C;  4IFF A;  1BGY J;  1ZRT E;  1VPC A;  4HB1 A;  3I56 P;  3H1H D;  1SQB G;  2PP6 A;  3PP5 A;  1KYO I;  3G1G A;  1N86 A;  2KNC A;  3CWB J;  1QL1 A;  3JC2 2;  1VQ4 P;  3O8Z A;  2KP8 A;  5EJD A;  1ZNV A;  1LT9 B;  1VF5 D;  1NJI Q;  2BCC D;  3AEA C;  3GLM A;  3JCU H;  4W7Y A;  1FZC B;  3KZI E;  3NY7 B;  3IR9 A;  1SVF A;  5TIS E;  5KKZ B;  2IZ0 A;  2N5H A;  4JYC A;  4DG9 A;  1FS0 E;  1AQT A;  2J59 M;  1T3J A;  5AW9 B;  1AUM A;  1PGO A;  2QJY B;  2H7H A;  1QEX A;  2L5G B;  2ZXX A;  1K8A Q;  4U0D A;  1E79 H;  3M0D A;  1YJN P;  2EHS A;  3RL0 C;  1PFI A;  3PLN A;  2ITA A;  3KPE A;  3EFG A;  1VQM P;  3H0D A;  2PEK A;  2Z45 A;  1NHL A;  1LT1 A;  1VQ5 P;  2K1A A;  2HYN A;  2KG8 A;  4PD4 E;  2Z5H A;  1EZV G;  2NRG A;  1OR5 A;  4ASW A;  5KJ7 C;  1FZG A;  3FGA D;  4XFX A;  1EDI A;  3DPH A;  1S72 P;  2L22 A;  4OVN F;  1DD4 A;  1LWU A;  2HPC A;  3MUD C;  4QKO A;  3HTK A;  2YKO A;  3A2A A;  4U3F J;  3S4R A;  2H8P D;  1SQB E;  5F2K A;  2K88 A;  3EWK A;  3A0H H;  3CX5 D;  5AW1 B;  1FE6 A;  2KLU A;  1LWU C;  3RK2 D;  5AW5 B;  4EIJ A;  3TNU B;  1L0L J;  5TIS H;  2M8N A;  1SQV G;  3T97 B;  2KW2 A;  1EXI A;  4RJT A;  4ZKU A;  1LTA C;  1KFN A;  1WT6 A;  2KSE A;  1EXJ A;  3L70 G;  3L71 G;  3N7N A;  3A0H E;  2WSC H;  1L0N J;  1EDL A;  1GW3 A;  3E7K A;  2KG9 A;  5KP8 B;  2MY5 A;  4H44 B;  2KOS A;  2MVU A;  1OWA A;  3H47 A;  3VP8 A;  1RF1 A;  2RN0 A;  1LTT C;  2PNG A;  1N2D C;  1N8R Q;  2E75 D;  1MV8 A;  1HY8 A;  1RF1 C;  2JGP A;  3FWN A;  4M3L A;  1QRJ A;  7CEI A;  2M3B A;  1NTM J;  4D6T G;  2XZR A;  1EQ7 A;  3HZQ A;  3L72 J;  3CXH I;  1JY2 P;  5CCH D;  1K73 Q;  4DZO A;  3MHV A;  1SQQ D;  2H43 A;  2CGQ A;  2FQ0 A;  2Y0C A;  5BU8 B;  2JU1 A;  1EZV D;  2Z4E A;  3FX0 A;  4U0B A;  3HRN A;  2QJK B;  4IPY A;  2FAD A;  1RQV A;  2O1J A;  2KB7 P;  2KG6 A;  2IX7 C;  2SPZ A;  3IN6 A;  2E76 C;  2IYP A;  3EJB A;  5B66 E;  3KYQ A;  1U57 A; 
#chains in the Genus database with same CATH homology
 1VQ7 P;  3M9H A;  3MGN A;  3G1I A;  2W6A A;  3BRV B;  1YJ9 P;  3P8M C;  5CJ0 A;  3P8C D;  1G2C B;  2EG5 A;  1LTJ B;  1NH4 A;  2N9B A;  1NO4 A;  1GTW A;  2JYG A;  1GK6 A;  1QL2 A;  2A45 I;  4JYB A;  1YIT P;  1NTZ K;  1GK4 A;  3I5C A;  2FFD A;  1JOC A;  1LT9 C;  1SQX K;  1HBW A;  2WT7 B;  5CCH C;  1KQS O;  4IFM A;  2LKM A;  5I4T G;  1FZC C;  1ZV8 A;  1A02 J;  1FOS F;  3HUS C;  1RO0 A;  5CCG A;  1YTZ I;  1N73 A;  2PY8 A;  1G1I A;  1X9V A;  1FJP A;  3B5I A;  2M8P A;  3G28 A;  1JCC A;  2L6E A;  3LID A;  1IFN A;  2JJL A;  2IFN A;  2C0X A;  1MUU A;  1NAF A;  2XV5 A;  2FFD C;  2NPS B;  5APQ A;  3Q20 A;  3CME P;  1NTK K;  2WWW A;  2FKW B;  1ZN5 A;  2EFJ A;  1N73 C;  1YTZ T;  1JTH B;  3V2N A;  2O1K A;  3VRL C;  1VQO P;  1S9K E;  1SQB K;  1GU4 A;  4LLH A;  3L35 A;  1G1J A;  2QEX P;  1JJ2 O;  1JO5 A;  4N78 D;  2QM8 A;  3CPW O;  2WSE H;  2PEN A;  4WY4 A;  3DTJ A;  3HYB A;  1YYC A;  5HGO A;  2KOG A;  1J1E B;  1IK9 A;  2KSJ A;  3B5N B;  4GR6 A;  1JMM A;  2WPR A;  1G2C A;  1M1J B;  4XRQ A;  3OW2 O;  3U1C A;  1L4A D;  1Q81 Q;  2GUV A;  1E6J P;  1A8O A;  4I1L A;  5AVY B;  1GZL A;  4WY4 C;  4XA4 A;  3HE4 B;  4PH0 A;  2WT7 A;  1KZU B;  1IC2 A;  3GHG B;  2O01 H;  5APW A;  3G3Z A;  2CPS A;  2R5B A;  1HTL C;  2W6B A;  3DS1 A;  3C9I A;  5AW3 B;  1GU5 A;  1FBM A;  5KLV K;  1JY2 N;  2N1T B;  2POH A;  3CCM P;  2WPQ A;  2Q3I A;  3DS3 A;  3H32 B;  1EIA A;  3M9B A;  3CCJ P;  3M91 A;  1NKN A;  2Z5I A;  4W7Z A;  2A45 H;  3V5B A;  1YJW P;  3P7K A;  2NPS A;  5APV A;  3VP9 A;  3U1A A;  3VMY A;  1GW4 A;  5BU5 A;  3G26 A;  2BUO A;  2Z46 A;  1SFC B;  2Q7C A;  1JTH A;  3CC4 P;  3H6P A;  3DS0 A;  3RK3 B;  1CZQ A;  1FZF A;  2QM7 A;  2Q5U A;  1NKZ B;  2WIT A;  2NPS C;  4IFD K;  3VOP A;  2QA4 P;  3M0A A;  2OTJ P;  3P8C E;  1D1D A;  4LC1 A;  1CW5 A;  1Z56 A;  3OA7 A;  5BVZ A;  1FDM A;  1JY3 O;  3NMD A;  1HVV A;  3KQG A;  3V2P A;  2YO2 A;  3WBH A;  1M1J A;  2Q9I A;  1CI6 B;  1GDT A;  1JUN A;  3MIW A;  4Y99 B;  3M06 A;  3CCS P;  2HOD B;  3HD7 B;  5HGM A;  5AW2 B;  5CCG D;  1GL2 B;  1J1D B;  3V4Q A;  3VMX A;  3KDP B;  4OH8 B;  2XU6 A;  1HH0 A;  2C9L Y;  4XE5 B;  2PEQ A;  3HE4 A;  2OYH A;  1J1E C;  3GHG A;  1Q86 Q;  3N4X A;  1DX7 A;  4XRO A;  4WYM A;  5KJ7 A;  2P2U A;  2GUS A;  2N1T A;  3LIE A;  5F2O A;  4KHX A;  1NOH A;  3H32 A;  2I1K A;  3MTU E;  1T3U A;  2P67 A;  3TYY A;  4C7R A;  3MUD A;  1H89 A;  2W27 A;  2XNX A;  5BS1 A;  1KIL A;  5JPA A;  4I2L C;  2OYH C;  1FOS E;  2BHV A;  3VN0 A;  3GHG C;  3HE5 B;  3TSI A;  2YNY A;  1SFC A;  1IFM A;  5AW4 B;  3B8E B;  1W2B O;  4WY4 D;  5AVX B;  4XFZ A;  1RE4 A;  3RK2 B;  1M1K Q;  4N78 E;  4N6J A;  3SWY A;  3A7O A;  4QNB A;  5AVQ B;  2EIA A;  1RF1 B;  1DH3 A;  1IUQ A;  3OAK A;  3SWF A;  3VMZ A;  4COC A;  3CCR P;  1KIL C;  1LGH B;  2XDJ A;  1VQ6 P;  4XFY A;  5KTB A;  2C0W A;  1SFC C;  2C9N Y;  3MD0 A;  1VDF A;  3CCQ P;  5CCG C;  2CWO A;  1RE4 C;  2R3C A;  4HH2 A;  3RK3 C;  2KOD A;  2HOD A;  3HD7 A;  3CC2 P;  2M8R A;  1GL2 A;  4ZKP A;  1VQN P;  1YHQ P;  2ZXE B;  3P32 A;  4WBA A;  2CPB A;  2FYU K;  2XKM A;  2LF4 A;  1M74 A;  1IFJ A;  3R2P A;  1AQ5 A;  1E5W A;  1YIJ P;  1RO2 A;  4U0C A;  2E1M A;  3G6E P;  5APY A;  4C7N B;  3RL0 B;  1RE3 A;  3OJA B;  3M9Q A;  1T2K C;  3RG6 C;  2NPS D;  1JY3 N;  2ZFC A;  4GR2 A;  1HGV A;  1H8A A;  3P05 A;  3HD7 C;  1LTJ A;  1HJB A;  2JEE A;  1L4A B;  2R32 A;  4N3Y B;  2E42 A;  1IFD A;  1XTC C;  1ZMB A;  4PH1 A;  1GD2 E;  2HLO A;  3V4W A;  3HE5 A;  3A5T A;  3V2Q A;  2E43 A;  4COP A;  2A45 G;  1JY3 P;  4IFF A;  1FZA A;  2BAS A;  3NXS A;  1QVG O;  1VPC A;  1N7S B;  3I56 P;  2PP6 A;  1LTJ C;  3PP5 A;  1HUC A;  1IJD B;  5AVT B;  1FU1 A;  5AVR B;  2PAJ A;  3G1G A;  2HG5 D;  1N86 A;  3DS2 A;  1QL1 A;  1KC8 Q;  4LGD E;  1NU1 K;  1VQ4 P;  2PEO A;  3H4E A;  1LTI C;  2KP8 A;  3E2D A;  3O8Z A;  4U0E A;  1QVF O;  1LT9 B;  1NJI Q;  3RK2 C;  5CMZ A;  1FZC B;  4W7Y A;  3VTP C;  1URQ B;  3HUS B;  2P9X A;  1KFM A;  1LWU B;  2HPC B;  3IR9 A;  1IFI A;  1SVF A;  2P7J A;  3M1M A;  1XTG B;  3BVH A;  1SQQ K;  1W2E A;  2YO3 A;  3HTK B;  3CL3 D;  4JYC A;  4C7N A;  1VQP P;  5DCK A;  3CCU P;  2YKP A;  3B5N A;  1KIL D;  2J59 M;  1JNM A;  3CCE P;  4C46 A;  1T3J A;  4DOJ A;  1ZR2 A;  3G71 P;  1LTG C;  5AW9 B;  1AUM A;  1SFC D;  5AW6 B;  1N73 B;  2H7H A;  3II6 A;  2L5G B;  4GIF A;  3RK3 D;  1EOQ A;  1K8A Q;  4U0D A;  4HYT B;  1M6E X;  1A02 F;  1HWT C;  3M0D A;  1YJN P;  3U59 A;  3RL0 C;  1PFI A;  3B5N C;  3KPE A;  1A43 A;  1N7S A;  3BAS A;  1M1J C;  3EFG A;  1VQM P;  3H0D A;  2PEK A;  2M8L A;  1M6N A;  2Z45 A;  4O9B A;  1NHL A;  2PEI A;  1T2K D;  1VQ5 P;  1BAJ A;  2HYN A;  2OAR A;  1Q82 Q;  3HD7 D;  5AW0 B;  3L37 A;  1MZ9 A;  1YI2 P;  2Z5H A;  3BAT A;  3VYI A;  1KD1 Q;  4WY4 B;  5KJ7 C;  1LT9 A;  1FZG A;  1N7S C;  1SQV K;  5CCH A;  4XFX A;  3DPH A;  2N1T C;  2R5D A;  1FZC A;  1VQ9 P;  1S72 P;  1JY2 O;  1URQ A;  3HUS A;  1HGZ A;  1LWU A;  2HPC A;  1RY3 A;  3LW5 H;  1L0L K;  2ONT A;  3CXC O;  3HTK A;  1M90 Q;  2YKO A;  3A2A A;  3NFQ A;  1K9M Q;  3NTN A;  2HFE D;  3TK1 A;  2H8P D;  5CHX A;  2WTY A;  2KYV A;  5F2K A;  5APS A;  3CMA P;  1CI6 A;  1H88 A;  5HGN A;  2JO0 A;  1SLQ A;  5AW1 B;  3G29 A;  2DGY A;  1URQ C;  1NWQ A;  3CC7 P;  5F2N A;  2PEJ A;  1LWU C;  1AFO A;  3L36 A;  3IFM A;  3RK2 D;  1L0N K;  5AW5 B;  4B86 A;  4AQR D;  4EIJ A;  3TNU B;  2OYI B;  2M8N A;  2XV6 A;  5AW8 B;  3G0V A;  5CJ4 A;  4AUW A;  4ZKU A;  4AYC A;  4Y99 C;  4I6M C;  1LTA C;  5APT A;  5APU A;  3CCL P;  1KFN A;  1WT6 A;  4W80 A;  2OTL P;  1GL2 C;  1J1D C;  1RNI A;  2PEM A;  2MJZ A;  5AW7 B;  2GM4 A;  3N7N A;  2WSF H;  2XXM A;  3NTE A;  5AVU B;  2WSC H;  1MFZ A;  2IFM A;  1RE3 C;  1GW3 A;  1KQL A;  2I1J A;  1OWA A;  3H47 A;  3DS4 A;  3RL0 D;  3CCV P;  2IPP A;  1NTM K;  2WPS A;  3VP8 A;  3B5N D;  1RF1 A;  4GT1 A;  1FAV A;  2FXM A;  5AVZ B;  3UIA A;  1VQL P;  3CLQ A;  2VRS A;  1SP4 A;  3A3Y B;  1LTT C;  1RF0 A;  1S9K D;  1VQ8 P;  1X8Y A;  1LTB C;  3BRT B;  2OYH B;  4U0A A;  1N2D C;  1X79 B;  3CI9 A;  1N8R Q;  1JCD A;  5HGL A;  1MV8 A;  1N7L A;  2YMY A;  1ZLL A;  5KJ7 D;  1RF1 C;  1N7S D;  2P1J A;  4M3L A;  1QRJ A;  2N1T D;  2M3B A;  1LTS C;  3CD6 P;  3EQ2 A;  4WB4 A;  3TNU A;  2YKQ A;  1RF0 C;  2XZR A;  2OYI A;  3L4F A;  1Q7Y Q;  1EQ7 A;  1KIL B;  3T97 A;  1IO4 A;  2FFD B;  3G4S P;  1T8Z A;  4EOT A;  3HZQ A;  1JY2 P;  1L4A A;  5CCH D;  1M7L A;  4JF7 A;  5APX A;  4M0I A;  1K73 Q;  3I55 P;  5AVW B;  1FZB A;  4DZO A;  1URQ D;  1VQK P;  2H43 A;  1K30 A;  2FYZ A;  2JYL A;  2OYI C;  5BU8 B;  5AVV B;  2J58 A;  2Z4E A;  4U0B A;  4RES B;  1DEB A;  3HRN A;  4IPY A;  2XT1 A;  2O1J A;  2KB7 P;  4GKG A;  1ZR4 A;  3LRY A;  1L4A C;  2IX7 C;  5AVS B;  3DS5 A;  1J2J B;  3E1I A;  3G21 A;  4U0F A;  2KLV A;  5BS2 A;  1FZE A;  3MGE A;  1WRG A;  2WZ7 A;  1GL2 D;  3M0D C;  1FJK A;  1SQP K;  2Z44 A;  1CSB A;  3WMM 0;  3KYQ A;  1OXZ A;  3V2R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...