3OW2O

Crystal structure of enhanced macrolide bound to 50s ribosomal subunit
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
143
structure length
143
Chain Sequence
b'TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAKGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RIBOSOMAL RNA
molecule tags Ribosome
total genus 47
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2010-09-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3ow2O03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 3ow2O01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 3ow2O02
1W2BO 1KD1Q 3CCQP 2QEXP 3G6EP 1K9MQ 1VQ7P 1K8AQ 2OTLP 1VQ9P 1Q82Q 1YHQP 1Q81Q 1QVFO 2OTJP 1YITP 3CCSP 1VQMP 3I56P 1YI2P 3CCMP 3CCRP 1NJIQ 1YIJP 3CMAP 3CMEP 3CCUP 3CC7P 1VQ5P 3I55P 3CCEP 1VQ8P 1VQPP 1VQKP 3G4SP 3CPWO 1YJNP 1VQ6P 3G71P 1YJ9P 1YJWP 3CC2P 3CCJP 1KQSO 1JJ2O 3CCVP 1N8RQ 1VQLP 3OW2O 3CD6P 1Q7YQ 1K73Q 1VQNP 3CCLP 1QVGO 1M1KQ 1S72P 1VQ4P 3CC4P 1VQOP 2QA4P 1Q86Q 3CXCO 1M90Q 1KC8Q
chains in the Genus database with same CATH superfamily
1AVOA 3L73D 4PH1A 1Q90D 2FYNC 5K5GB 3GMAA 4HJGH 1QGKB 5KLVD 2H89C 1Z56A 2FYUE 5H2FE 4JYBA 3P05A 4NPFX 1L0NJ 2Z5IA 1JM0A 1PV3A 2QG4A 1GL2B 2PEKA 1IK9A 1WMKA 1UJZA 1CZQA 2WMMA 3QH9A 3G28A 1SQXJ 2KGEA 1EDIA 4A7PA 4YXDC 4BPGA 4TLFA 2JB0A 2E74C 1GL2D 1L0LD 1HY8A 2KOOA 1SP4A 2NZ2A 3CD6P 3H1HG 1JEKA 3Q5PA 1HWTC 1IFNA 1KMIZ 1NKZB 1S9KD 1T6AA 1M1JA 1IFPA 1PGOA 1E79H 3VMYA 2N1TB 2WITA 3KZIE 4ZKPA 3CL3D 2W8ZA 3M9QA 1CEIA 4D6TE 5KLIB 2Y0CA 2B89A 1N73C 1HF9A 1GW4A 3CCUP 1FU1A 1LTJC 3JC22 5E79H 2FQ1A 2N1TD 4GOEA 2AF8A 3H1LE 2G8YA 2IDBA 4PV1D 2QNWA 1URQB 5DJTB 2J5UA 3DPHA 2W6BA 4H44B 4WYMA 1URQD 2O3JA 2Y9ZA 2WPRA 3VP8A 2VLQA 2W90A 4COCA 3A2AA 1SQQD 3O8ZA 4XFJA 4H44D 2KSJA 4GOFA 2LR2A 2WZ7A 1GK4A 1FZCB 1ZLLA 1M57D 1RE4A 1P84H 2QIWA 5GTHE 1BE3G 1NKNA 1LTAC 1A02F 1BGYG 5H2FH 2BEQD 3VP9A 5GTIE 2KYVA 2Z44A 3BRVB 2YO2A 1JO5A 1LGHB 1NU1D 1GL2A 1NH4A 2YKPA 3H1IJ 4CPGA 1OW8A 1K8AQ 2KXPB 3FWNA 1RQVA 2EHSA 2JO1A 3CXHD 1S5LE 1VHNA 3HUSC 3L71G 1GXGA 5KTBA 1J1DB 1T3JA 4UHPB 1LT1A 1X22A 3P8CE 4WWIA 3L73E 1K30A 5HGLA 5AVQB 2GDWA 2WT7B 1BCCG 5AW5B 5KLVE 2OTLP 2N1TA 2N50A 5BU5A 1SQPG 1GU4A 1OIPA 2POHA 3CWBD 2IYPA 3TSIA 1BDDA 3L70G 1NO4A 1AVYA 3C9IA 1Q86Q 2KIKA 1FZBA 1S5LX 1URQA 2K0YA 1T8KA 5CCHC 3CXHI 1NTMD 1S3JA 2IPPA 1IFDA 1L0LE 1KILB 1NTZD 3OAKA 1VQPP 1L0IA 5AW1B 1FOSF 3MUDC 2CWOA 2FXMA 1KILD 2K94A 5EW5E 1FZCA 3Q3DA 4R0MA 1Y8AA 2M8LA 2HFED 2VSQA 5GTHH 1FJKA 2Q3IA 1YJ9P 3BATA 1MV8A 2QM8A 1K05A 4Y99B 2Z5HA 3EFFK 2QRXA 2JGPA 3GHGB 5GTIH 4GDOA 4MRTC 4ASWA 3RL0C 2A45I 3VMXA 3CPWO 1VQ6P 4RJTA 2NPSC 1S5LH 1SQQE 2RKLA 3AE9C 1S72P 3L75G 3ITKA 2KLVA 2KOQA 2Q3EA 1ZV8A 2KB7P 2WT7A 4WY4A 1JUNA 2GZJA 1LTBC 3NFQA 2FADA 1YI2P 3D6ZA 2E75C 2XZ0D 4U3FD 3WUVA 1FDOA 1PP9D 3E1IA 2BHVA 1NU1E 2YXRB 3WU2E 1KV4A 1EDJA 1NAFA 3H1LJ 2QJYB 1NTKD 3CXHE 1N2DC 1DIPA 1T2KD 2N98A 3I56P 3P7KA 2P58A 1KILA 2ZYDA 5CBOA 1VQLP 1YTZT 2WPSA 3VMAA 3WUTA 3T97B 3AE5C 1BGYJ 2IBZI 2Y0DA 1KQGB 3CMAP 4U0BA 2N9BA 2ZXEB 5BVZA 2N5HA 4EOTA 3L71J 2WSFJ 2AEJA 3CC4P 1XTGB 2QVAA 2GZEA 1NTME 3GHGA 2JEEA 3H1JJ 4DZOA 1NTZE 2KR5A 3A7OA 3KQGA 2O1KA 3SWYA 4C46A 2N6ZA 2ZYGA 4W7ZA 1PPJD 3CC2P 3BRTB 1KILE 2E43A 2QJPC 1G2CB 1IZNB 2KK7A 3E7KA 3L70J 4W7YA 1X0TA 4IZ6A 4KJMA 2HYNA 3CCSP 3GLMA 3CCRP 3IR9A 3VTPC 1AJYA 3DS0A 1PZQA 1ZMEC 2KW2A 1N7SB 2V4HA 4N6JA 1T3UA 4LLHA 3P8MC 1JCDA 1NHLA 1SVFA 3BCCG 2YIUB 2JU2A 3Q20A 1SQXG 1SQBD 3DS3A 1N7SD 1FJPA 2ZFCA 5APSA 3WU2H 2GDYA 1FDIA 2XKMA 3CXHH 4WB4A 1R5LA 3RGUA 3M06A 1LTIC 1M6NA 3L72G 4L76A 1UNKA 3T97A 1YBKA 2QJKB 1KC8Q 1L4AC 2M0BA 4RESB 1HVVA 1RF0A 3DS2A 3TGUJ 2OYHB 2KOGA 1RHZB 5AW8B 1M6EX 4U3FE 3CCMP 2CK3H 1PP9E 2PEIA 3TDKA 1H0TB 1NAYA 1NYHA 2JYLA 1PGQA 3H32B 1Q7YQ 2EFJA 3V2PA 2XXMA 3AEBC 3H1HD 1NTKE 3VOPA 2C9NY 2QEXP 2AFDA 3RBXA 1RO0A 4HYTB 1VQ7P 2PEJA 2E42A 1M7LA 2WSCJ 1AQTA 1IJDB 2N6YA 3LRYA 5CZDB 4R4LA 2VLNA 2A45H 2XZ1C 1FC2C 5KP6B 2BCCG 1SQVK 1G2CA 1PFIA 2R32A 1IO4A 1GMJA 3LIEA 2QM7A 1M1JC 1J1EB 2OQQA 3W68A 2E1MA 2JR8A 2Q1KA 3MHVA 4YXWH 3G1GA 2K93A 4BPHA 4IFMA 1YIJP 1KB9D 1OVRA 2VLOA 1N7SA 1OVUA 1QLED 2R5DA 2KGAA 1MZ9A 3R4YA 5AVUB 3CE7A 3PLNA 3PTZA 1PPJE 1OR5A 2A06G 1BE3D 3G71P 3GKLC 1KZUB 2XU6A 2O01J 2R5BA 2V7QH 2N9YB 2OARA 2MR7A 4NEOA 5AW3B 3L74J 3TNUB 1BAJA 1FOSE 2EG5A 2OYHA 1D1DA 1RE4C 1DNYA 1HH0A 4IPYA 3HRNA 3V2QA 1VQ5P 1H0TA 2MY5A 1AYIA 4EI2A 3LW5H 3H32A 1SQBE 2DNWA 2WSSH 2FVEA 1ZRTD 2H43A 2M8PA 2FY8A 5JPAA 1BCCD 1S2EA 1SS1A 1HBWA 1GL2C 3UIAA 2K2QA 3NTEA 3FXEA 4DCKA 2PEMA 1NTZJ 1SQPD 1KORA 1VF5B 3L4FA 2BEZF 3FXDA 2MF4A 2FYUK 5CCGD 5APQA 4JBZA 5CHXA 1WT6A 1CSBA 2LL8A 3LMOA 1VF5D 3BCCJ 3SFEC 2FYUG 2N1TC 2YKQA 2E76B 2KI7B 5KLIC 2N5IA 4PV1C 1RNIA 3H1HE 3D71A 2AEFA 1GK6A 2IFMA 2BQ1E 2Q9IA 5CJ4A 3CCQP 2E76D 5HVCA 4H13B 3L72J 1URQC 4YPCA 1BSHA 3M0DA 1U7MA 4H13D 4H44C 1IC2A 1RF1B 1RH5B 3MGNA 5KAFE 3GF3A 2ZJSE 2IFNA 2QA4P 1EDLA 3U43A 3GJNA 3PJSK 2O1JA 1FZFA 2K5XA 3TNUA 2C9LY 1KB9E 1L0HA 4D6TG 1FZCC 3E1RA 4AYCA 1S4XA 2QSIA 5AW2B 3G1IA 3M9HA 2ONTA 3H1LG 1R8EA 5HGNA 4OVNF 3VMZA 1YYCA 5KP7B 3L75D 2BCCJ 3A3YB 1F80D 1BE3E 3C1LA 1LWUB 1AA0A 1QX8A 1ZOYC 5CCGA 3HD7B 1HGZA 4I6MC 4UB8E 2WVRA 1EDKA 4I1LA 2H88C 1SQVJ 1J1DC 1ZMBA 2FKWB 1KQFB 4XE5B 2LOLA 2XNDH 3FWLA 1KTMA 3HD7D 3FGAD 3GF7A 4L75A 4PH0A 2W83C 4H0LB 2Y9YA 4BXLA 4M0IA 3U1AA 2H8PD 2ZT9B 4H0LD 2PEQA 3NTNA 3S1KA 1ZRTE 2I8DA 3H1JG 4GODA 4WVZA 2ZT9D 4COPA 2OYOA 3AEFC 4WY4B 3TYYA 4L73A 1SQPE 4I2LC 4YTPC 3Q1MA 5KLVK 2FXOA 4LC1A 3RL0g 3F5HA 1RF1A 1KILC 4WY4D 3AE4C 2GZIA 3KXDA 2OYIB 5KAFH 1GTWA 2E5TA 3H1KJ 2K9YA 4C7NB 1FZEA 1HTLC 1HGVA 5TISH 5KLVG 2GYKA 2GZFA 2KODA 5F2KA 1KB9H 4I7ZB 2KSEA 4HH2A 2JU1A 2GUSA 1A8OA 1S9KE 1L0LK 4HB1A 2HLOA 3B8EB 5AVZB 2J58A 1TU3F 4Y99C 1AQ5A 1EZVD 1X9VA 2D2CB 3GHGC 3AE6C 3C8VA 2LTEA 2E5YA 2QE7H 1LWUA 3VYIA 2JYGA 3IAOA 3MGEA 3SWKA 3HD7A 3CX5H 2FYUJ 1L0ND 2D2CD 3II6A 3TGUG 1AFOA 2XT1A 4UB8H 4NPEA 1DEEG 3AEDC 1SQXD 2M3BA 1JNMA 7CEIA 1MKMA 4DOJA 2XV6A 1Q2NA 1YJWP 2AVAA 4IL6E 2WSFH 3U59A 1H8AA 3MIWA 5AW9B 5APYA 2LXBA 3L75E 1GD2E 1JTHB 2I1KA 2P1JA 1EZVI 5APTA 1SQQK 3SFDC 2DGYA 3G0VA 3MTUE 3BASA 1T2KC 3NXSA 5CBNA 1JY3N 1GPJA 2QJYC 1R5SA 2Q5UA 1JCCA 1VL2A 4D6TJ 4XRQA 5DJUB 4DJGA 1JY3P 4W80A 2OYIA 4C7NA 1FAVA 4IL6X 1NU1K 1QL2A 1RF0C 1KFMA 2FXPA 2RMZA 2K0DX 3KPEA 2CNRA 4OGQB 5KP8B 1JY3O 1NOHA 3G29A 2Z45A 5BS1A 3V6IA 1SLQA 1MFTA 1G1JA 2WSEH 4OGQD 1KN7A 3BVHA 3L37A 1OW7A 5KJ7D 3R2PA 4H2YC 3CWBE 1PGJA 2AFEA 3RG2A 3AE7C 3I5CA 4ZKUA 5CJ0A 3L74G 3IFMA 2XNXA 4PD4D 3S4RA 3H1ID 2P9XA 4XA4A 1N7LA 1OZHA 1Q82Q 3B5NB 1USEA 3RK2B 1NTMK 1VPCA 4H2XC 1FE6A 4U0FA 3JSVC 2FFDB 3AEAC 2M3EA 2A06D 1NTZK 2FVAA 1ZR2A 3LIDA 3B5ND 5I4TG 4IL6H 1N7SC 3RK2D 1JTHA 3FX0A 3CXCO 3H0DA 1EZVE 1NTMG 2XV5A 4PXHB 3Q5SA 1FBMA 3L73J 2KWLA 2YIUC 5AVWB 1NTZG 3AE2C 4U0CA 2C0XA 1VKUA 3MZWB 2FVFA 5KLVJ 1OX3A 3OJAB 3CCJP 1L0NE 4BRYB 2ZXXA 1WRGA 3KDPB 4PD4I 1CI6B 1LT9B 1SQXE 2B9BA 2JJLA 1JB0J 2LKMA 1HUCA 3DS4A 2QJKC 2SPZA 3Q2YA 2K1AA 2OYHC 4NPDA 2L22A 1G1IA 1L0LJ 5AW4B 3N4XA 4RO0A 1ZR4A 2JO0A 5KJ7A 1FDMA 2LKIA 3HE4B 1GW3A 5DCKA 1FZAA 1OXZA 4JYCA 4AUWA 1H88A 1GU5A 3PH0A 2L91A 1X8YA 1W2EA 2FBWC 2JP3A 1RY3A 1ZNVA 2IBZG 1QL1A 1YTZI 2OTKE 1ZN5A 3EJEA 4K3AA 2GZGA 1K9MQ 3GG2A 1VQ9P 1NTKK 1JY2O 3M1MA 1OFCX 3B5NA 1PGPA 2OTJP 4M3LA 2LIWA 2MJZA 1J1EC 2MR8A 3L36A 1AUMA 1D7MA 2FFDA 4ZMDA 1X79B 1FR2A 1L4AB 2K9JB 2GDXA 1SQQJ 4N3YB 1FZGA 1EQ7A 2YO3A 3L35A 3RBZA 5KKZB 1SQVG 2LIUA 3PP5A 1M56D 4BRYA 4WBAA 3M0DC 3M91A 4PD4E 1CI6A 3H1IE 1LT9A 2GA1A 3H1LD 4QKOA 3G26A 2WPTA 1E5WA 3G9RA 2P7JA 2YMKA 3SSUA 1NU1J 1PEMA 1ZP0C 2KUBA 2A06E 3SWFA 1VQKP 1RE3A 5AVRB 3CX5D 1X3OA 3G3ZA 1BGYD 1VQOP 1DEBA 5APWA 3HE4A 2HG5D 2GM4A 1IK7A 4U0DA 4N78D 1KB9I 5HGMA 4HKZH 1EXJA 2PENA 5C39A 2JWDA 3L71D 2HODB 2PEOA 3CWBJ 3H1KG 4R4MA 5CCGC 2BUOA 1RQUA 2M8NA 2K0XA 4XFZA 2VRSA 1VF5C 2Z4EA 3H1JD 5B5EE 2ZAEB 5AVTB 5AVSB 3WUUA 2H7HA 1LTSC 1NTMJ 3CX5I 1KLPA 1ACPA 4C7RA 4EYYQ 2W27A 4PJ0E 2RH0A 3RK3B 5AW6B 1K04A 1L4AA 2K9JA 1Z6MA 1SFCB 2E76C 3L70D 1U7JA 3RK3D 5EJDA 3RG6C 1Y9BA 3U1CA 3JCUH 3HE5B 1SFCD 4H13C 2NRGA 4Z1MH 1OWAA 5KAIH 1GZLA 3A0BE 2JBGA 4AQRD 1N8RQ 4CA3A 1MZ8A 2FQ2A 4XFXA 2FYNB 1RF1C 2M5RA 2KZIA 4GKGA 3DS1A 3D70A 1QRJA 4PD4H 2P67A 4L74A 2HPCB 2KLUA 1RO2A 3HTKA 1IUQA 3N7NA 3M0AA 1PEQA 2FQ0A 5HV8A 3CCEP 1XTCC 2AXTE 1VQNP 1GXHA 2JWAA 3CLQA 4IFFA 4QNBA 2V7QJ 5AVYB 3WMM0 5TISE 2ROQA 2G3AA 3TGUD 4KHXA 4H2WC 2KS1B 1MFZA 2E74B 1QVFO 4PV1B 3GZLA 2WQYC 4UB6E 1JJ2O 4U3FJ 1LWUC 2HODA 3LW5J 2E74D 1PP9J 3HD7C 2R44A 3KHUA 2P2UA 2CPBA 2UWJE 1N73B 1DH3A 3H4EA 4RKUJ 1NTKJ 1LTJB 1A02J 1YHQP 5B5EH 1CW5A 1IFIA 3AE1C 2FACA 1GDTA 1NJIQ 4H0LC 3CX5E 3USSA 5BU8B 4BPFA 3V2RA 2MVVA 1BGYE 1K73Q 4PJ0H 1T8ZA 1QVGO 1A43A 2ZT9C 4Y28J 1SFCA 1UIXA 4N78E 2PNGA 1BXIA 3MP7B 2Y0EA 1NGMB 1LP1B 2K92A 1W5CE 3HE5A 5APVA 2L0QA 3L71E 1VQ8P 3G4SP 2JAZA 4WY4C 3W67A 1KYOD 3V4WA 3V4QA 2NO8A 3A0BH 2IZ0A 1M8OB 3H1JE 1PL5A 3VN0A 2KGCA 4K35A 1PEOA 3EWKA 1BCCE 4DT0A 2HPCA 2OYIC 1EXIA 1LJ2A 3KYQA 2YKOA 1HJ0A 4MN4C 3A0HE 2IZ1A 2IX7C 1H89A 2P10A 3NY7B 1SQPK 3L70E 2X2BA 4I7ZC 2KOSA 2CPSA 3L73G 3RK3E 3L74D 2AXTH 4ASVA 2MVUA 1QEXA 3HUSB 2DW3A 2KS1A 3KZIH 1KYOI 2C0WA 2XDJA 2R3SA 2D2CC 1HQBA 3DS5A 5AW7B 2B87B 3K5BA 4UB6H 2Z46A 1E6JP 1FS0E 1LTTC 1SQBJ 4QMAA 1DX7A 1N73A 1AF8A 1LTJA 3B5IA 4B86A 4F37A 1L0LG 2W6JH 1EIAA 2L9FA 1OVVA 2PFXA 2K37A 1PIXA 2KG9A 2FHSC 3TGUE 3OA7A 1HJBA 5AVVB 1E0HA 3BCCD 3PRJA 1LP1A 5CCHD 3AE3C 2J59M 1PEUA 3TF5A 4PWVB 2ZVOB 3H25A 2W6AA 3TK1A 2YNYA 2Q6QA 3V2NA 3EQ2A 3HZQA 2EIAA 3H1HJ 3L72D 2KNCB 1KQLA 1KQSO 3AECC 1SQQG 3WBHA 3CCVP 3OW2O 3H47A 2CG5B 3A0HH 5APUA 4OGQC 2ITAA 2PGDA 4GT1A 2FYZA 3EJDA 3RL0B 5KJ7C 2KG8A 2IBZD 5F2OA 3HUSA 2ERHA 5B66E 1BDCA 3ABVC 2NPSB 2Q7CA 4IFDK 1NQ4A 1KYOE 3GW6A 2JQ4A 3RL0D 2B87A 2AXCA 1JOCA 3Q5RA 3D6YA 2NPSD 2PY8A 1NU1G 1J2JB 2PP6A 2BCCD 3O6QB 3AEGC 2E75B 1JMMA 2WPQA 2AEMA 2GUVA 1YJNP 3B5NC 4BWNA 2B88A 5HGOA 1BE3J 1OMIA 2E75D 3RK2C 1SQVD 3GZMA 3L74E 2FFDC 1EMVA 5CCHA 3M9BA 1KD1Q 2JKVA 4U7JA 2WTYA 3IN6A 2WWWA 3AE8C 2LPKA 2O01N 1N86A 3G21A 3CWBG 4KT0J 2KORA 3MUDA 2PRRA 1ZXGA 4IOIH 1VQ4P 1UIIA 5BS2A 2K88A 2ZVNB 2KNCA 2CQ8A 2VLPA 1LT9C 4EDFA 2XZRA 5APXA 2L5GB 1Q81Q 1YITP 3H6PA 1BCCJ 5EFWB 2HR3A 2WSCH 2A45G 4JQ0D 1SQPJ 2K3RA 3VRLC 3PHLA 1RE3C 3H1KD 2KZJA 1EZVG 1L0NK 3BCCE 3F89A 3B4QA 1Y47A 1BSNA 1OW6A 3DTJA 2IYOA 1SQXK 2L4BA 2NPSA 5B66H 2LMLA 4O9BA 1L0NG 2QJPB 4OH8B 1KYOH 3ZDMA 1DD4A 2MKVA 3L72E 1JY2N 5TJHA 2WSEJ 1NVOA 3V5BA 3O6QA 1P84D 5M1BA 2YXQB 5L8RJ 4TT3H 3EJBA 1ZW0A 1YQ4C 1S1CX 1JY2P 2FYUD 2BASA 3EFGA 2O01H 3IF4A 1M1KQ 2IBZE 5AVXB 1W2BO 1NWQA 2MD9A 2I1JA 1JMBA 1LTGC 1USDA 2M5AB 3CI9A 4U3FG 2KP8A 3CMEP 3B71A 1PP9G 4GR6A 5KKZC 3CCLP 3A5TA 2KG6A 1P84I 2BCCE 1NTKG 4EIJA 1IMQA 2M8RA 4HKGA 2CGQA 3L75J 3HYBA 3JCUE 1L4AD 1IFJA 3MD0A 4ZNCA 5KAIE 1VQMP 5AW0B 2R3CA 4D6TD 4XFYA 1SQVE 2L6EA 2FAEA 3QWOC 1DV5A 4U0AA 2LXCB 1U57A 5F2NA 4LGDE 3NMDA 1M90Q 2KGDA 1MUUA 4DG9A 3HTKB 4XROA 1EC5A 2RN0A 2YMYA 3CC7P 3AEEC 2WPVB 1DD3A 3E2DA 2PAJA 4OWFA 4JPZB 1M1JB 3B4SA 3H1IG 4GR2A 4U0EA 3G6EP 1M74A 1IMPA 5E79E 2KOPA 1PPJG 1KFNA 3I55P 3P32A 3H1KE 4JF7A 3RK3C 5CMZA 1YQ3C 1VDFA 2ZYAA 1SFCC 2LF4A 1IFMA 1SQBK 2M5AA 3S9OA 2JDIH 1L2PA 1AV1A 1EOQA 1LNQA 2EHTA 1SQBG 4GIFA 2OGUA 3P8CD 1P84E
chains in the Genus database with same CATH topology
3DS1A 1PEOA 1QRJA 3DS2A 3HYBA 1BAJA 4PH1A 2EG5A 1RO2A 1PEMA 1IUQA 3DS4A 1Q81Q 1D1DA 1M6EX 2KODA 2M8LA 5F2KA 1YITP 1VQMP 3CCMP 1PEQA 4IPYA 3CMAP 4U0BA 1VQ5P 2PEIA 3CCEP 1VQKP 4XFYA 2JYLA 1YJ9P 1KQSO 2L6EA 3G1IA 3WBHA 3CCVP 3G29A 3OW2O 1Q7YQ 1A8OA 2ONTA 3H47A 4U0AA 3VRLC 3P05A 1VQNP 2EFJA 5F2NA 2JO0A 2XXMA 3CC4P 2Z45A 2Z44A 4QNBA 5BS1A 5HGNA 1VQOP 1M90Q 2QEXP 2M8PA 2PEKA 5DCKA 1RO0A 3DTJA 5F2OA 2PEJA 1VQ7P 1K8AQ 4U0DA 3G28A 5JPAA 1QVFO 4XROA 5HGMA 3NTEA 3CC7P 2PENA 2JYGA 2PEMA 3CPWO 3MGEA 1VQ6P 3LRYA 3CC2P 3E2DA 3DS5A 1JJ2O 2PEOA 3CD6P 2BUOA 1S72P 1ZMBA 2M8NA 2PY8A 2Z46A 1K30A 2XT1A 1E6JP 4XFZA 5HGLA 4GR2A 2P9XA 4U0EA 4PH0A 3H4EA 3G6EP 1M74A 1K9MQ 2E1MA 2OTLP 1VQ9P 1Q82Q 4M0IA 1YHQP 3M1MA 3G1GA 3B5IA 2OTJP 3CCSP 1YI2P 1NJIQ 3CCRP 2XV6A 1YIJP 1EIAA 3CCUP 3I55P 4U0FA 3DS0A 1AUMA 1YJNP 1YJWP 5HGOA 2PEQA 1RNIA 1K73Q 1QVGO 1M1KQ 1A43A 5I4TG 2BHVA 1Q86Q 3Q20A 3CXCO 2BQ1E 3H0DA 1W2BO 1KD1Q 2DGYA 3DS3A 3CCQP 3G0VA 3RG6C 4COPA 2LF4A 3DPHA 4U0CA 3I56P 4WYMA 2EIAA 3G21A 3CMEP 1VQ8P 1VQPP 1PEUA 3G4SP 3G71P 1EOQA 3CCJP 4XRQA 1N8RQ 1VQLP 4GR6A 4COCA 3CCLP 1M6NA 1VQ4P 2CWOA 4XFXA 2QA4P 3HZQA 2OARA 3G26A 5BS2A 1KC8Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W2B O;  1KD1 Q;  3CCQ P;  2QEX P;  3G6E P;  1K9M Q;  1VQ7 P;  1K8A Q;  2OTL P;  1VQ9 P;  1Q82 Q;  1YHQ P;  1Q81 Q;  1QVF O;  2OTJ P;  1YIT P;  3CCS P;  1VQM P;  3I56 P;  1YI2 P;  3CCM P;  3CCR P;  1NJI Q;  1YIJ P;  3CMA P;  3CME P;  3CCU P;  3CC7 P;  1VQ5 P;  3I55 P;  3CCE P;  1VQ8 P;  1VQP P;  1VQK P;  3G4S P;  3CPW O;  1YJN P;  1VQ6 P;  3G71 P;  1YJ9 P;  1YJW P;  3CC2 P;  3CCJ P;  1KQS O;  1JJ2 O;  3CCV P;  1N8R Q;  1VQL P;  3OW2 O;  3CD6 P;  1Q7Y Q;  1K73 Q;  1VQN P;  3CCL P;  1QVG O;  1M1K Q;  1S72 P;  1VQ4 P;  3CC4 P;  1VQO P;  2QA4 P;  1Q86 Q;  3CXC O;  1M90 Q;  1KC8 Q; 
#chains in the Genus database with same CATH topology
 1AVO A;  3L73 D;  4PH1 A;  1Q90 D;  2FYN C;  5K5G B;  3GMA A;  4HJG H;  1QGK B;  5KLV D;  2H89 C;  1Z56 A;  2FYU E;  5H2F E;  4JYB A;  3P05 A;  4NPF X;  1L0N J;  2Z5I A;  1JM0 A;  1PV3 A;  2QG4 A;  1GL2 B;  2PEK A;  1IK9 A;  1WMK A;  1UJZ A;  1CZQ A;  2WMM A;  3QH9 A;  3G28 A;  1SQX J;  2KGE A;  1EDI A;  4A7P A;  4YXD C;  4BPG A;  4TLF A;  2JB0 A;  2E74 C;  1GL2 D;  1L0L D;  1HY8 A;  2KOO A;  1SP4 A;  2NZ2 A;  3CD6 P;  3H1H G;  1JEK A;  3Q5P A;  1HWT C;  1IFN A;  1KMI Z;  1NKZ B;  1S9K D;  1T6A A;  1M1J A;  1IFP A;  1PGO A;  1E79 H;  3VMY A;  2N1T B;  2WIT A;  3KZI E;  4ZKP A;  3CL3 D;  2W8Z A;  3M9Q A;  1CEI A;  4D6T E;  5KLI B;  2Y0C A;  2B89 A;  1N73 C;  1HF9 A;  1GW4 A;  3CCU P;  1FU1 A;  1LTJ C;  3JC2 2;  5E79 H;  2FQ1 A;  2N1T D;  4GOE A;  2AF8 A;  3H1L E;  2G8Y A;  2IDB A;  4PV1 D;  2QNW A;  1URQ B;  5DJT B;  2J5U A;  3DPH A;  2W6B A;  4H44 B;  4WYM A;  1URQ D;  2O3J A;  2Y9Z A;  2WPR A;  3VP8 A;  2VLQ A;  2W90 A;  4COC A;  3A2A A;  1SQQ D;  3O8Z A;  4XFJ A;  4H44 D;  2KSJ A;  4GOF A;  2LR2 A;  2WZ7 A;  1GK4 A;  1FZC B;  1ZLL A;  1M57 D;  1RE4 A;  1P84 H;  2QIW A;  5GTH E;  1BE3 G;  1NKN A;  1LTA C;  1A02 F;  1BGY G;  5H2F H;  2BEQ D;  3VP9 A;  5GTI E;  2KYV A;  2Z44 A;  3BRV B;  2YO2 A;  1JO5 A;  1LGH B;  1NU1 D;  1GL2 A;  1NH4 A;  2YKP A;  3H1I J;  4CPG A;  1OW8 A;  1K8A Q;  2KXP B;  3FWN A;  1RQV A;  2EHS A;  2JO1 A;  3CXH D;  1S5L E;  1VHN A;  3HUS C;  3L71 G;  1GXG A;  5KTB A;  1J1D B;  1T3J A;  4UHP B;  1LT1 A;  1X22 A;  3P8C E;  4WWI A;  3L73 E;  1K30 A;  5HGL A;  5AVQ B;  2GDW A;  2WT7 B;  1BCC G;  5AW5 B;  5KLV E;  2OTL P;  2N1T A;  2N50 A;  5BU5 A;  1SQP G;  1GU4 A;  1OIP A;  2POH A;  3CWB D;  2IYP A;  3TSI A;  1BDD A;  3L70 G;  1NO4 A;  1AVY A;  3C9I A;  1Q86 Q;  2KIK A;  1FZB A;  1S5L X;  1URQ A;  2K0Y A;  1T8K A;  5CCH C;  3CXH I;  1NTM D;  1S3J A;  2IPP A;  1IFD A;  1L0L E;  1KIL B;  1NTZ D;  3OAK A;  1VQP P;  1L0I A;  5AW1 B;  1FOS F;  3MUD C;  2CWO A;  2FXM A;  1KIL D;  2K94 A;  5EW5 E;  1FZC A;  3Q3D A;  4R0M A;  1Y8A A;  2M8L A;  2HFE D;  2VSQ A;  5GTH H;  1FJK A;  2Q3I A;  1YJ9 P;  3BAT A;  1MV8 A;  2QM8 A;  1K05 A;  4Y99 B;  2Z5H A;  3EFF K;  2QRX A;  2JGP A;  3GHG B;  5GTI H;  4GDO A;  4MRT C;  4ASW A;  3RL0 C;  2A45 I;  3VMX A;  3CPW O;  1VQ6 P;  4RJT A;  2NPS C;  1S5L H;  1SQQ E;  2RKL A;  3AE9 C;  1S72 P;  3L75 G;  3ITK A;  2KLV A;  2KOQ A;  2Q3E A;  1ZV8 A;  2KB7 P;  2WT7 A;  4WY4 A;  1JUN A;  2GZJ A;  1LTB C;  3NFQ A;  2FAD A;  1YI2 P;  3D6Z A;  2E75 C;  2XZ0 D;  4U3F D;  3WUV A;  1FDO A;  1PP9 D;  3E1I A;  2BHV A;  1NU1 E;  2YXR B;  3WU2 E;  1KV4 A;  1EDJ A;  1NAF A;  3H1L J;  2QJY B;  1NTK D;  3CXH E;  1N2D C;  1DIP A;  1T2K D;  2N98 A;  3I56 P;  3P7K A;  2P58 A;  1KIL A;  2ZYD A;  5CBO A;  1VQL P;  1YTZ T;  2WPS A;  3VMA A;  3WUT A;  3T97 B;  3AE5 C;  1BGY J;  2IBZ I;  2Y0D A;  1KQG B;  3CMA P;  4U0B A;  2N9B A;  2ZXE B;  5BVZ A;  2N5H A;  4EOT A;  3L71 J;  2WSF J;  2AEJ A;  3CC4 P;  1XTG B;  2QVA A;  2GZE A;  1NTM E;  3GHG A;  2JEE A;  3H1J J;  4DZO A;  1NTZ E;  2KR5 A;  3A7O A;  3KQG A;  2O1K A;  3SWY A;  4C46 A;  2N6Z A;  2ZYG A;  4W7Z A;  1PPJ D;  3CC2 P;  3BRT B;  1KIL E;  2E43 A;  2QJP C;  1G2C B;  1IZN B;  2KK7 A;  3E7K A;  3L70 J;  4W7Y A;  1X0T A;  4IZ6 A;  4KJM A;  2HYN A;  3CCS P;  3GLM A;  3CCR P;  3IR9 A;  3VTP C;  1AJY A;  3DS0 A;  1PZQ A;  1ZME C;  2KW2 A;  1N7S B;  2V4H A;  4N6J A;  1T3U A;  4LLH A;  3P8M C;  1JCD A;  1NHL A;  1SVF A;  3BCC G;  2YIU B;  2JU2 A;  3Q20 A;  1SQX G;  1SQB D;  3DS3 A;  1N7S D;  1FJP A;  2ZFC A;  5APS A;  3WU2 H;  2GDY A;  1FDI A;  2XKM A;  3CXH H;  4WB4 A;  1R5L A;  3RGU A;  3M06 A;  1LTI C;  1M6N A;  3L72 G;  4L76 A;  1UNK A;  3T97 A;  1YBK A;  2QJK B;  1KC8 Q;  1L4A C;  2M0B A;  4RES B;  1HVV A;  1RF0 A;  3DS2 A;  3TGU J;  2OYH B;  2KOG A;  1RHZ B;  5AW8 B;  1M6E X;  4U3F E;  3CCM P;  2CK3 H;  1PP9 E;  2PEI A;  3TDK A;  1H0T B;  1NAY A;  1NYH A;  2JYL A;  1PGQ A;  3H32 B;  1Q7Y Q;  2EFJ A;  3V2P A;  2XXM A;  3AEB C;  3H1H D;  1NTK E;  3VOP A;  2C9N Y;  2QEX P;  2AFD A;  3RBX A;  1RO0 A;  4HYT B;  1VQ7 P;  2PEJ A;  2E42 A;  1M7L A;  2WSC J;  1AQT A;  1IJD B;  2N6Y A;  3LRY A;  5CZD B;  4R4L A;  2VLN A;  2A45 H;  2XZ1 C;  1FC2 C;  5KP6 B;  2BCC G;  1SQV K;  1G2C A;  1PFI A;  2R32 A;  1IO4 A;  1GMJ A;  3LIE A;  2QM7 A;  1M1J C;  1J1E B;  2OQQ A;  3W68 A;  2E1M A;  2JR8 A;  2Q1K A;  3MHV A;  4YXW H;  3G1G A;  2K93 A;  4BPH A;  4IFM A;  1YIJ P;  1KB9 D;  1OVR A;  2VLO A;  1N7S A;  1OVU A;  1QLE D;  2R5D A;  2KGA A;  1MZ9 A;  3R4Y A;  5AVU B;  3CE7 A;  3PLN A;  3PTZ A;  1PPJ E;  1OR5 A;  2A06 G;  1BE3 D;  3G71 P;  3GKL C;  1KZU B;  2XU6 A;  2O01 J;  2R5B A;  2V7Q H;  2N9Y B;  2OAR A;  2MR7 A;  4NEO A;  5AW3 B;  3L74 J;  3TNU B;  1BAJ A;  1FOS E;  2EG5 A;  2OYH A;  1D1D A;  1RE4 C;  1DNY A;  1HH0 A;  4IPY A;  3HRN A;  3V2Q A;  1VQ5 P;  1H0T A;  2MY5 A;  1AYI A;  4EI2 A;  3LW5 H;  3H32 A;  1SQB E;  2DNW A;  2WSS H;  2FVE A;  1ZRT D;  2H43 A;  2M8P A;  2FY8 A;  5JPA A;  1BCC D;  1S2E A;  1SS1 A;  1HBW A;  1GL2 C;  3UIA A;  2K2Q A;  3NTE A;  3FXE A;  4DCK A;  2PEM A;  1NTZ J;  1SQP D;  1KOR A;  1VF5 B;  3L4F A;  2BEZ F;  3FXD A;  2MF4 A;  2FYU K;  5CCG D;  5APQ A;  4JBZ A;  5CHX A;  1WT6 A;  1CSB A;  2LL8 A;  3LMO A;  1VF5 D;  3BCC J;  3SFE C;  2FYU G;  2N1T C;  2YKQ A;  2E76 B;  2KI7 B;  5KLI C;  2N5I A;  4PV1 C;  1RNI A;  3H1H E;  3D71 A;  2AEF A;  1GK6 A;  2IFM A;  2BQ1 E;  2Q9I A;  5CJ4 A;  3CCQ P;  2E76 D;  5HVC A;  4H13 B;  3L72 J;  1URQ C;  4YPC A;  1BSH A;  3M0D A;  1U7M A;  4H13 D;  4H44 C;  1IC2 A;  1RF1 B;  1RH5 B;  3MGN A;  5KAF E;  3GF3 A;  2ZJS E;  2IFN A;  2QA4 P;  1EDL A;  3U43 A;  3GJN A;  3PJS K;  2O1J A;  1FZF A;  2K5X A;  3TNU A;  2C9L Y;  1KB9 E;  1L0H A;  4D6T G;  1FZC C;  3E1R A;  4AYC A;  1S4X A;  2QSI A;  5AW2 B;  3G1I A;  3M9H A;  2ONT A;  3H1L G;  1R8E A;  5HGN A;  4OVN F;  3VMZ A;  1YYC A;  5KP7 B;  3L75 D;  2BCC J;  3A3Y B;  1F80 D;  1BE3 E;  3C1L A;  1LWU B;  1AA0 A;  1QX8 A;  1ZOY C;  5CCG A;  3HD7 B;  1HGZ A;  4I6M C;  4UB8 E;  2WVR A;  1EDK A;  4I1L A;  2H88 C;  1SQV J;  1J1D C;  1ZMB A;  2FKW B;  1KQF B;  4XE5 B;  2LOL A;  2XND H;  3FWL A;  1KTM A;  3HD7 D;  3FGA D;  3GF7 A;  4L75 A;  4PH0 A;  2W83 C;  4H0L B;  2Y9Y A;  4BXL A;  4M0I A;  3U1A A;  2H8P D;  2ZT9 B;  4H0L D;  2PEQ A;  3NTN A;  3S1K A;  1ZRT E;  2I8D A;  3H1J G;  4GOD A;  4WVZ A;  2ZT9 D;  4COP A;  2OYO A;  3AEF C;  4WY4 B;  3TYY A;  4L73 A;  1SQP E;  4I2L C;  4YTP C;  3Q1M A;  5KLV K;  2FXO A;  4LC1 A;  3RL0 g;  3F5H A;  1RF1 A;  1KIL C;  4WY4 D;  3AE4 C;  2GZI A;  3KXD A;  2OYI B;  5KAF H;  1GTW A;  2E5T A;  3H1K J;  2K9Y A;  4C7N B;  1FZE A;  1HTL C;  1HGV A;  5TIS H;  5KLV G;  2GYK A;  2GZF A;  2KOD A;  5F2K A;  1KB9 H;  4I7Z B;  2KSE A;  4HH2 A;  2JU1 A;  2GUS A;  1A8O A;  1S9K E;  1L0L K;  4HB1 A;  2HLO A;  3B8E B;  5AVZ B;  2J58 A;  1TU3 F;  4Y99 C;  1AQ5 A;  1EZV D;  1X9V A;  2D2C B;  3GHG C;  3AE6 C;  3C8V A;  2LTE A;  2E5Y A;  2QE7 H;  1LWU A;  3VYI A;  2JYG A;  3IAO A;  3MGE A;  3SWK A;  3HD7 A;  3CX5 H;  2FYU J;  1L0N D;  2D2C D;  3II6 A;  3TGU G;  1AFO A;  2XT1 A;  4UB8 H;  4NPE A;  1DEE G;  3AED C;  1SQX D;  2M3B A;  1JNM A;  7CEI A;  1MKM A;  4DOJ A;  2XV6 A;  1Q2N A;  1YJW P;  2AVA A;  4IL6 E;  2WSF H;  3U59 A;  1H8A A;  3MIW A;  5AW9 B;  5APY A;  2LXB A;  3L75 E;  1GD2 E;  1JTH B;  2I1K A;  2P1J A;  1EZV I;  5APT A;  1SQQ K;  3SFD C;  2DGY A;  3G0V A;  3MTU E;  3BAS A;  1T2K C;  3NXS A;  5CBN A;  1JY3 N;  1GPJ A;  2QJY C;  1R5S A;  2Q5U A;  1JCC A;  1VL2 A;  4D6T J;  4XRQ A;  5DJU B;  4DJG A;  1JY3 P;  4W80 A;  2OYI A;  4C7N A;  1FAV A;  4IL6 X;  1NU1 K;  1QL2 A;  1RF0 C;  1KFM A;  2FXP A;  2RMZ A;  2K0D X;  3KPE A;  2CNR A;  4OGQ B;  5KP8 B;  1JY3 O;  1NOH A;  3G29 A;  2Z45 A;  5BS1 A;  3V6I A;  1SLQ A;  1MFT A;  1G1J A;  2WSE H;  4OGQ D;  1KN7 A;  3BVH A;  3L37 A;  1OW7 A;  5KJ7 D;  3R2P A;  4H2Y C;  3CWB E;  1PGJ A;  2AFE A;  3RG2 A;  3AE7 C;  3I5C A;  4ZKU A;  5CJ0 A;  3L74 G;  3IFM A;  2XNX A;  4PD4 D;  3S4R A;  3H1I D;  2P9X A;  4XA4 A;  1N7L A;  1OZH A;  1Q82 Q;  3B5N B;  1USE A;  3RK2 B;  1NTM K;  1VPC A;  4H2X C;  1FE6 A;  4U0F A;  3JSV C;  2FFD B;  3AEA C;  2M3E A;  2A06 D;  1NTZ K;  2FVA A;  1ZR2 A;  3LID A;  3B5N D;  5I4T G;  4IL6 H;  1N7S C;  3RK2 D;  1JTH A;  3FX0 A;  3CXC O;  3H0D A;  1EZV E;  1NTM G;  2XV5 A;  4PXH B;  3Q5S A;  1FBM A;  3L73 J;  2KWL A;  2YIU C;  5AVW B;  1NTZ G;  3AE2 C;  4U0C A;  2C0X A;  1VKU A;  3MZW B;  2FVF A;  5KLV J;  1OX3 A;  3OJA B;  3CCJ P;  1L0N E;  4BRY B;  2ZXX A;  1WRG A;  3KDP B;  4PD4 I;  1CI6 B;  1LT9 B;  1SQX E;  2B9B A;  2JJL A;  1JB0 J;  2LKM A;  1HUC A;  3DS4 A;  2QJK C;  2SPZ A;  3Q2Y A;  2K1A A;  2OYH C;  4NPD A;  2L22 A;  1G1I A;  1L0L J;  5AW4 B;  3N4X A;  4RO0 A;  1ZR4 A;  2JO0 A;  5KJ7 A;  1FDM A;  2LKI A;  3HE4 B;  1GW3 A;  5DCK A;  1FZA A;  1OXZ A;  4JYC A;  4AUW A;  1H88 A;  1GU5 A;  3PH0 A;  2L91 A;  1X8Y A;  1W2E A;  2FBW C;  2JP3 A;  1RY3 A;  1ZNV A;  2IBZ G;  1QL1 A;  1YTZ I;  2OTK E;  1ZN5 A;  3EJE A;  4K3A A;  2GZG A;  1K9M Q;  3GG2 A;  1VQ9 P;  1NTK K;  1JY2 O;  3M1M A;  1OFC X;  3B5N A;  1PGP A;  2OTJ P;  4M3L A;  2LIW A;  2MJZ A;  1J1E C;  2MR8 A;  3L36 A;  1AUM A;  1D7M A;  2FFD A;  4ZMD A;  1X79 B;  1FR2 A;  1L4A B;  2K9J B;  2GDX A;  1SQQ J;  4N3Y B;  1FZG A;  1EQ7 A;  2YO3 A;  3L35 A;  3RBZ A;  5KKZ B;  1SQV G;  2LIU A;  3PP5 A;  1M56 D;  4BRY A;  4WBA A;  3M0D C;  3M91 A;  4PD4 E;  1CI6 A;  3H1I E;  1LT9 A;  2GA1 A;  3H1L D;  4QKO A;  3G26 A;  2WPT A;  1E5W A;  3G9R A;  2P7J A;  2YMK A;  3SSU A;  1NU1 J;  1PEM A;  1ZP0 C;  2KUB A;  2A06 E;  3SWF A;  1VQK P;  1RE3 A;  5AVR B;  3CX5 D;  1X3O A;  3G3Z A;  1BGY D;  1VQO P;  1DEB A;  5APW A;  3HE4 A;  2HG5 D;  2GM4 A;  1IK7 A;  4U0D A;  4N78 D;  1KB9 I;  5HGM A;  4HKZ H;  1EXJ A;  2PEN A;  5C39 A;  2JWD A;  3L71 D;  2HOD B;  2PEO A;  3CWB J;  3H1K G;  4R4M A;  5CCG C;  2BUO A;  1RQU A;  2M8N A;  2K0X A;  4XFZ A;  2VRS A;  1VF5 C;  2Z4E A;  3H1J D;  5B5E E;  2ZAE B;  5AVT B;  5AVS B;  3WUU A;  2H7H A;  1LTS C;  1NTM J;  3CX5 I;  1KLP A;  1ACP A;  4C7R A;  4EYY Q;  2W27 A;  4PJ0 E;  2RH0 A;  3RK3 B;  5AW6 B;  1K04 A;  1L4A A;  2K9J A;  1Z6M A;  1SFC B;  2E76 C;  3L70 D;  1U7J A;  3RK3 D;  5EJD A;  3RG6 C;  1Y9B A;  3U1C A;  3JCU H;  3HE5 B;  1SFC D;  4H13 C;  2NRG A;  4Z1M H;  1OWA A;  5KAI H;  1GZL A;  3A0B E;  2JBG A;  4AQR D;  1N8R Q;  4CA3 A;  1MZ8 A;  2FQ2 A;  4XFX A;  2FYN B;  1RF1 C;  2M5R A;  2KZI A;  4GKG A;  3DS1 A;  3D70 A;  1QRJ A;  4PD4 H;  2P67 A;  4L74 A;  2HPC B;  2KLU A;  1RO2 A;  3HTK A;  1IUQ A;  3N7N A;  3M0A A;  1PEQ A;  2FQ0 A;  5HV8 A;  3CCE P;  1XTC C;  2AXT E;  1VQN P;  1GXH A;  2JWA A;  3CLQ A;  4IFF A;  4QNB A;  2V7Q J;  5AVY B;  3WMM 0;  5TIS E;  2ROQ A;  2G3A A;  3TGU D;  4KHX A;  4H2W C;  2KS1 B;  1MFZ A;  2E74 B;  1QVF O;  4PV1 B;  3GZL A;  2WQY C;  4UB6 E;  1JJ2 O;  4U3F J;  1LWU C;  2HOD A;  3LW5 J;  2E74 D;  1PP9 J;  3HD7 C;  2R44 A;  3KHU A;  2P2U A;  2CPB A;  2UWJ E;  1N73 B;  1DH3 A;  3H4E A;  4RKU J;  1NTK J;  1LTJ B;  1A02 J;  1YHQ P;  5B5E H;  1CW5 A;  1IFI A;  3AE1 C;  2FAC A;  1GDT A;  1NJI Q;  4H0L C;  3CX5 E;  3USS A;  5BU8 B;  4BPF A;  3V2R A;  2MVV A;  1BGY E;  1K73 Q;  4PJ0 H;  1T8Z A;  1QVG O;  1A43 A;  2ZT9 C;  4Y28 J;  1SFC A;  1UIX A;  4N78 E;  2PNG A;  1BXI A;  3MP7 B;  2Y0E A;  1NGM B;  1LP1 B;  2K92 A;  1W5C E;  3HE5 A;  5APV A;  2L0Q A;  3L71 E;  1VQ8 P;  3G4S P;  2JAZ A;  4WY4 C;  3W67 A;  1KYO D;  3V4W A;  3V4Q A;  2NO8 A;  3A0B H;  2IZ0 A;  1M8O B;  3H1J E;  1PL5 A;  3VN0 A;  2KGC A;  4K35 A;  1PEO A;  3EWK A;  1BCC E;  4DT0 A;  2HPC A;  2OYI C;  1EXI A;  1LJ2 A;  3KYQ A;  2YKO A;  1HJ0 A;  4MN4 C;  3A0H E;  2IZ1 A;  2IX7 C;  1H89 A;  2P10 A;  3NY7 B;  1SQP K;  3L70 E;  2X2B A;  4I7Z C;  2KOS A;  2CPS A;  3L73 G;  3RK3 E;  3L74 D;  2AXT H;  4ASV A;  2MVU A;  1QEX A;  3HUS B;  2DW3 A;  2KS1 A;  3KZI H;  1KYO I;  2C0W A;  2XDJ A;  2R3S A;  2D2C C;  1HQB A;  3DS5 A;  5AW7 B;  2B87 B;  3K5B A;  4UB6 H;  2Z46 A;  1E6J P;  1FS0 E;  1LTT C;  1SQB J;  4QMA A;  1DX7 A;  1N73 A;  1AF8 A;  1LTJ A;  3B5I A;  4B86 A;  4F37 A;  1L0L G;  2W6J H;  1EIA A;  2L9F A;  1OVV A;  2PFX A;  2K37 A;  1PIX A;  2KG9 A;  2FHS C;  3TGU E;  3OA7 A;  1HJB A;  5AVV B;  1E0H A;  3BCC D;  3PRJ A;  1LP1 A;  5CCH D;  3AE3 C;  2J59 M;  1PEU A;  3TF5 A;  4PWV B;  2ZVO B;  3H25 A;  2W6A A;  3TK1 A;  2YNY A;  2Q6Q A;  3V2N A;  3EQ2 A;  3HZQ A;  2EIA A;  3H1H J;  3L72 D;  2KNC B;  1KQL A;  1KQS O;  3AEC C;  1SQQ G;  3WBH A;  3CCV P;  3OW2 O;  3H47 A;  2CG5 B;  3A0H H;  5APU A;  4OGQ C;  2ITA A;  2PGD A;  4GT1 A;  2FYZ A;  3EJD A;  3RL0 B;  5KJ7 C;  2KG8 A;  2IBZ D;  5F2O A;  3HUS A;  2ERH A;  5B66 E;  1BDC A;  3ABV C;  2NPS B;  2Q7C A;  4IFD K;  1NQ4 A;  1KYO E;  3GW6 A;  2JQ4 A;  3RL0 D;  2B87 A;  2AXC A;  1JOC A;  3Q5R A;  3D6Y A;  2NPS D;  2PY8 A;  1NU1 G;  1J2J B;  2PP6 A;  2BCC D;  3O6Q B;  3AEG C;  2E75 B;  1JMM A;  2WPQ A;  2AEM A;  2GUV A;  1YJN P;  3B5N C;  4BWN A;  2B88 A;  5HGO A;  1BE3 J;  1OMI A;  2E75 D;  3RK2 C;  1SQV D;  3GZM A;  3L74 E;  2FFD C;  1EMV A;  5CCH A;  3M9B A;  1KD1 Q;  2JKV A;  4U7J A;  2WTY A;  3IN6 A;  2WWW A;  3AE8 C;  2LPK A;  2O01 N;  1N86 A;  3G21 A;  3CWB G;  4KT0 J;  2KOR A;  3MUD A;  2PRR A;  1ZXG A;  4IOI H;  1VQ4 P;  1UII A;  5BS2 A;  2K88 A;  2ZVN B;  2KNC A;  2CQ8 A;  2VLP A;  1LT9 C;  4EDF A;  2XZR A;  5APX A;  2L5G B;  1Q81 Q;  1YIT P;  3H6P A;  1BCC J;  5EFW B;  2HR3 A;  2WSC H;  2A45 G;  4JQ0 D;  1SQP J;  2K3R A;  3VRL C;  3PHL A;  1RE3 C;  3H1K D;  2KZJ A;  1EZV G;  1L0N K;  3BCC E;  3F89 A;  3B4Q A;  1Y47 A;  1BSN A;  1OW6 A;  3DTJ A;  2IYO A;  1SQX K;  2L4B A;  2NPS A;  5B66 H;  2LML A;  4O9B A;  1L0N G;  2QJP B;  4OH8 B;  1KYO H;  3ZDM A;  1DD4 A;  2MKV A;  3L72 E;  1JY2 N;  5TJH A;  2WSE J;  1NVO A;  3V5B A;  3O6Q A;  1P84 D;  5M1B A;  2YXQ B;  5L8R J;  4TT3 H;  3EJB A;  1ZW0 A;  1YQ4 C;  1S1C X;  1JY2 P;  2FYU D;  2BAS A;  3EFG A;  2O01 H;  3IF4 A;  1M1K Q;  2IBZ E;  5AVX B;  1W2B O;  1NWQ A;  2MD9 A;  2I1J A;  1JMB A;  1LTG C;  1USD A;  2M5A B;  3CI9 A;  4U3F G;  2KP8 A;  3CME P;  3B71 A;  1PP9 G;  4GR6 A;  5KKZ C;  3CCL P;  3A5T A;  2KG6 A;  1P84 I;  2BCC E;  1NTK G;  4EIJ A;  1IMQ A;  2M8R A;  4HKG A;  2CGQ A;  3L75 J;  3HYB A;  3JCU E;  1L4A D;  1IFJ A;  3MD0 A;  4ZNC A;  5KAI E;  1VQM P;  5AW0 B;  2R3C A;  4D6T D;  4XFY A;  1SQV E;  2L6E A;  2FAE A;  3QWO C;  1DV5 A;  4U0A A;  2LXC B;  1U57 A;  5F2N A;  4LGD E;  3NMD A;  1M90 Q;  2KGD A;  1MUU A;  4DG9 A;  3HTK B;  4XRO A;  1EC5 A;  2RN0 A;  2YMY A;  3CC7 P;  3AEE C;  2WPV B;  1DD3 A;  3E2D A;  2PAJ A;  4OWF A;  4JPZ B;  1M1J B;  3B4S A;  3H1I G;  4GR2 A;  4U0E A;  3G6E P;  1M74 A;  1IMP A;  5E79 E;  2KOP A;  1PPJ G;  1KFN A;  3I55 P;  3P32 A;  3H1K E;  4JF7 A;  3RK3 C;  5CMZ A;  1YQ3 C;  1VDF A;  2ZYA A;  1SFC C;  2LF4 A;  1IFM A;  1SQB K;  2M5A A;  3S9O A;  2JDI H;  1L2P A;  1AV1 A;  1EOQ A;  1LNQ A;  2EHT A;  1SQB G;  4GIF A;  2OGU A;  3P8C D;  1P84 E; 
#chains in the Genus database with same CATH homology
 3DS1 A;  1PEO A;  1QRJ A;  3DS2 A;  3HYB A;  1BAJ A;  4PH1 A;  2EG5 A;  1RO2 A;  1PEM A;  1IUQ A;  3DS4 A;  1Q81 Q;  1D1D A;  1M6E X;  2KOD A;  2M8L A;  5F2K A;  1YIT P;  1VQM P;  3CCM P;  1PEQ A;  4IPY A;  3CMA P;  4U0B A;  1VQ5 P;  2PEI A;  3CCE P;  1VQK P;  4XFY A;  2JYL A;  1YJ9 P;  1KQS O;  2L6E A;  3G1I A;  3WBH A;  3CCV P;  3G29 A;  3OW2 O;  1Q7Y Q;  1A8O A;  2ONT A;  3H47 A;  4U0A A;  3VRL C;  3P05 A;  1VQN P;  2EFJ A;  5F2N A;  2JO0 A;  2XXM A;  3CC4 P;  2Z45 A;  2Z44 A;  4QNB A;  5BS1 A;  5HGN A;  1VQO P;  1M90 Q;  2QEX P;  2M8P A;  2PEK A;  5DCK A;  1RO0 A;  3DTJ A;  5F2O A;  2PEJ A;  1VQ7 P;  1K8A Q;  4U0D A;  3G28 A;  5JPA A;  1QVF O;  4XRO A;  5HGM A;  3NTE A;  3CC7 P;  2PEN A;  2JYG A;  2PEM A;  3CPW O;  3MGE A;  1VQ6 P;  3LRY A;  3CC2 P;  3E2D A;  3DS5 A;  1JJ2 O;  2PEO A;  3CD6 P;  2BUO A;  1S72 P;  1ZMB A;  2M8N A;  2PY8 A;  2Z46 A;  1K30 A;  2XT1 A;  1E6J P;  4XFZ A;  5HGL A;  4GR2 A;  2P9X A;  4U0E A;  4PH0 A;  3H4E A;  3G6E P;  1M74 A;  1K9M Q;  2E1M A;  2OTL P;  1VQ9 P;  1Q82 Q;  4M0I A;  1YHQ P;  3M1M A;  3G1G A;  3B5I A;  2OTJ P;  3CCS P;  1YI2 P;  1NJI Q;  3CCR P;  2XV6 A;  1YIJ P;  1EIA A;  3CCU P;  3I55 P;  4U0F A;  3DS0 A;  1AUM A;  1YJN P;  1YJW P;  5HGO A;  2PEQ A;  1RNI A;  1K73 Q;  1QVG O;  1M1K Q;  1A43 A;  5I4T G;  2BHV A;  1Q86 Q;  3Q20 A;  3CXC O;  2BQ1 E;  3H0D A;  1W2B O;  1KD1 Q;  2DGY A;  3DS3 A;  3CCQ P;  3G0V A;  3RG6 C;  4COP A;  2LF4 A;  3DPH A;  4U0C A;  3I56 P;  4WYM A;  2EIA A;  3G21 A;  3CME P;  1VQ8 P;  1VQP P;  1PEU A;  3G4S P;  3G71 P;  1EOQ A;  3CCJ P;  4XRQ A;  1N8R Q;  1VQL P;  4GR6 A;  4COC A;  3CCL P;  1M6N A;  1VQ4 P;  2CWO A;  4XFX A;  2QA4 P;  3HZQ A;  2OAR A;  3G26 A;  5BS2 A;  1KC8 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...