3OW2O

Crystal structure of enhanced macrolide bound to 50s ribosomal subunit
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAKGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RIBOSOMAL RNA
molecule tags Ribosome
total genus 47
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2010-09-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3ow2O03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 3ow2O01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 3ow2O02
3CMAP 3CPWO 1VQ5P 3CCUP 1K73Q 1YIJP 3CCQP 3CCMP 1YJWP 1VQPP 1VQ4P 3CC2P 1M1KQ 3I55P 3CCEP 1Q86Q 1W2BO 1K9MQ 1VQOP 1VQMP 3CCRP 1QVFO 3CCVP 1S72P 1M90Q 3CCSP 3CC4P 1KQSO 3CD6P 3CC7P 1JJ2O 1VQ6P 2OTLP 1NJIQ 1YJNP 2QA4P 3CCLP 1VQ9P 1VQKP 1VQ7P 1KD1Q 1N8RQ 3G6EP 3CCJP 3G4SP 1KC8Q 1QVGO 3CXCO 1YITP 3CMEP 3I56P 2OTJP 3OW2O 1YJ9P 1Q7YQ 1VQLP 1VQ8P 2QEXP 1Q82Q 1YHQP 1Q81Q 1K8AQ 1VQNP 3G71P 1YI2P
chains in the Genus database with same CATH superfamily
2FFDB 2X2BA 2LOLA 3CX5H 4XFJA 3CCQP 1KN7A 5GTIE 5KP8B 1NU1J 2XZRA 3TNUA 4H2YC 1IMPA 5KAFE 2AXCA 2JDIH 5CCHA 1R5SA 3KHUA 3NY7B 3F5HA 2E42A 4OVNF 1K04A 1OW7A 1PGJA 1VQ8P 2E1MA 3GF7A 1FU1A 3H6PA 3VMXA 2KB7P 3HUSA 3VP8A 2E75B 2K9JB 2XKMA 4N78D 3L70G 1M8OB 3CWBJ 1TU3F 3TGUG 2BCCE 2QJPC 3U1CA 3JCUH 4UB8E 2QRXA 2OYIC 2K0YA 2KGEA 4MRTC 1GU5A 2W83C 1KFNA 2FYUE 3WUUA 2WSFH 1NVOA 2OARA 1SP4A 1K05A 1Q7YQ 4KT0J 1N7LA 4B86A 4D6TG 2UWJE 2ZXXA 4F37A 4R4MA 2YKQA 3CXHE 1M74A 2KLUA 2M8RA 1L0LJ 1X3OA 3LW5H 1DX7A 2BUOA 2YKPA 5CCGA 1GK4A 1SQXD 3V2RA 1S3JA 1VQLP 1NTKK 1VQ5P 2MVUA 1GPJA 2ZYDA 3IR9A 5KLIB 2R5DA 5F2KA 5APXA 1Q2NA 1MV8A 4LC1A 3R2PA 1USEA 4U0AA 3PP5A 1NHLA 4WY4A 2GA1A 2SPZA 4U0BA 2A45G 3KYQA 2B89A 1KILB 2KR5A 1W2EA 3AE9C 1J1EB 2OTKE 2YO2A 1FE6A 1VQKP 4EYYQ 2FFDA 5KJ7D 1FZCB 3D70A 2C0XA 1L0NK 1MKMA 2JGPA 2KZJA 4PV1B 1CI6A 5BU5A 3LRYA 4U3FG 5AW8B 2K0XA 5KLVG 3CWBE 2KG8A 1R8EA 2YO3A 3RL0D 5EJDA 2WPTA 3N7NA 3DS2A 4I1LA 3H1HJ 3M9QA 5H2FE 2R3CA 2KW2A 3PRJA 1SQPD 1U7JA 2K9JA 1GZLA 5JPAA 4YPCA 2CWOA 4RJTA 2H88C 2KK7A 1UNKA 3AEDC 2FYNB 1LGHB 1KQLA 1YJNP 2Q7CA 2VSQA 1ZOYC 2KOPA 3KXDA 2K92A 1RQVA 2H89C 1L0LE 2CG5B 3PJSK 3B71A 3H1LG 4N78E 2IZ1A 3HD7B 2Z4EA 2M3EA 3TSIA 3GG2A 5HV8A 2WVRA 2E76D 2RKLA 2ZT9B 1PIXA 5AW9B 3P8MC 3ZDMA 3USSA 3L73D 5AW0B 2MR7A 1GD2E 2WQYC 1DEBA 3A0HE 2CNRA 3B5NB 2LKMA 4BRYB 3WU2H 2EFJA 3AECC 1PEMA 1LTSC 1H88A 3L37A 1YITP 4PH1A 2ZYAA 3OA7A 4Y99C 3KPEA 1OW8A 1K8AQ 2XNXA 1LWUC 4NPFX 2FVAA 2E76B 3P8CE 1JY2O 1FR2A 2MJZA 3CD6P 3TF5A 1D1DA 3MHVA 2AF8A 1SQXE 4PD4H 1PP9D 3G4SP 1QL2A 2P58A 3L73J 1NKNA 3L75D 1K30A 1QGKB 4PXHB 2QM7A 1T6AA 1QVFO 1JMMA 3HE4B 3EFFK 1J2JB 1QEXA 1FZCA 4NPDA 2ZYGA 1OVRA 3G29A 4BPGA 1FZAA 2CPSA 2Y9YA 3HTKB 1CSBA 1LTAC 1Q90D 4RO0A 1M1JC 1RO0A 3L71D 3L70J 2NPSB 3II6A 3L74D 5KLVK 1FOSE 3TGUJ 3HYBA 2C9LY 3AEGC 2FYZA 1KV4A 2AVAA 1EQ7A 2JO1A 1JY3P 3NTNA 5AW2B 1A43A 1FS0E 4XFYA 1SQBG 3GHGB 2Q9IA 1JTHA 1P84D 2I1KA 5KJ7A 2XXMA 5DCKA 1BCCG 2Q5UA 3PTZA 3Q5PA 1U7MA 3KDPB 1LTJC 1KB9H 3LIDA 2M8LA 1P84I 3A5TA 4ASVA 3L4FA 1IFIA 4C7NA 1BE3D 4D6TJ 3HD7A 1ACPA 2OYOA 5KAIE 5TISH 3QH9A 1S2EA 5I4TG 2JB0A 2PEKA 1J1DC 1N7SD 1AJYA 2WWWA 4EI2A 3IF4A 3BASA 4JPZB 4R4LA 3S1KA 1X22A 1Z56A 2JKVA 3TNUB 1JY3O 5B5EE 1VF5D 4ASWA 4UB6E 1VQ7P 3U1AA 3L73E 2BCCD 2CK3H 1JCCA 2VRSA 2MF4A 2ZJSE 2N9YB 5F2NA 1VF5C 2GYKA 2Y0DA 4H13D 3OAKA 1N7SB 1URQC 1HJ0A 2WSEJ 1Z6MA 1BGYD 2KOSA 1EC5A 3F89A 3Q5SA 1RH5B 4IZ6A 3GMAA 1ZV8A 1SFCC 1GU4A 3E2DA 3DS4A 3A0BE 1SQVK 5AW6B 5M1BA 1H0TA 1LWUA 3MP7B 3BVHA 3WUTA 4XFZA 2KOOA 2Q3EA 5CMZA 3L70E 3H1ID 3TGUE 3AE8C 1F80D 4HH2A 1RE3C 2EIAA 1Y9BA 5GTIH 4BPHA 4H13B 3AE4C 2KIKA 5AW5B 5KAFH 3PH0A 1S1CX 1YHQP 1G1IA 2GDXA 3N4XA 1SQQD 1M6EX 2NPSA 1JMBA 1PGQA 2PEQA 3LIEA 1ZLLA 1EIAA 1NTKG 5KKZB 1JOCA 2XT1A 2KSJA 4UB8H 1NO4A 2IBZG 1NU1D 5CZDB 2JO0A 2Z5HA 4H2WC 1MUUA 3L72G 1T8KA 1YQ4C 1M1JA 3EJDA 3L74E 3E7KA 3KZIH 2R32A 3M1MA 5APVA 1FBMA 1S5LE 1NTMK 3SWFA 2KSEA 3RK2C 1N73B 4WB4A 4GT1A 2FXOA 2LKIA 1EZVD 1P84E 3NTEA 4WBAA 2Z45A 1XTGB 2FACA 2JU2A 2CQ8A 1RF1C 4XA4A 2OYHA 4M3LA 2AEJA 1EZVI 1L4AC 3CXHH 1L2PA 5BS2A 2LMLA 1K73Q 2CPBA 2DGYA 1ZR2A 2RH0A 1CI6B 4QMAA 1HY8A 1LT9B 1FAVA 1KLPA 1T3JA 1CEIA 1QRJA 2KXPB 1SQBD 3C1LA 2GDWA 1N7SA 1IO4A 3RG6C 1DIPA 3VOPA 1L0LD 2Q3IA 5APWA 1LTIC 2W8ZA 2WSCJ 2ERHA 4H44D 2JR8A 2YMYA 3CCJP 2KS1A 1AYIA 2GZFA 4H44C 2LF4A 1H89A 1JUNA 1BSNA 1YIJP 2WSFJ 1GXHA 1HJBA 1AVYA 2AXTE 1BGYE 2EHSA 1SLQA 3AE6C 1VPCA 1BXIA 2QJPB 2D2CD 3PLNA 4C46A 2E5YA 2B9BA 2V4HA 2LR2A 2OYIB 1SQBJ 5H2FH 3V2PA 2WT7A 2N50A 2E74C 3H1IE 3MZWB 1E5WA 2D2CC 2QJKC 2QG4A 2ZVNB 1M57D 1NTZG 3P8CD 3H1KG 4WYMA 3Q2YA 2KGDA 2WSSH 1FDMA 1YJ9P 5CHXA 5APSA 1SQQE 2HLOA 5B66E 1W2BO 1AV1A 4XE5B 1NYHA 1N73A 3H1HD 4IFFA 3OW2O 4I7ZC 3Q1MA 1KILC 1EOQA 4BPFA 1NU1E 2CGQA 1SQPK 1L0HA 3BRTB 1DD3A 4HYTB 1T3UA 3W68A 2LL8A 1VDFA 2GUSA 3A0HH 3SFEC 4IPYA 3G6EP 2R3SA 1IK7A 2YMKA 4U0EA 1EZVE 4PJ0E 3EFGA 1IMQA 5KTBA 3CCMP 1YJWP 1NH4A 2L5GB 1IJDB 4GR6A 1LT9A 3IN6A 5AVTB 3H25A 4U0DA 1IZNB 4R0MA 5AW3B 2LPKA 1NTKD 3DS0A 2ZVOB 1KZUB 1FJKA 4C7RA 3JC22 4Y28J 2L0QA 2KGAA 2K2QA 2KGCA 3AEBC 4K35A 4W7YA 5AVQB 1JTHB 3BCCG 1EDJA 2YIUC 1PL5A 2K93A 3SFDC 2WZ7A 3GKLC 2MR8A 1SQBE 1QL1A 5HGNA 2JYLA 3RL0B 3DTJA 4JBZA 1E79H 3T97A 5AVRB 1FZGA 4AYCA 1MFZA 1KYOH 2ZT9C 4C7NB 2FYUG 1RE4C 3Q3DA 1MZ9A 1ZMEC 2GZIA 1KD1Q 1L0ND 3C8VA 1NTKJ 1RF0C 2OYIA 1Q81Q 3B5NC 1MFTA 2K0DX 5AVXB 2VLOA 2H7HA 4LLHA 2Y0CA 4U0CA 1FC2C 5HGLA 2LXCB 2WPVB 3M0AA 2QM8A 1HF9A 4L73A 1N8RQ 1NTZK 2FHSC 2PENA 1PFIA 4XFXA 2A06G 1GW4A 2ITAA 1EDIA 5APTA 3L70D 3VMZA 1NJIQ 2MD9A 3TGUD 3FX0A 3H1JG 5KAIH 1VQ9P 2JP3A 3H47A 1SQVG 2H43A 3NXSA 1L0NJ 2M0BA 3D6YA 1HGVA 1IK9A 3NFQA 3MGEA 2KOGA 4COCA 1BAJA 2XU6A 2NZ2A 2R44A 2M5RA 1PPJG 1Q86Q 1H0TB 1LWUB 3TK1A 1HVVA 1KQSO 3H1HE 3M0DC 1YTZI 1RO2A 3VMYA 2KNCA 5B5EH 4UB6H 5CBOA 2J59M 4D6TD 4XROA 3L36A 2B88A 1AA0A 1YYCA 1M6NA 3RL0g 2PEMA 2YXRB 2VLNA 2YNYA 3H1KD 1S9KD 1GL2D 1PV3A 1FZBA 4U7JA 2GZGA 1SS1A 1JM0A 1CZQA 2K1AA 1GL2C 1VQ4P 4GOEA 3A0BH 3V2NA 4CA3A 2PP6A 1NTMG 5AVUB 2Y0EA 2N6ZA 1NTKE 2BHVA 2VLQA 1M1JB 1S5LX 1HTLC 1FDIA 4CPGA 3M9HA 3B5IA 1D7MA 1WRGA 2DW3A 1KTMA 1Y47A 5AVZB 2B87A 1X8YA 1AVOA 5KP6B 2N5IA 1GTWA 2WPQA 3WMM0 5HVCA 4H2XC 1NTZJ 3AE7C 3G0VA 4EDFA 2OYHB 3H1KJ 2A45I 2FYUK 4OGQD 1E0HA 2MY5A 3Q5RA 3O6QA 5BU8B 1E6JP 4OGQC 2N9BA 4N3YB 4U3FD 2Q6QA 2JWDA 5KLVD 2QJYC 4KJMA 2XV6A 5HGMA 2OGUA 2OTLP 1L0NE 2YKOA 2K37A 2C9NY 1FDOA 2KUBA 2O01H 3V6IA 2JYGA 2JQ4A 1RQUA 4COPA 2OQQA 1S5LH 1URQD 3UIAA 2ZXEB 2JU1A 3HUSC 2W90A 1P84H 3BCCD 2PNGA 1SFCD 2DNWA 3VMAA 1SQXG 2N1TD 2KOQA 2FBWC 2QEXP 4U0FA 3JSVC 1GDTA 2KS1B 4GDOA 4QKOA 2N1TC 1VF5B 4U3FJ 2L4BA 3H1LD 3CCVP 1GXGA 5E79E 5KLVJ 2GZEA 1R5LA 2Z5IA 4I2LC 2V7QJ 1NGMB 2WSEH 1SVFA 4PWVB 2M8PA 1Y8AA 4GODA 3Q20A 3RK3D 2KYVA 2NRGA 3GLMA 3O8ZA 2WMMA 1UIXA 2R5BA 1SFCB 1M1KQ 4GIFA 5CCGD 4EOTA 3RK3C 2O1KA 3CCSP 2WT7B 3V4QA 1IFMA 2P2UA 3BCCJ 3M0DA 5CCGC 2P67A 2PRRA 4IL6E 4H0LC 2MVVA 3I56P 3CX5D 4D6TE 1OXZA 1N2DC 3EQ2A 3V5BA 2A06D 4W7ZA 4DJGA 1IFDA 1KFMA 3H1LJ 3RK2D 3GW6A 3V4WA 2W6JH 3CX5I 2FYUJ 3H1KE 1HGZA 4WY4D 2HPCB 2IZ0A 1S9KE 2BQ1E 3H1JD 3H0DA 3CCLP 1X0TA 5CBNA 1PEOA 2AXTH 4LGDE 4WY4C 4DCKA 3AE1C 1SQPG 1ZN5A 1GL2A 2FKWB 2KP8A 3ITKA 4ZKPA 2PAJA 2NO8A 2GUVA 3D71A 1L4AD 2QVAA 5AW1B 2MKVA 3DPHA 1L0LK 3BRVB 3B4SA 2QA4P 1FZEA 1LTJA 2I1JA 4JYCA 1U57A 1KC8Q 3TYYA 3VP9A 2FFDC 3M06A 3B4QA 3RK2B 5F2OA 1NKZB 1YTZT 1EXIA 2FAEA 4Z1MH 4WVZA 2GDYA 2LXBA 2IYOA 3M91A 5C39A 2POHA 3GZMA 2KG9A 1KQGB 5B66H 2M5AA 2E75D 4TLFA 3H1JJ 3L73G 1SQVJ 1GW3A 1L4AB 2P7JA 2BEQD 3E1RA 1EDLA 2E75C 2XZ0D 4U3FE 5APUA 4ZNCA 5KLVE 1OW6A 3V2QA 3QWOC 1VQMP 2LIUA 3OJAB 1LP1B 1NTMD 1LTBC 1BCCD 5BS1A 2HODB 1NQ4A 4I6MC 1HQBA 1OVUA 1G1JA 2XNDH 3G1IA 1SQXK 2O3JA 4EIJA 2P9XA 3A3YB 2H8PD 1OZHA 4O9BA 1AFOA 2FQ0A 3BCCE 4PJ0H 1URQA 3T97B 3S9OA 2GZJA 3P05A 2M3BA 1PGPA 1PP9G 2WSCH 4DZOA 4BWNA 1H8AA 2E74D 3L75G 1SFCA 1YI2P 3KZIE 2K94A 5AVSB 1G2CA 2FY8A 2N1TA 3H1LE 5CJ4A 3VYIA 1IFNA 4H44B 3LW5J 1RE3A 1NTMJ 4AQRD 2L9FA 1BCCJ 1NOHA 1WT6A 1HUCA 3RK3E 3SWYA 3HZQA 4DG9A 3PHLA 1X9VA 1S4XA 5AVYB 5KLIC 4OWFA 3AE2C 2HPCA 3WUVA 5GTHE 1A02J 4GOFA 1AUMA 3L71G 2E74B 1JJ2O 2D2CB 2W27A 2QJKB 3L74G 3MGNA 1PZQA 2N6YA 1KILD 2K3RA 4KHXA 3CX5E 2FXPA 2A06E 5K5GB 4RESB 3AEEC 1LJ2A 1IFPA 3A7OA 1J1EC 1DEEG 1YBKA 4W80A 1PEQA 2QSIA 1VL2A 4PV1D 1OVVA 3H1JE 2P1JA 1SQVE 1FZCC 3CL3D 4ZMDA 4HKGA 4L75A 4PV1C 4PH0A 4NEOA 2AEMA 1KYOD 1BE3G 2KLVA 4UHPB 1PPJE 2KNCB 4I7ZB 1JNMA 1HWTC 3JCUE 3E1IA 1RF1A 1LT1A 4N6JA 1ZNVA 1RNIA 1KYOI 1ZW0A 1L4AA 2IX7C 3MUDC 1SQXJ 2HG5D 3ABVC 2HR3A 5HGOA 2OTJP 1AQ5A 2K88A 1Q82Q 3D6ZA 4GKGA 1LP1A 2IBZD 1OX3A 4GR2A 1W5CE 5DJUB 5KJ7C 4HJGH 2JAZA 2HODA 3L72D 1T8ZA 2FYNC 2M8NA 3AEAC 3CC7P 1M56D 4BXLA 2BCCG 2IBZI 3HD7D 3RL0C 1ZR4A 3CMEP 3FWLA 3FXEA 2ZT9D 3CI9A 4YXWH 3HD7C 3TDKA 2IFMA 3CC2P 1NTME 3B8EB 1BCCE 1M90Q 2B87B 4PD4D 1JO5A 1BGYG 2E5TA 3G28A 3U59A 1JY2P 3B5ND 1KMIZ 3FXDA 4PD4I 2YIUB 2XZ1C 2RN0A 2Y9ZA 4L76A 3H32B 2Z44A 1K9MQ 2XV5A 3O6QB 1USDA 3AEFC 3H1IG 3L72J 2IYPA 4IOIH 3VTPC 2QE7H 2ONTA 3G21A 1VKUA 1QVGO 2W6BA 4IFMA 2C0WA 2E76C 1SQPJ 1EMVA 3G71P 4MN4C 5BVZA 1IFJA 2XDJA 3RGUA 5AW4B 1JCDA 1SQQG 2JWAA 3EJBA 1MZ8A 3HRNA 3CC4P 3P7KA 2IDBA 2K5XA 4JQ0D 1IUQA 3AE3C 1OWAA 2IFNA 2J58A 1FJPA 4K3AA 3CMAP 1N86A 4Y99B 3CCUP 2PEJA 1A02F 1NU1G 1X79B 4RKUJ 2Z46A 4HB1A 1ZRTD 1KB9D 1KILE 2WTYA 3MIWA 1UJZA 3RBXA 4AUWA 1RY3A 2PEIA 2NPSD 3MTUE 4IFDK 2GM4A 1KILA 1VQNP 3LMOA 5KP7B 1EZVG 1KB9I 1NAYA 1ZMBA 2FVEA 4NPEA 2FADA 4L74A 2NPSC 1BDDA 3CWBG 3RBZA 3K5BA 2KORA 1ZXGA 1NTZD 1JY2N 5DJTB 1YQ3C 3G9RA 2WPRA 4JF7A 4IL6X 1AF8A 2FVFA 1KYOE 3GHGC 2QNWA 1T2KD 4QNBA 4JYBA 3W67A 1KQFB 2EG5A 3GZLA 3FGAD 3BATA 1XTCC 1T2KC 2O01N 5APQA 5AVWB 1IC2A 3VN0A 1OR5A 3MUDA 2RMZA 5E79H 1DV5A 1PP9J 3C9IA 1UIIA 3G3ZA 4YXDC 3L75J 2IBZE 3WU2E 3L72E 2G3AA 1L0LG 2EHTA 2OYHC 5TJHA 2I8DA 1GL2B 3H4EA 4TT3H 2Q1KA 1L0IA 1JEKA 3HE5B 1SQPE 2AEFA 3M9BA 2ZAEB 1BSHA 3H32A 2FQ2A 1LTJB 3FWNA 4IL6H 2FQ1A 7CEIA 5CCHD 2K9YA 5EFWB 3MD0A 4PD4E 2YXQB 1S72P 1QLED 3EJEA 3R4YA 2KODA 1VQ6P 3L71J 2BEZF 5CCHC 2O01J 3L35A 1RE4A 3L74J 2P10A 1FOSF 2VLPA 3S4RA 3CXCO 2M5AB 1LTGC 1OFCX 1RF0A 3EWKA 3B5NA 1J1DB 2BASA 1N7SC 4BRYA 3A2AA 3CCRP 3DS3A 4OGQB 2PFXA 1A8OA 3DS5A 1ZP0C 4WWIA 2J5UA 1OMIA 2IPPA 2QJYB 3SSUA 3G26A 1EDKA 1PGOA 1SQQK 1M7LA 3SWKA 2W6AA 4HKZH 2ROQA 1LNQA 1EXJA 2PGDA 1BE3J 1GMJA 1KORA 1RHZB 1VQPP 3CCEP 1NAFA 4H13C 2A45H 2FYUD 4OH8B 1NU1K 4DT0A 3HUSB 2HYNA 3AE5C 2G8YA 3H1HG 1JY3N 1URQB 3KQGA 2E43A 1HBWA 2JEEA 2ZFCA 4ZKUA 2FXMA 3GF3A 4XRQA 3HE4A 2L91A 2KWLA 1ZRTE 1GK6A 1WMKA 2PEOA 1KB9E 4M0IA 3CXHD 1G2CB 4H0LD 2N1TB 5KKZC 1PP9E 1HH0A 2V7QH 1VHNA 1AQTA 2WPSA 2HFED 2BCCJ 1OIPA 3L75E 1JB0J 3CE7A 2L22A 2LIWA 4A7PA 3CXHI 3P32A 4YTPC 3HTKA 5TISE 3CPWO 5CJ0A 3I55P 1NTZE 2QIWA 1N73C 1PEUA 3RK3B 2AFEA 1BGYJ 1QX8A 1SQVD 1BDCA 3GHGA 2PY8A 3RG2A 1FZFA 3DS1A 4H0LB 2WITA 3NMDA 4DOJA 1PPJD 3L71E 1SQBK 2O1JA 3H1IJ 5AVVB 3HE5A 1NWQA 3I5CA 2KG6A 3WBHA 5EW5E 1CW5A 5APYA 1DD4A 3GJNA 4WY4B 2JJLA 2JBGA 1VQOP 2N98A 1LT9C 1SQQJ 5AW7B 3CWBD 2L6EA 2KI7B 1DH3A 2LTEA 2KZIA 3IAOA 1DNYA 2AFDA 1RF1B 3U43A 5GTHH 1L0NG 3IFMA 1LTTC 5L8RJ 1BE3E 3G1GA 3CLQA 3VRLC 2N5HA
chains in the Genus database with same CATH topology
1VQ5P 1BAJA 3NTEA 1E6JP 2P9XA 2Z45A 4XRQA 3CCQP 1Q86Q 2PEOA 2XV6A 4M0IA 5F2KA 3CC4P 1KQSO 1RO0A 3H4EA 5HGMA 2OTLP 3P05A 1RNIA 2BQ1E 3HYBA 3H0DA 4WYMA 3CCLP 1IUQA 1PEOA 4U0AA 1RO2A 5HGOA 5BS2A 2JYGA 2OTJP 1YJ9P 4COPA 3E2DA 1VQ8P 3DS4A 1Q82Q 2E1MA 4U0BA 5HGNA 2JYLA 1A43A 1YI2P 3CMAP 4XFYA 3CPWO 4XROA 3CCUP 2PEJA 3DTJA 1K73Q 4GR2A 2DGYA 4XFZA 3I55P 1W2BO 2Z46A 1M6NA 2M8NA 1S72P 2PEMA 2XXMA 5DCKA 2EIAA 3DPHA 3CC7P 2KODA 2EFJA 1VQ6P 1PEUA 1PEMA 2QA4P 1VQKP 1KD1Q 2M8LA 1KC8Q 3CXCO 4PH1A 1YITP 3CMEP 1QRJA 2PEIA 3OW2O 2PY8A 2QEXP 3HZQA 4U0FA 1EOQA 1YHQP 1Q81Q 1K8AQ 1VQNP 3DS1A 5F2OA 1ZMBA 3LRYA 4U0CA 1VQ4P 5HGLA 3CC2P 3RG6C 3CCRP 1M6EX 3CCVP 3DS3A 1M90Q 1AUMA 3CD6P 1A8OA 3DS5A 2PEQA 1JJ2O 1D1DA 3G26A 3G28A 2M8PA 2BHVA 3DS2A 5I4TG 1EIAA 2OARA 2PEKA 4IPYA 4COCA 1N8RQ 3G6EP 3CCJP 3G4SP 3Q20A 3WBHA 1Q7YQ 2XT1A 4U0EA 3B5IA 1K30A 2PENA 2LF4A 4QNBA 4XFXA 1YIJP 2Z44A 3CCMP 1YJWP 1VQPP 5JPAA 2EG5A 2JO0A 1M1KQ 3CCEP 1K9MQ 4GR6A 1VQOP 1M74A 1VQMP 1QVFO 1PEQA 2CWOA 3CCSP 2L6EA 5BS1A 3M1MA 4U0DA 1NJIQ 2BUOA 2ONTA 3G0VA 1YJNP 3G21A 1VQ9P 1VQ7P 3H47A 1QVGO 4PH0A 3DS0A 3I56P 3G29A 3G1GA 1VQLP 3MGEA 5F2NA 3G1IA 3G71P 3VRLC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CMA P;  3CPW O;  1VQ5 P;  3CCU P;  1K73 Q;  1YIJ P;  3CCQ P;  3CCM P;  1YJW P;  1VQP P;  1VQ4 P;  3CC2 P;  1M1K Q;  3I55 P;  3CCE P;  1Q86 Q;  1W2B O;  1K9M Q;  1VQO P;  1VQM P;  3CCR P;  1QVF O;  3CCV P;  1S72 P;  1M90 Q;  3CCS P;  3CC4 P;  1KQS O;  3CD6 P;  3CC7 P;  1JJ2 O;  1VQ6 P;  2OTL P;  1NJI Q;  1YJN P;  2QA4 P;  3CCL P;  1VQ9 P;  1VQK P;  1VQ7 P;  1KD1 Q;  1N8R Q;  3G6E P;  3CCJ P;  3G4S P;  1KC8 Q;  1QVG O;  3CXC O;  1YIT P;  3CME P;  3I56 P;  2OTJ P;  3OW2 O;  1YJ9 P;  1Q7Y Q;  1VQL P;  1VQ8 P;  2QEX P;  1Q82 Q;  1YHQ P;  1Q81 Q;  1K8A Q;  1VQN P;  3G71 P;  1YI2 P; 
#chains in the Genus database with same CATH topology
 2FFD B;  2X2B A;  2LOL A;  3CX5 H;  4XFJ A;  3CCQ P;  1KN7 A;  5GTI E;  5KP8 B;  1NU1 J;  2XZR A;  3TNU A;  4H2Y C;  1IMP A;  5KAF E;  2AXC A;  2JDI H;  5CCH A;  1R5S A;  3KHU A;  3NY7 B;  3F5H A;  2E42 A;  4OVN F;  1K04 A;  1OW7 A;  1PGJ A;  1VQ8 P;  2E1M A;  3GF7 A;  1FU1 A;  3H6P A;  3VMX A;  2KB7 P;  3HUS A;  3VP8 A;  2E75 B;  2K9J B;  2XKM A;  4N78 D;  3L70 G;  1M8O B;  3CWB J;  1TU3 F;  3TGU G;  2BCC E;  2QJP C;  3U1C A;  3JCU H;  4UB8 E;  2QRX A;  2OYI C;  2K0Y A;  2KGE A;  4MRT C;  1GU5 A;  2W83 C;  1KFN A;  2FYU E;  3WUU A;  2WSF H;  1NVO A;  2OAR A;  1SP4 A;  1K05 A;  1Q7Y Q;  4KT0 J;  1N7L A;  4B86 A;  4D6T G;  2UWJ E;  2ZXX A;  4F37 A;  4R4M A;  2YKQ A;  3CXH E;  1M74 A;  2KLU A;  2M8R A;  1L0L J;  1X3O A;  3LW5 H;  1DX7 A;  2BUO A;  2YKP A;  5CCG A;  1GK4 A;  1SQX D;  3V2R A;  1S3J A;  1VQL P;  1NTK K;  1VQ5 P;  2MVU A;  1GPJ A;  2ZYD A;  3IR9 A;  5KLI B;  2R5D A;  5F2K A;  5APX A;  1Q2N A;  1MV8 A;  4LC1 A;  3R2P A;  1USE A;  4U0A A;  3PP5 A;  1NHL A;  4WY4 A;  2GA1 A;  2SPZ A;  4U0B A;  2A45 G;  3KYQ A;  2B89 A;  1KIL B;  2KR5 A;  1W2E A;  3AE9 C;  1J1E B;  2OTK E;  2YO2 A;  1FE6 A;  1VQK P;  4EYY Q;  2FFD A;  5KJ7 D;  1FZC B;  3D70 A;  2C0X A;  1L0N K;  1MKM A;  2JGP A;  2KZJ A;  4PV1 B;  1CI6 A;  5BU5 A;  3LRY A;  4U3F G;  5AW8 B;  2K0X A;  5KLV G;  3CWB E;  2KG8 A;  1R8E A;  2YO3 A;  3RL0 D;  5EJD A;  2WPT A;  3N7N A;  3DS2 A;  4I1L A;  3H1H J;  3M9Q A;  5H2F E;  2R3C A;  2KW2 A;  3PRJ A;  1SQP D;  1U7J A;  2K9J A;  1GZL A;  5JPA A;  4YPC A;  2CWO A;  4RJT A;  2H88 C;  2KK7 A;  1UNK A;  3AED C;  2FYN B;  1LGH B;  1KQL A;  1YJN P;  2Q7C A;  2VSQ A;  1ZOY C;  2KOP A;  3KXD A;  2K92 A;  1RQV A;  2H89 C;  1L0L E;  2CG5 B;  3PJS K;  3B71 A;  3H1L G;  4N78 E;  2IZ1 A;  3HD7 B;  2Z4E A;  2M3E A;  3TSI A;  3GG2 A;  5HV8 A;  2WVR A;  2E76 D;  2RKL A;  2ZT9 B;  1PIX A;  5AW9 B;  3P8M C;  3ZDM A;  3USS A;  3L73 D;  5AW0 B;  2MR7 A;  1GD2 E;  2WQY C;  1DEB A;  3A0H E;  2CNR A;  3B5N B;  2LKM A;  4BRY B;  3WU2 H;  2EFJ A;  3AEC C;  1PEM A;  1LTS C;  1H88 A;  3L37 A;  1YIT P;  4PH1 A;  2ZYA A;  3OA7 A;  4Y99 C;  3KPE A;  1OW8 A;  1K8A Q;  2XNX A;  1LWU C;  4NPF X;  2FVA A;  2E76 B;  3P8C E;  1JY2 O;  1FR2 A;  2MJZ A;  3CD6 P;  3TF5 A;  1D1D A;  3MHV A;  2AF8 A;  1SQX E;  4PD4 H;  1PP9 D;  3G4S P;  1QL2 A;  2P58 A;  3L73 J;  1NKN A;  3L75 D;  1K30 A;  1QGK B;  4PXH B;  2QM7 A;  1T6A A;  1QVF O;  1JMM A;  3HE4 B;  3EFF K;  1J2J B;  1QEX A;  1FZC A;  4NPD A;  2ZYG A;  1OVR A;  3G29 A;  4BPG A;  1FZA A;  2CPS A;  2Y9Y A;  3HTK B;  1CSB A;  1LTA C;  1Q90 D;  4RO0 A;  1M1J C;  1RO0 A;  3L71 D;  3L70 J;  2NPS B;  3II6 A;  3L74 D;  5KLV K;  1FOS E;  3TGU J;  3HYB A;  2C9L Y;  3AEG C;  2FYZ A;  1KV4 A;  2AVA A;  1EQ7 A;  2JO1 A;  1JY3 P;  3NTN A;  5AW2 B;  1A43 A;  1FS0 E;  4XFY A;  1SQB G;  3GHG B;  2Q9I A;  1JTH A;  1P84 D;  2I1K A;  5KJ7 A;  2XXM A;  5DCK A;  1BCC G;  2Q5U A;  3PTZ A;  3Q5P A;  1U7M A;  3KDP B;  1LTJ C;  1KB9 H;  3LID A;  2M8L A;  1P84 I;  3A5T A;  4ASV A;  3L4F A;  1IFI A;  4C7N A;  1BE3 D;  4D6T J;  3HD7 A;  1ACP A;  2OYO A;  5KAI E;  5TIS H;  3QH9 A;  1S2E A;  5I4T G;  2JB0 A;  2PEK A;  1J1D C;  1N7S D;  1AJY A;  2WWW A;  4EI2 A;  3IF4 A;  3BAS A;  4JPZ B;  4R4L A;  3S1K A;  1X22 A;  1Z56 A;  2JKV A;  3TNU B;  1JY3 O;  5B5E E;  1VF5 D;  4ASW A;  4UB6 E;  1VQ7 P;  3U1A A;  3L73 E;  2BCC D;  2CK3 H;  1JCC A;  2VRS A;  2MF4 A;  2ZJS E;  2N9Y B;  5F2N A;  1VF5 C;  2GYK A;  2Y0D A;  4H13 D;  3OAK A;  1N7S B;  1URQ C;  1HJ0 A;  2WSE J;  1Z6M A;  1BGY D;  2KOS A;  1EC5 A;  3F89 A;  3Q5S A;  1RH5 B;  4IZ6 A;  3GMA A;  1ZV8 A;  1SFC C;  1GU4 A;  3E2D A;  3DS4 A;  3A0B E;  1SQV K;  5AW6 B;  5M1B A;  1H0T A;  1LWU A;  3MP7 B;  3BVH A;  3WUT A;  4XFZ A;  2KOO A;  2Q3E A;  5CMZ A;  3L70 E;  3H1I D;  3TGU E;  3AE8 C;  1F80 D;  4HH2 A;  1RE3 C;  2EIA A;  1Y9B A;  5GTI H;  4BPH A;  4H13 B;  3AE4 C;  2KIK A;  5AW5 B;  5KAF H;  3PH0 A;  1S1C X;  1YHQ P;  1G1I A;  2GDX A;  3N4X A;  1SQQ D;  1M6E X;  2NPS A;  1JMB A;  1PGQ A;  2PEQ A;  3LIE A;  1ZLL A;  1EIA A;  1NTK G;  5KKZ B;  1JOC A;  2XT1 A;  2KSJ A;  4UB8 H;  1NO4 A;  2IBZ G;  1NU1 D;  5CZD B;  2JO0 A;  2Z5H A;  4H2W C;  1MUU A;  3L72 G;  1T8K A;  1YQ4 C;  1M1J A;  3EJD A;  3L74 E;  3E7K A;  3KZI H;  2R32 A;  3M1M A;  5APV A;  1FBM A;  1S5L E;  1NTM K;  3SWF A;  2KSE A;  3RK2 C;  1N73 B;  4WB4 A;  4GT1 A;  2FXO A;  2LKI A;  1EZV D;  1P84 E;  3NTE A;  4WBA A;  2Z45 A;  1XTG B;  2FAC A;  2JU2 A;  2CQ8 A;  1RF1 C;  4XA4 A;  2OYH A;  4M3L A;  2AEJ A;  1EZV I;  1L4A C;  3CXH H;  1L2P A;  5BS2 A;  2LML A;  1K73 Q;  2CPB A;  2DGY A;  1ZR2 A;  2RH0 A;  1CI6 B;  4QMA A;  1HY8 A;  1LT9 B;  1FAV A;  1KLP A;  1T3J A;  1CEI A;  1QRJ A;  2KXP B;  1SQB D;  3C1L A;  2GDW A;  1N7S A;  1IO4 A;  3RG6 C;  1DIP A;  3VOP A;  1L0L D;  2Q3I A;  5APW A;  1LTI C;  2W8Z A;  2WSC J;  2ERH A;  4H44 D;  2JR8 A;  2YMY A;  3CCJ P;  2KS1 A;  1AYI A;  2GZF A;  4H44 C;  2LF4 A;  1H89 A;  1JUN A;  1BSN A;  1YIJ P;  2WSF J;  1GXH A;  1HJB A;  1AVY A;  2AXT E;  1BGY E;  2EHS A;  1SLQ A;  3AE6 C;  1VPC A;  1BXI A;  2QJP B;  2D2C D;  3PLN A;  4C46 A;  2E5Y A;  2B9B A;  2V4H A;  2LR2 A;  2OYI B;  1SQB J;  5H2F H;  3V2P A;  2WT7 A;  2N50 A;  2E74 C;  3H1I E;  3MZW B;  1E5W A;  2D2C C;  2QJK C;  2QG4 A;  2ZVN B;  1M57 D;  1NTZ G;  3P8C D;  3H1K G;  4WYM A;  3Q2Y A;  2KGD A;  2WSS H;  1FDM A;  1YJ9 P;  5CHX A;  5APS A;  1SQQ E;  2HLO A;  5B66 E;  1W2B O;  1AV1 A;  4XE5 B;  1NYH A;  1N73 A;  3H1H D;  4IFF A;  3OW2 O;  4I7Z C;  3Q1M A;  1KIL C;  1EOQ A;  4BPF A;  1NU1 E;  2CGQ A;  1SQP K;  1L0H A;  3BRT B;  1DD3 A;  4HYT B;  1T3U A;  3W68 A;  2LL8 A;  1VDF A;  2GUS A;  3A0H H;  3SFE C;  4IPY A;  3G6E P;  2R3S A;  1IK7 A;  2YMK A;  4U0E A;  1EZV E;  4PJ0 E;  3EFG A;  1IMQ A;  5KTB A;  3CCM P;  1YJW P;  1NH4 A;  2L5G B;  1IJD B;  4GR6 A;  1LT9 A;  3IN6 A;  5AVT B;  3H25 A;  4U0D A;  1IZN B;  4R0M A;  5AW3 B;  2LPK A;  1NTK D;  3DS0 A;  2ZVO B;  1KZU B;  1FJK A;  4C7R A;  3JC2 2;  4Y28 J;  2L0Q A;  2KGA A;  2K2Q A;  2KGC A;  3AEB C;  4K35 A;  4W7Y A;  5AVQ B;  1JTH B;  3BCC G;  1EDJ A;  2YIU C;  1PL5 A;  2K93 A;  3SFD C;  2WZ7 A;  3GKL C;  2MR8 A;  1SQB E;  1QL1 A;  5HGN A;  2JYL A;  3RL0 B;  3DTJ A;  4JBZ A;  1E79 H;  3T97 A;  5AVR B;  1FZG A;  4AYC A;  1MFZ A;  1KYO H;  2ZT9 C;  4C7N B;  2FYU G;  1RE4 C;  3Q3D A;  1MZ9 A;  1ZME C;  2GZI A;  1KD1 Q;  1L0N D;  3C8V A;  1NTK J;  1RF0 C;  2OYI A;  1Q81 Q;  3B5N C;  1MFT A;  2K0D X;  5AVX B;  2VLO A;  2H7H A;  4LLH A;  2Y0C A;  4U0C A;  1FC2 C;  5HGL A;  2LXC B;  2WPV B;  3M0A A;  2QM8 A;  1HF9 A;  4L73 A;  1N8R Q;  1NTZ K;  2FHS C;  2PEN A;  1PFI A;  4XFX A;  2A06 G;  1GW4 A;  2ITA A;  1EDI A;  5APT A;  3L70 D;  3VMZ A;  1NJI Q;  2MD9 A;  3TGU D;  3FX0 A;  3H1J G;  5KAI H;  1VQ9 P;  2JP3 A;  3H47 A;  1SQV G;  2H43 A;  3NXS A;  1L0N J;  2M0B A;  3D6Y A;  1HGV A;  1IK9 A;  3NFQ A;  3MGE A;  2KOG A;  4COC A;  1BAJ A;  2XU6 A;  2NZ2 A;  2R44 A;  2M5R A;  1PPJ G;  1Q86 Q;  1H0T B;  1LWU B;  3TK1 A;  1HVV A;  1KQS O;  3H1H E;  3M0D C;  1YTZ I;  1RO2 A;  3VMY A;  2KNC A;  5B5E H;  4UB6 H;  5CBO A;  2J59 M;  4D6T D;  4XRO A;  3L36 A;  2B88 A;  1AA0 A;  1YYC A;  1M6N A;  3RL0 g;  2PEM A;  2YXR B;  2VLN A;  2YNY A;  3H1K D;  1S9K D;  1GL2 D;  1PV3 A;  1FZB A;  4U7J A;  2GZG A;  1SS1 A;  1JM0 A;  1CZQ A;  2K1A A;  1GL2 C;  1VQ4 P;  4GOE A;  3A0B H;  3V2N A;  4CA3 A;  2PP6 A;  1NTM G;  5AVU B;  2Y0E A;  2N6Z A;  1NTK E;  2BHV A;  2VLQ A;  1M1J B;  1S5L X;  1HTL C;  1FDI A;  4CPG A;  3M9H A;  3B5I A;  1D7M A;  1WRG A;  2DW3 A;  1KTM A;  1Y47 A;  5AVZ B;  2B87 A;  1X8Y A;  1AVO A;  5KP6 B;  2N5I A;  1GTW A;  2WPQ A;  3WMM 0;  5HVC A;  4H2X C;  1NTZ J;  3AE7 C;  3G0V A;  4EDF A;  2OYH B;  3H1K J;  2A45 I;  2FYU K;  4OGQ D;  1E0H A;  2MY5 A;  3Q5R A;  3O6Q A;  5BU8 B;  1E6J P;  4OGQ C;  2N9B A;  4N3Y B;  4U3F D;  2Q6Q A;  2JWD A;  5KLV D;  2QJY C;  4KJM A;  2XV6 A;  5HGM A;  2OGU A;  2OTL P;  1L0N E;  2YKO A;  2K37 A;  2C9N Y;  1FDO A;  2KUB A;  2O01 H;  3V6I A;  2JYG A;  2JQ4 A;  1RQU A;  4COP A;  2OQQ A;  1S5L H;  1URQ D;  3UIA A;  2ZXE B;  2JU1 A;  3HUS C;  2W90 A;  1P84 H;  3BCC D;  2PNG A;  1SFC D;  2DNW A;  3VMA A;  1SQX G;  2N1T D;  2KOQ A;  2FBW C;  2QEX P;  4U0F A;  3JSV C;  1GDT A;  2KS1 B;  4GDO A;  4QKO A;  2N1T C;  1VF5 B;  4U3F J;  2L4B A;  3H1L D;  3CCV P;  1GXG A;  5E79 E;  5KLV J;  2GZE A;  1R5L A;  2Z5I A;  4I2L C;  2V7Q J;  1NGM B;  2WSE H;  1SVF A;  4PWV B;  2M8P A;  1Y8A A;  4GOD A;  3Q20 A;  3RK3 D;  2KYV A;  2NRG A;  3GLM A;  3O8Z A;  2WMM A;  1UIX A;  2R5B A;  1SFC B;  1M1K Q;  4GIF A;  5CCG D;  4EOT A;  3RK3 C;  2O1K A;  3CCS P;  2WT7 B;  3V4Q A;  1IFM A;  2P2U A;  3BCC J;  3M0D A;  5CCG C;  2P67 A;  2PRR A;  4IL6 E;  4H0L C;  2MVV A;  3I56 P;  3CX5 D;  4D6T E;  1OXZ A;  1N2D C;  3EQ2 A;  3V5B A;  2A06 D;  4W7Z A;  4DJG A;  1IFD A;  1KFM A;  3H1L J;  3RK2 D;  3GW6 A;  3V4W A;  2W6J H;  3CX5 I;  2FYU J;  3H1K E;  1HGZ A;  4WY4 D;  2HPC B;  2IZ0 A;  1S9K E;  2BQ1 E;  3H1J D;  3H0D A;  3CCL P;  1X0T A;  5CBN A;  1PEO A;  2AXT H;  4LGD E;  4WY4 C;  4DCK A;  3AE1 C;  1SQP G;  1ZN5 A;  1GL2 A;  2FKW B;  2KP8 A;  3ITK A;  4ZKP A;  2PAJ A;  2NO8 A;  2GUV A;  3D71 A;  1L4A D;  2QVA A;  5AW1 B;  2MKV A;  3DPH A;  1L0L K;  3BRV B;  3B4S A;  2QA4 P;  1FZE A;  1LTJ A;  2I1J A;  4JYC A;  1U57 A;  1KC8 Q;  3TYY A;  3VP9 A;  2FFD C;  3M06 A;  3B4Q A;  3RK2 B;  5F2O A;  1NKZ B;  1YTZ T;  1EXI A;  2FAE A;  4Z1M H;  4WVZ A;  2GDY A;  2LXB A;  2IYO A;  3M91 A;  5C39 A;  2POH A;  3GZM A;  2KG9 A;  1KQG B;  5B66 H;  2M5A A;  2E75 D;  4TLF A;  3H1J J;  3L73 G;  1SQV J;  1GW3 A;  1L4A B;  2P7J A;  2BEQ D;  3E1R A;  1EDL A;  2E75 C;  2XZ0 D;  4U3F E;  5APU A;  4ZNC A;  5KLV E;  1OW6 A;  3V2Q A;  3QWO C;  1VQM P;  2LIU A;  3OJA B;  1LP1 B;  1NTM D;  1LTB C;  1BCC D;  5BS1 A;  2HOD B;  1NQ4 A;  4I6M C;  1HQB A;  1OVU A;  1G1J A;  2XND H;  3G1I A;  1SQX K;  2O3J A;  4EIJ A;  2P9X A;  3A3Y B;  2H8P D;  1OZH A;  4O9B A;  1AFO A;  2FQ0 A;  3BCC E;  4PJ0 H;  1URQ A;  3T97 B;  3S9O A;  2GZJ A;  3P05 A;  2M3B A;  1PGP A;  1PP9 G;  2WSC H;  4DZO A;  4BWN A;  1H8A A;  2E74 D;  3L75 G;  1SFC A;  1YI2 P;  3KZI E;  2K94 A;  5AVS B;  1G2C A;  2FY8 A;  2N1T A;  3H1L E;  5CJ4 A;  3VYI A;  1IFN A;  4H44 B;  3LW5 J;  1RE3 A;  1NTM J;  4AQR D;  2L9F A;  1BCC J;  1NOH A;  1WT6 A;  1HUC A;  3RK3 E;  3SWY A;  3HZQ A;  4DG9 A;  3PHL A;  1X9V A;  1S4X A;  5AVY B;  5KLI C;  4OWF A;  3AE2 C;  2HPC A;  3WUV A;  5GTH E;  1A02 J;  4GOF A;  1AUM A;  3L71 G;  2E74 B;  1JJ2 O;  2D2C B;  2W27 A;  2QJK B;  3L74 G;  3MGN A;  1PZQ A;  2N6Y A;  1KIL D;  2K3R A;  4KHX A;  3CX5 E;  2FXP A;  2A06 E;  5K5G B;  4RES B;  3AEE C;  1LJ2 A;  1IFP A;  3A7O A;  1J1E C;  1DEE G;  1YBK A;  4W80 A;  1PEQ A;  2QSI A;  1VL2 A;  4PV1 D;  1OVV A;  3H1J E;  2P1J A;  1SQV E;  1FZC C;  3CL3 D;  4ZMD A;  4HKG A;  4L75 A;  4PV1 C;  4PH0 A;  4NEO A;  2AEM A;  1KYO D;  1BE3 G;  2KLV A;  4UHP B;  1PPJ E;  2KNC B;  4I7Z B;  1JNM A;  1HWT C;  3JCU E;  3E1I A;  1RF1 A;  1LT1 A;  4N6J A;  1ZNV A;  1RNI A;  1KYO I;  1ZW0 A;  1L4A A;  2IX7 C;  3MUD C;  1SQX J;  2HG5 D;  3ABV C;  2HR3 A;  5HGO A;  2OTJ P;  1AQ5 A;  2K88 A;  1Q82 Q;  3D6Z A;  4GKG A;  1LP1 A;  2IBZ D;  1OX3 A;  4GR2 A;  1W5C E;  5DJU B;  5KJ7 C;  4HJG H;  2JAZ A;  2HOD A;  3L72 D;  1T8Z A;  2FYN C;  2M8N A;  3AEA C;  3CC7 P;  1M56 D;  4BXL A;  2BCC G;  2IBZ I;  3HD7 D;  3RL0 C;  1ZR4 A;  3CME P;  3FWL A;  3FXE A;  2ZT9 D;  3CI9 A;  4YXW H;  3HD7 C;  3TDK A;  2IFM A;  3CC2 P;  1NTM E;  3B8E B;  1BCC E;  1M90 Q;  2B87 B;  4PD4 D;  1JO5 A;  1BGY G;  2E5T A;  3G28 A;  3U59 A;  1JY2 P;  3B5N D;  1KMI Z;  3FXD A;  4PD4 I;  2YIU B;  2XZ1 C;  2RN0 A;  2Y9Z A;  4L76 A;  3H32 B;  2Z44 A;  1K9M Q;  2XV5 A;  3O6Q B;  1USD A;  3AEF C;  3H1I G;  3L72 J;  2IYP A;  4IOI H;  3VTP C;  2QE7 H;  2ONT A;  3G21 A;  1VKU A;  1QVG O;  2W6B A;  4IFM A;  2C0W A;  2E76 C;  1SQP J;  1EMV A;  3G71 P;  4MN4 C;  5BVZ A;  1IFJ A;  2XDJ A;  3RGU A;  5AW4 B;  1JCD A;  1SQQ G;  2JWA A;  3EJB A;  1MZ8 A;  3HRN A;  3CC4 P;  3P7K A;  2IDB A;  2K5X A;  4JQ0 D;  1IUQ A;  3AE3 C;  1OWA A;  2IFN A;  2J58 A;  1FJP A;  4K3A A;  3CMA P;  1N86 A;  4Y99 B;  3CCU P;  2PEJ A;  1A02 F;  1NU1 G;  1X79 B;  4RKU J;  2Z46 A;  4HB1 A;  1ZRT D;  1KB9 D;  1KIL E;  2WTY A;  3MIW A;  1UJZ A;  3RBX A;  4AUW A;  1RY3 A;  2PEI A;  2NPS D;  3MTU E;  4IFD K;  2GM4 A;  1KIL A;  1VQN P;  3LMO A;  5KP7 B;  1EZV G;  1KB9 I;  1NAY A;  1ZMB A;  2FVE A;  4NPE A;  2FAD A;  4L74 A;  2NPS C;  1BDD A;  3CWB G;  3RBZ A;  3K5B A;  2KOR A;  1ZXG A;  1NTZ D;  1JY2 N;  5DJT B;  1YQ3 C;  3G9R A;  2WPR A;  4JF7 A;  4IL6 X;  1AF8 A;  2FVF A;  1KYO E;  3GHG C;  2QNW A;  1T2K D;  4QNB A;  4JYB A;  3W67 A;  1KQF B;  2EG5 A;  3GZL A;  3FGA D;  3BAT A;  1XTC C;  1T2K C;  2O01 N;  5APQ A;  5AVW B;  1IC2 A;  3VN0 A;  1OR5 A;  3MUD A;  2RMZ A;  5E79 H;  1DV5 A;  1PP9 J;  3C9I A;  1UII A;  3G3Z A;  4YXD C;  3L75 J;  2IBZ E;  3WU2 E;  3L72 E;  2G3A A;  1L0L G;  2EHT A;  2OYH C;  5TJH A;  2I8D A;  1GL2 B;  3H4E A;  4TT3 H;  2Q1K A;  1L0I A;  1JEK A;  3HE5 B;  1SQP E;  2AEF A;  3M9B A;  2ZAE B;  1BSH A;  3H32 A;  2FQ2 A;  1LTJ B;  3FWN A;  4IL6 H;  2FQ1 A;  7CEI A;  5CCH D;  2K9Y A;  5EFW B;  3MD0 A;  4PD4 E;  2YXQ B;  1S72 P;  1QLE D;  3EJE A;  3R4Y A;  2KOD A;  1VQ6 P;  3L71 J;  2BEZ F;  5CCH C;  2O01 J;  3L35 A;  1RE4 A;  3L74 J;  2P10 A;  1FOS F;  2VLP A;  3S4R A;  3CXC O;  2M5A B;  1LTG C;  1OFC X;  1RF0 A;  3EWK A;  3B5N A;  1J1D B;  2BAS A;  1N7S C;  4BRY A;  3A2A A;  3CCR P;  3DS3 A;  4OGQ B;  2PFX A;  1A8O A;  3DS5 A;  1ZP0 C;  4WWI A;  2J5U A;  1OMI A;  2IPP A;  2QJY B;  3SSU A;  3G26 A;  1EDK A;  1PGO A;  1SQQ K;  1M7L A;  3SWK A;  2W6A A;  4HKZ H;  2ROQ A;  1LNQ A;  1EXJ A;  2PGD A;  1BE3 J;  1GMJ A;  1KOR A;  1RHZ B;  1VQP P;  3CCE P;  1NAF A;  4H13 C;  2A45 H;  2FYU D;  4OH8 B;  1NU1 K;  4DT0 A;  3HUS B;  2HYN A;  3AE5 C;  2G8Y A;  3H1H G;  1JY3 N;  1URQ B;  3KQG A;  2E43 A;  1HBW A;  2JEE A;  2ZFC A;  4ZKU A;  2FXM A;  3GF3 A;  4XRQ A;  3HE4 A;  2L91 A;  2KWL A;  1ZRT E;  1GK6 A;  1WMK A;  2PEO A;  1KB9 E;  4M0I A;  3CXH D;  1G2C B;  4H0L D;  2N1T B;  5KKZ C;  1PP9 E;  1HH0 A;  2V7Q H;  1VHN A;  1AQT A;  2WPS A;  2HFE D;  2BCC J;  1OIP A;  3L75 E;  1JB0 J;  3CE7 A;  2L22 A;  2LIW A;  4A7P A;  3CXH I;  3P32 A;  4YTP C;  3HTK A;  5TIS E;  3CPW O;  5CJ0 A;  3I55 P;  1NTZ E;  2QIW A;  1N73 C;  1PEU A;  3RK3 B;  2AFE A;  1BGY J;  1QX8 A;  1SQV D;  1BDC A;  3GHG A;  2PY8 A;  3RG2 A;  1FZF A;  3DS1 A;  4H0L B;  2WIT A;  3NMD A;  4DOJ A;  1PPJ D;  3L71 E;  1SQB K;  2O1J A;  3H1I J;  5AVV B;  3HE5 A;  1NWQ A;  3I5C A;  2KG6 A;  3WBH A;  5EW5 E;  1CW5 A;  5APY A;  1DD4 A;  3GJN A;  4WY4 B;  2JJL A;  2JBG A;  1VQO P;  2N98 A;  1LT9 C;  1SQQ J;  5AW7 B;  3CWB D;  2L6E A;  2KI7 B;  1DH3 A;  2LTE A;  2KZI A;  3IAO A;  1DNY A;  2AFD A;  1RF1 B;  3U43 A;  5GTH H;  1L0N G;  3IFM A;  1LTT C;  5L8R J;  1BE3 E;  3G1G A;  3CLQ A;  3VRL C;  2N5H A; 
#chains in the Genus database with same CATH homology
 1VQ5 P;  1BAJ A;  3NTE A;  1E6J P;  2P9X A;  2Z45 A;  4XRQ A;  3CCQ P;  1Q86 Q;  2PEO A;  2XV6 A;  4M0I A;  5F2K A;  3CC4 P;  1KQS O;  1RO0 A;  3H4E A;  5HGM A;  2OTL P;  3P05 A;  1RNI A;  2BQ1 E;  3HYB A;  3H0D A;  4WYM A;  3CCL P;  1IUQ A;  1PEO A;  4U0A A;  1RO2 A;  5HGO A;  5BS2 A;  2JYG A;  2OTJ P;  1YJ9 P;  4COP A;  3E2D A;  1VQ8 P;  3DS4 A;  1Q82 Q;  2E1M A;  4U0B A;  5HGN A;  2JYL A;  1A43 A;  1YI2 P;  3CMA P;  4XFY A;  3CPW O;  4XRO A;  3CCU P;  2PEJ A;  3DTJ A;  1K73 Q;  4GR2 A;  2DGY A;  4XFZ A;  3I55 P;  1W2B O;  2Z46 A;  1M6N A;  2M8N A;  1S72 P;  2PEM A;  2XXM A;  5DCK A;  2EIA A;  3DPH A;  3CC7 P;  2KOD A;  2EFJ A;  1VQ6 P;  1PEU A;  1PEM A;  2QA4 P;  1VQK P;  1KD1 Q;  2M8L A;  1KC8 Q;  3CXC O;  4PH1 A;  1YIT P;  3CME P;  1QRJ A;  2PEI A;  3OW2 O;  2PY8 A;  2QEX P;  3HZQ A;  4U0F A;  1EOQ A;  1YHQ P;  1Q81 Q;  1K8A Q;  1VQN P;  3DS1 A;  5F2O A;  1ZMB A;  3LRY A;  4U0C A;  1VQ4 P;  5HGL A;  3CC2 P;  3RG6 C;  3CCR P;  1M6E X;  3CCV P;  3DS3 A;  1M90 Q;  1AUM A;  3CD6 P;  1A8O A;  3DS5 A;  2PEQ A;  1JJ2 O;  1D1D A;  3G26 A;  3G28 A;  2M8P A;  2BHV A;  3DS2 A;  5I4T G;  1EIA A;  2OAR A;  2PEK A;  4IPY A;  4COC A;  1N8R Q;  3G6E P;  3CCJ P;  3G4S P;  3Q20 A;  3WBH A;  1Q7Y Q;  2XT1 A;  4U0E A;  3B5I A;  1K30 A;  2PEN A;  2LF4 A;  4QNB A;  4XFX A;  1YIJ P;  2Z44 A;  3CCM P;  1YJW P;  1VQP P;  5JPA A;  2EG5 A;  2JO0 A;  1M1K Q;  3CCE P;  1K9M Q;  4GR6 A;  1VQO P;  1M74 A;  1VQM P;  1QVF O;  1PEQ A;  2CWO A;  3CCS P;  2L6E A;  5BS1 A;  3M1M A;  4U0D A;  1NJI Q;  2BUO A;  2ONT A;  3G0V A;  1YJN P;  3G21 A;  1VQ9 P;  1VQ7 P;  3H47 A;  1QVG O;  4PH0 A;  3DS0 A;  3I56 P;  3G29 A;  3G1G A;  1VQL P;  3MGE A;  5F2N A;  3G1I A;  3G71 P;  3VRL C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...