3OW2O

Crystal structure of enhanced macrolide bound to 50s ribosomal subunit
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAKGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S RIBOSOMAL RNA
total genus 47
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2010-09-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3ow2O03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 3ow2O01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 3ow2O02
3I55P 1VQMP 1VQ5P 1YJNP 1KQSO 3CCJP 3CC4P 3G4SP 1Q82Q 1VQ6P 2OTLP 2QEXP 1W2BO 1YIJP 1M1KQ 1VQPP 3OW2O 3G6EP 1YITP 1NJIQ 3CCQP 1K9MQ 1Q86Q 3CCLP 3G71P 2OTJP 1VQ7P 1VQKP 2QA4P 3CMEP 1S72P 1K73Q 1M90Q 1VQ4P 1VQOP 3CC2P 1K8AQ 1YI2P 1VQLP 3CXCO 3CD6P 1VQ8P 1YJWP 1N8RQ 1VQ9P 3CCEP 3CCVP 1VQNP 1YHQP 3I56P 1Q7YQ 1Q81Q 3CCRP 3CCUP 1YJ9P 3CPWO 1JJ2O 3CMAP 1KD1Q 1KC8Q 3CCMP 3CCSP 1QVGO 1QVFO 3CC7P
chains in the Genus database with same CATH superfamily
2QJYB 3BRTB 5AVYB 2KB7P 2JQ4A 2KGCA 4YXDC 1T2KD 3FXDA 5TJHA 3RK3C 2M8NA 2ZXXA 5B5EH 3CXCO 2KOSA 4COCA 1URQD 1BXIA 1OFCX 3M9BA 1L0LE 3QH9A 2K88A 2FYNB 1EMVA 3JCUH 3EJEA 4PH1A 4WY4A 1X9VA 2ONTA 3L75J 1P84H 2AVAA 2K93A 5EJDA 1DEBA 2K9YA 3TGUJ 1SQXE 4U3FJ 1RE3C 2KGDA 1VPCA 2L22A 1FZBA 1H88A 3SSUA 4XE5B 3KZIE 1ZRTE 4C46A 4H13D 2D2CD 2A45H 4I7ZB 2NPSA 3TGUE 2NZ2A 1K73Q 2YXQB 3JSVC 5E79H 1L4AD 2AEFA 2AXCA 5HV8A 2GA1A 1N73A 5E79E 1MFZA 1KZUB 1RO0A 2L4BA 4HB1A 4EDFA 2QRXA 3H1HG 3H6PA 5AVVB 3C1LA 1Y8AA 3HUSC 3V2RA 3L71D 1RNIA 4GKGA 2ZT9B 2FQ0A 3H1LG 1HGVA 3MHVA 3FWLA 3BCCJ 3IF4A 1L0NG 3MGNA 3V2NA 4D6TD 5KAIE 1ZOYC 2FVFA 3AEDC 5BVZA 5AW7B 3H32A 1KLPA 2O01H 2M3BA 2L5GB 1X3OA 1AJYA 2KG8A 2OTKE 1T6AA 3RBZA 3RBXA 2GM4A 5KLIC 3A0HE 1EOQA 1ZR4A 1S9KD 1BDCA 2IX7C 1UIIA 5I4TG 1VQ9P 5KJ7C 1NYHA 3TNUA 2G8YA 3V2PA 4HKZH 1DNYA 5HGMA 2WQYC 1PEMA 1KQLA 2W90A 3CC4P 2I1JA 2OTLP 1L0NE 1OW7A 2FYZA 1KB9H 2IYOA 5AW5B 4N78E 3W68A 1S72P 2E75C 5CCHD 2PRRA 1URQB 1SQVG 1NOHA 2FQ1A 3EFGA 3RK3E 2BCCJ 4PD4H 3B71A 4PV1C 1EIAA 2W27A 1SQBE 5CMZA 2XV6A 1GL2A 2C0XA 3A7OA 4WVZA 2B88A 1BCCE 1OZHA 5CHXA 1SQQE 1GTWA 1J2JB 2N50A 2W6AA 2W83C 2E74D 2SPZA 1RQUA 1SQBJ 2AF8A 2N1TC 4IZ6A 3CL3D 3G9RA 4IL6X 3PLNA 1RHZB 1L4AB 1KTMA 5GTHH 1JTHA 1Y47A 2WT7A 4H44B 2ZYAA 3IFMA 1ZV8A 1HBWA 2W6JH 3LIEA 3AE9C 4GOEA 4BXLA 2Y0EA 2JYLA 2M0BA 3L75G 2BEZF 1M1JC 1FZFA 1TU3F 4I1LA 4ZKPA 4BPHA 1YQ4C 1FOSF 2E75D 3P8CE 2OYIC 3CCQP 1AUMA 1NGMB 2CPBA 2JWDA 2FYUG 2C9LY 1SQXD 2KK7A 1VQ4P 1NTMD 5GTIH 4K3AA 1AVOA 1GK6A 2K0YA 2Z5HA 1PGQA 3RG6C 1FR2A 2K5XA 1IC2A 3HE5A 3HD7A 1PP9J 2KUBA 2ROQA 3WUVA 2LXBA 3GF7A 1UIXA 1EZVI 3RL0B 2CQ8A 4PWVB 2XXMA 3LRYA 2KODA 1ZLLA 5AVWB 1SQXG 2MVVA 4PV1B 2YIUC 3BASA 2LIWA 2P1JA 3OW2O 4H2YC 4IFDK 3RK2D 3L71G 3P8MC 1YTZT 2BCCD 5HVCA 2R3CA 2AFEA 2C0WA 1N7SB 1GMJA 2PEOA 3CCSP 1KORA 4H0LD 3CC7P 4H13C 3I55P 2KLVA 1YJNP 4I6MC 3L35A 1RE4C 1J1DC 5KLVE 2N1TB 2FYUD 1XTCC 1EC5A 1NO4A 2B89A 1N73C 1PV3A 5CJ4A 1MUUA 1AV1A 3A0HH 3GZMA 1NU1G 3P7KA 3GLMA 3CPWO 3Q3DA 2QM8A 2JO1A 1QVFO 3CWBE 2IBZE 5F2NA 4YXWH 1LTGC 2ZYGA 5BS2A 3GW6A 2PP6A 2Q1KA 3L72J 1ZW0A 4GIFA 1K30A 3BATA 1M56D 2R32A 3H0DA 1N8RQ 2N6ZA 2KSJA 4XFZA 4TLFA 3DS0A 1NHLA 2P67A 1NTMJ 4RO0A 3G4SP 1DD4A 2HPCA 1KB9D 1JUNA 2A45G 4NEOA 1FJKA 1HGZA 1VF5D 5AVQB 1SQVD 3P32A 1FZAA 2Z4EA 2YMYA 3AEGC 1PP9G 2MR7A 2N1TA 1Q7YQ 3KQGA 2FYNC 2XNDH 1VKUA 3G29A 1HQBA 4BPFA 3E7KA 1VDFA 1X22A 1JY2P 1VL2A 2E42A 1BCCD 2C9NY 2ZXEB 2J58A 2X2BA 3KHUA 1SFCA 5CCHA 1KYOH 1VQ8P 3H1JJ 3H1KD 4WY4B 3R4YA 1Q90D 2UWJE 1PP9D 2K0XA 2JJLA 3WU2E 3HUSA 2BASA 3CX5D 1NTKK 3WUTA 3NXSA 1HWTC 4IPYA 1NQ4A 3H1KG 1U57A 4Z1MH 2J5UA 2KW2A 1KILC 1FZCC 3CXHD 1GW4A 1MFTA 2OYHB 1BCCG 4PV1D 2NPSC 1NTKE 3S9OA 4Y99B 2QIWA 2M8PA 5APTA 2GDWA 2JEEA 4LC1A 5DJUB 3AEAC 2H43A 1SQBG 1ZMEC 1QL2A 3RK2B 2LPKA 2O1KA 1HY8A 2K3RA 2LKIA 3H1LD 2GZIA 1K8AQ 1BE3G 1FZEA 2HPCB 1PIXA 1RQVA 1JJ2O 2JGPA 1E6JP 2RMZA 3H1HE 4C7NB 2Z46A 3VP9A 1LTJB 3VMXA 1FU1A 2QEXP 1E79H 2LIUA 1E5WA 1AQ5A 3E2DA 2IFNA 4XFYA 4DJGA 1QX8A 2KSEA 2XZRA 1CEIA 1KV4A 2LR2A 2O3JA 3A0BH 2FYUK 2R5DA 3D6YA 3CXHI 2CNRA 1SQVJ 1JEKA 3Q5SA 2FVEA 4UB6E 4H13B 1Y9BA 4N3YB 2IZ1A 2Y0DA 3D71A 2JP3A 4YTPC 3AE8C 3ZDMA 3HYBA 3BVHA 4MN4C 4CA3A 1N7SA 1KYOI 1ACPA 2YKOA 3GJNA 4GR2A 4DOJA 2M5AA 2M8RA 2IZ0A 2KS1B 2QA4P 2CGQA 1S3JA 4WB4A 1X0TA 5H2FE 5KKZB 2FQ2A 3NMDA 1SQPE 1VF5C 2E5TA 3G26A 3M0AA 3DS5A 3Q20A 3H1IG 5K5GB 3M0DC 1LWUC 2JBGA 3H1JG 3OJAB 1M6EX 3MGEA 2FBWC 2I1KA 4O9BA 4H0LC 2KOPA 1H8AA 2OQQA 1PL5A 4RESB 2I8DA 2KI7B 1NTMK 3L73D 3TK1A 1GL2D 2R3SA 2JKVA 1E0HA 4DZOA 2CK3H 4UB8H 2B87B 1BGYD 1WT6A 4U0AA 2XKMA 1EZVG 3G21A 2RH0A 1M1JA 2GUVA 2VLPA 3VMZA 2G3AA 5APUA 1KILD 2FACA 4M3LA 1ZR2A 2K92A 3SWYA 4H44C 1LP1A 1URQA 1LT9C 2MR8A 5DJTB 2E76C 2FXMA 4PD4D 2H88C 3GMAA 4OGQB 5B5EE 5CCGA 3EQ2A 2KWLA 1SQPD 1D1DA 4DG9A 2O01J 1LTSC 1R5LA 2DNWA 4RJTA 4R4MA 4U0DA 1H89A 1BAJA 2HFED 3U1AA 1NTZJ 5KAFH 1U7JA 1KILA 1FZCA 2XU6A 3WU2H 3V5BA 1K9MQ 1SLQA 3U1CA 4Y28J 2Y0CA 2WSFJ 2PFXA 3V4QA 5KLVG 1QVGO 2EFJA 2PEKA 1MKMA 1VQMP 1SFCB 1AQTA 1USEA 3L74E 1KFMA 3AE3C 1RE3A 5TISE 4TT3H 2BQ1E 2WITA 2M8LA 4BPGA 3H4EA 3CC2P 1YI2P 1JTHB 3H1LJ 2XNXA 3W67A 3AE5C 3CCUP 1T3UA 2YIUB 1IO4A 5CCHC 1A02J 1MZ9A 3KYQA 4I2LC 4DCKA 3Q5PA 2WPSA 1EXIA 2EHSA 1VHNA 3OAKA 3VMYA 4GOFA 1SQBK 7CEIA 1BSHA 1VQOP 2E76D 3EFFK 1S1CX 1YJWP 3SWFA 3CXHH 2IDBA 2PEQA 1EDLA 5APYA 3HD7D 1S4XA 2KP8A 3HUSB 2RKLA 3G3ZA 1VQPP 2A06E 3HE4B 2VLQA 4EI2A 1VQKP 3G28A 1PEUA 3DS4A 4U3FG 3MIWA 2OYIA 2ZYDA 3KZIH 3AE4C 1GL2C 3M06A 2JU1A 4KT0J 1WMKA 1L0LD 2DW3A 3RK3D 5BS1A 3IAOA 4N6JA 1LWUA 1GZLA 1IFMA 3CCEP 3WBHA 4KHXA 2VLNA 4I7ZC 1RE4A 4LLHA 3G1IA 1P84D 1HTLC 2IPPA 1KC8Q 3CD6P 2EIAA 2ERHA 2OGUA 1CZQA 2WWWA 3GKLC 3PH0A 5KLVJ 3CCJP 4UHPB 3VN0A 2YO3A 2L91A 4R4LA 1N86A 3H1JD 4PD4I 2WSSH 2JYGA 3JC22 3H1ID 1GXHA 1LTAC 1L0HA 1RF1B 4W80A 2Z5IA 3VP8A 3L71J 1JCCA 2WPTA 2E75B 3G6EP 1DD3A 2KOOA 2N1TD 5CBOA 5KJ7D 2L9FA 2WSCH 1KB9I 3L72G 3B5NC 1NU1K 5B66E 2QJKB 2FXOA 2GZEA 3L71E 4YPCA 2Z45A 2ZJSE 3CWBG 1Q82Q 2LMLA 3M91A 1JY3N 1IFPA 2AEMA 4C7NA 1BE3D 1NU1E 3A3YB 5AVZB 1LTBC 3PTZA 2JAZA 2K94A 3JCUE 1YQ3C 3B4SA 1GW3A 1JM0A 1L0LK 3L73J 4A7PA 3WUUA 3VRLC 1UNKA 1ZXGA 3C9IA 3RK2C 1PZQA 4GDOA 2D2CC 3AECC 1JY2O 1LGHB 1PPJG 3H1JE 1BGYJ 5KAFE 2K9JB 1FS0E 1W2EA 1F80D 5AVUB 1EQ7A 3LW5J 1PGJA 3CCRP 1JMMA 2N5HA 4F37A 1KD1Q 1M6NA 5JPAA 4JBZA 2QNWA 2V7QH 3CX5E 3M9HA 2PNGA 1M57D 2WTYA 3NTEA 1WRGA 2P10A 1FDOA 1SQXJ 4U3FE 4EYYQ 4ASWA 3DTJA 1SQBD 1AA0A 5APVA 1IZNB 3DS3A 4L76A 2FFDB 1LTTC 1KMIZ 1NTKD 1JY2N 1G1IA 3RL0g 2LTEA 1XTGB 1KYOE 2A45I 1Q2NA 1OR5A 4WY4D 2L0QA 3H1HJ 1CI6A 1EZVE 3B5IA 2WSCJ 1OXZA 1KQSO 2E74C 4HYTB 2J59M 1LTJC 1FBMA 3GHGA 1NKNA 3RL0C 2DGYA 3B5NB 1S5LH 1A43A 3KXDA 1P84I 4U7JA 3CMEP 2YKPA 2FYUE 5KAIH 2XDJA 3BCCE 1VF5B 4IOIH 1SQVE 1T3JA 1YHQP 1SQVK 4BRYB 1DH3A 3KDPB 1A8OA 3E1RA 4OWFA 5B66H 1QRJA 2MF4A 1J1EB 1M7LA 2YO2A 3H25A 2FXPA 1Z6MA 2OYIB 3AE2C 1L0IA 2FADA 3CWBD 1YIJP 4JQ0D 1JY3P 2KZIA 2FYUJ 1S5LX 1UJZA 3AEFC 1SQPK 2NRGA 5KP8B 1YJ9P 1L4AA 2W6BA 3HTKB 3T97A 2AXTE 1J1DB 4HKGA 1L2PA 1N73B 2AXTH 1RF1C 1A02F 1RF0C 1Q86Q 1EZVD 2R5BA 2ZAEB 1P84E 2K37A 2FHSC 2KS1A 3E1IA 3HE5B 1USDA 3B8EB 1G1JA 1JOCA 1ZRTD 1SQQJ 3CE7A 4OGQC 1EXJA 2Q3EA 1FDMA 3MD0A 2QE7H 2IFMA 3RG2A 2OYHA 1OW6A 3TDKA 2YKQA 1N7SC 5APSA 2Z44A 1VQNP 3OA7A 2FFDC 2BCCE 1AVYA 3MZWB 1M8OB 2WPVB 1OIPA 2GDXA 1KQFB 1MV8A 1HH0A 2V4HA 2MY5A 1NTZE 3ABVC 1HUCA 2JO0A 4COPA 2VRSA 2PENA 1BCCJ 3M0DA 1IUQA 1VQLP 1KILE 1QEXA 5HGNA 3HZQA 1T2KC 1SFCC 2XZ0D 5GTHE 2WMMA 3S4RA 1JCDA 2N9BA 3H1HD 4IL6E 3G0VA 2GZFA 3L75D 3LIDA 3L74J 2IBZG 5EFWB 2FAEA 3EJBA 2E5YA 3L36A 1W5CE 1FDIA 1SQXK 3CLQA 5KP7B 3D70A 1EDKA 1FJPA 1ZN5A 4PXHB 4U0CA 3L72D 1DV5A 1LP1B 1GD2E 3NFQA 1W2BO 1EDJA 2EHTA 1YBKA 1PPJD 3Q2YA 1G2CB 2Q9IA 2NPSB 3BRVB 3D6ZA 3I56P 4Y99C 1NTZD 4H2WC 2MKVA 2N6YA 2N5IA 1PEOA 1SQQD 2PGDA 4WY4C 3FXEA 2KGAA 3F89A 3G1GA 4XRQA 1SQQK 1T8ZA 1GL2B 3CX5I 4JYBA 1OW8A 1AF8A 1KYOD 1HVVA 4ZKUA 2E43A 2PEMA 1SFCD 1NTZK 2ITAA 4WWIA 2KR5A 1J1EC 1L0LG 1SQQG 2WPRA 4KJMA 1H0TB 5KLIB 1FE6A 1KILB 3EJDA 1FZCB 1H0TA 2AFDA 1HJBA 2PY8A 3CCMP 5KTBA 3N4XA 2M5RA 5KJ7A 3CWBJ 4GODA 5H2FH 1CI6B 3II6A 1L4AC 4OGQD 2XV5A 3L74G 1IFIA 1GU5A 1N2DC 3L70D 2ZFCA 1FAVA 3DS1A 3U59A 3AE7C 4MRTC 4D6TE 1EDIA 5AVTB 2PAJA 3HD7B 1FOSE 3A2AA 2HODA 1S9KE 4NPFX 4OH8B 1YITP 1NTME 3A0BE 1M1JB 4IL6H 2CG5B 5BU5A 4L74A 1LT1A 2KORA 3MTUE 4U0BA 1NTMG 2RN0A 2KOGA 1ZNVA 2QJKC 3CI9A 2Q3IA 3L73G 1CSBA 2L6EA 4UB6H 1L0ND 3VYIA 4GT1A 3TGUG 3P8CD 3B5NA 1NAYA 2QJPB 3O6QA 1FC2C 2LOLA 5BU8B 2HR3A 1QLED 2KXPB 1BSNA 1IFDA 4PD4E 3RK3B 1IFNA 4R0MA 3IR9A 1VQ7P 2POHA 4BRYA 2A06G 2MVUA 1PGPA 5AW2B 1X79B 1X8YA 5DCKA 3H1IE 4PJ0E 3K5BA 3UIAA 3M1MA 1JNMA 2HG5D 3AE1C 4CPGA 2D2CB 1AFOA 2KNCA 3L70E 4XA4A 1QGKB 3CCLP 1LT9A 1NAFA 2MJZA 4PJ0H 1IK7A 3CCVP 3FWNA 2E76B 3B4QA 3H1IJ 2CWOA 5KKZC 1OVVA 1SQPG 3F5HA 2YMKA 1NTKJ 3VMAA 2GUSA 3USSA 3G71P 4JPZB 2Y9YA 3GHGB 3L73E 4AYCA 1L0LJ 1D7MA 2KNCB 3GF3A 4QMAA 1OX3A 1PGOA 2AEJA 3FGAD 3FX0A 1RY3A 3L75E 5AW6B 3RGUA 2K1AA 1L0NK 1BGYE 1M1KQ 2K2QA 1NJIQ 1K04A 5APXA 3H47A 1BGYG 2M3EA 4NPEA 2A06D 2KG6A 2WSEH 3HD7C 3O6QB 1Q81Q 1JY3O 3MUDA 4L73A 5AW8B 2E74B 3U43A 1VQ5P 4JYCA 3HTKA 2PEIA 1YYCA 3S1KA 1RH5B 2WSFH 1LTJA 2M5AB 1MZ8A 2VSQA 3SFEC 3AE6C 1VQ6P 4QKOA 2QJPC 5C39A 3H1KE 4H2XC 5AW4B 2HLOA 3AEEC 5AW9B 4ZMDA 3PJSK 2W8ZA 2EG5A 2K0DX 3A5TA 3ITKA 1Z56A 1S2EA 3H1KJ 4U0EA 2FFDA 3V4WA 2QSIA 3VTPC 4XFJA 3L37A 2FVAA 1OWAA 2O01N 4RKUJ 1NTZG 1NKZB 5HGLA 4C7RA 2V7QJ 4HJGH 4L75A 3BCCD 4EIJA 4ZNCA 1PFIA 5KLVD 1NH4A 2XT1A 5AW0B 1SQPJ 1QL1A 4UB8E 2WT7B 1BDDA 3GHGC 5HGOA 3BCCG 3C8VA 2QM7A 3M9QA 2P58A 1RF1A 4H44D 2OYHC 5AW3B 1DX7A 1L0NJ 2O1JA 1KFNA 1LNQA 1S5LE 4NPDA 3B5ND 3T97B 1SP4A 2FY8A 2JU2A 3TSIA 1IMPA 2R44A 2NO8A 2KLUA 2GZGA 1GPJA 1N7SD 3PRJA 1GXGA 1NU1D 2GZJA 2HODB 2LXCB 1IJDB 2BUOA 2OARA 5GTIE 1GK4A 5APWA 3EWKA 2GDYA 3AEBC 2H8PD 2JB0A 2OYOA 1RO2A 3I5CA 2QJYC 1DEEG 2VLOA 5EW5E 2P2UA 3V6IA 2IBZD 2Y9ZA 2KZJA 1IFJA 1M74A 2YXRB 2H7HA 2IBZI 2K9JA 3NY7B 1DIPA 4ASVA 4D6TG 5CZDB 3VOPA 5F2OA 3RL0D 1LJ2A 2Q7CA 4WBAA 4M0IA 4AUWA 4HH2A 3LMOA 1K05A 4U3FD 3TGUD 4W7YA 3Q1MA 3PP5A 3CX5H 1FZGA 2BHVA 2JR8A 1IK9A 2WSEJ 3L4FA 1HJ0A 3MUDC 3WMM0 1OVUA 5AVXB 5F2KA 1PP9E 3DPHA 1AYIA 4OVNF 4U0FA 1LWUB 4LGDE 2JDIH 4H0LB 2LL8A 2WZ7A 3TYYA 1JO5A 1ZMBA 2IYPA 3L70G 2LF4A 1G2CA 3KPEA 3H1LE 3CXHE 4PH0A 1PPJE 4EOTA 1GU4A 3TF5A 4IFMA 3LW5H 4DT0A 2WPQA 3R2PA 1R5SA 2Q6QA 1RF0A 3NTNA 2E1MA 2N98A 1BE3J 3GG2A 4XROA 5AW1B 1N7LA 2ZVNB 1PEQA 4QNBA 3TNUB 2H89C 3N7NA 2OTJP 4JF7A 1M90Q 2QG4A 1LT9B 2KOQA 2Q5UA 4AQRD 2KG9A 2NPSD 1BE3E 1HF9A 5L8RJ 3HE4A 2BCCG 4WYMA 5M1BA 2WVRA 2LKMA 1U7MA 3MP7B 3GZLA 1CW5A 5AVSB 1ZP0C 3O8ZA 3V2QA 2HYNA 3QWOC 3SFDC 2YNYA 1LTIC 5KP6B 3HRNA 1SVFA 4GR6A 2CPSA 5APQA 1OMIA 2QVAA 2ZT9D 4N78D 4XFXA 1OVRA 3CMAP 1KB9E 1GDTA 2ZVOB 2FKWB 5KLVK 2XZ1C 4BWNA 2KIKA 2MD9A 1IMQA 1YTZI 2JWAA 5AVRB 2PEJA 2N9YB 1KQGB 5CJ0A 2ZT9C 3H32B 1NWQA 1JMBA 4D6TJ 4K35A 3P05A 5CCGD 2KYVA 2P7JA 3L74D 5CBNA 1KN7A 3SWKA 2GYKA 1NTKG 3L72E 4B86A 3IN6A 2BEQD 3PHLA 3Q5RA 1URQC 1SS1A 3DS2A 1JB0J 1R8EA 2P9XA 5TISH 2B9BA 3L70J 1NU1J 4W7ZA 2B87A 1NVOA 4IFFA 5CCGC 2KGEA 1T8KA
chains in the Genus database with same CATH topology
2E1MA 5DCKA 2Z45A 4XROA 3G29A 1KQSO 1Q82Q 1VQ6P 1PEQA 3M1MA 2PEMA 4QNBA 2DGYA 1VQPP 3OW2O 1A43A 2JO0A 4COPA 3CCLP 2OTJP 1D1DA 2PENA 1VQKP 3G28A 2M8NA 3CMEP 1PEUA 1M90Q 1IUQA 3DS4A 1VQLP 1RO2A 3CXCO 1VQ8P 4COCA 3CCVP 5HGNA 1YHQP 4U0DA 2CWOA 1A8OA 2PEOA 2PY8A 1BAJA 3HYBA 2EG5A 3CCMP 3CCSP 3HZQA 3CC7P 3VRLC 4WYMA 1QRJA 3I55P 1YJNP 4PH1A 1M74A 1YIJP 4U0EA 2ONTA 5BS1A 1EOQA 3G0VA 4GR2A 1K9MQ 4IPYA 5F2OA 3G71P 2QA4P 4GR6A 4M0IA 5HGLA 5I4TG 3CCEP 3WBHA 1VQ9P 2JYLA 3DS1A 3G26A 3CCRP 1YJ9P 3CPWO 3G1IA 3DS5A 4XFXA 3CMAP 2BHVA 3Q20A 1KC8Q 3CD6P 2EIAA 1QVGO 2EFJA 1KD1Q 5HGMA 2PEKA 1QVFO 1M6NA 4U0CA 5JPAA 1PEMA 1VQMP 5F2NA 1M6EX 2M8PA 3CCJP 3CC4P 3MGEA 2OTLP 1W2BO 1M1KQ 2XT1A 1YITP 1NJIQ 3CCQP 1AUMA 3NTEA 5BS2A 1Q86Q 2BQ1E 2PEJA 3H47A 5F2KA 2M8LA 3DPHA 1S72P 1K30A 3DTJA 1K73Q 3H4EA 1VQ4P 3CC2P 1K8AQ 1YI2P 4U0BA 3H0DA 1N8RQ 4U0FA 5HGOA 3P05A 3I56P 1Q81Q 3CCUP 2JYGA 1JJ2O 4XFZA 1E6JP 2L6EA 3DS3A 3RG6C 3DS0A 2Z46A 1VQ5P 4U0AA 1ZMBA 3G4SP 2LF4A 1RO0A 2QEXP 3G21A 3G6EP 1EIAA 3E2DA 2PEIA 4XFYA 1PEOA 2XV6A 3DS2A 1VQ7P 4PH0A 2P9XA 1RNIA 1VQOP 2XXMA 2Z44A 3LRYA 1YJWP 1VQNP 2KODA 3G1GA 1Q7YQ 2BUOA 4XRQA 2PEQA 2OARA 3B5IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I55 P;  1VQM P;  1VQ5 P;  1YJN P;  1KQS O;  3CCJ P;  3CC4 P;  3G4S P;  1Q82 Q;  1VQ6 P;  2OTL P;  2QEX P;  1W2B O;  1YIJ P;  1M1K Q;  1VQP P;  3OW2 O;  3G6E P;  1YIT P;  1NJI Q;  3CCQ P;  1K9M Q;  1Q86 Q;  3CCL P;  3G71 P;  2OTJ P;  1VQ7 P;  1VQK P;  2QA4 P;  3CME P;  1S72 P;  1K73 Q;  1M90 Q;  1VQ4 P;  1VQO P;  3CC2 P;  1K8A Q;  1YI2 P;  1VQL P;  3CXC O;  3CD6 P;  1VQ8 P;  1YJW P;  1N8R Q;  1VQ9 P;  3CCE P;  3CCV P;  1VQN P;  1YHQ P;  3I56 P;  1Q7Y Q;  1Q81 Q;  3CCR P;  3CCU P;  1YJ9 P;  3CPW O;  1JJ2 O;  3CMA P;  1KD1 Q;  1KC8 Q;  3CCM P;  3CCS P;  1QVG O;  1QVF O;  3CC7 P; 
#chains in the Genus database with same CATH topology
 2QJY B;  3BRT B;  5AVY B;  2KB7 P;  2JQ4 A;  2KGC A;  4YXD C;  1T2K D;  3FXD A;  5TJH A;  3RK3 C;  2M8N A;  2ZXX A;  5B5E H;  3CXC O;  2KOS A;  4COC A;  1URQ D;  1BXI A;  1OFC X;  3M9B A;  1L0L E;  3QH9 A;  2K88 A;  2FYN B;  1EMV A;  3JCU H;  3EJE A;  4PH1 A;  4WY4 A;  1X9V A;  2ONT A;  3L75 J;  1P84 H;  2AVA A;  2K93 A;  5EJD A;  1DEB A;  2K9Y A;  3TGU J;  1SQX E;  4U3F J;  1RE3 C;  2KGD A;  1VPC A;  2L22 A;  1FZB A;  1H88 A;  3SSU A;  4XE5 B;  3KZI E;  1ZRT E;  4C46 A;  4H13 D;  2D2C D;  2A45 H;  4I7Z B;  2NPS A;  3TGU E;  2NZ2 A;  1K73 Q;  2YXQ B;  3JSV C;  5E79 H;  1L4A D;  2AEF A;  2AXC A;  5HV8 A;  2GA1 A;  1N73 A;  5E79 E;  1MFZ A;  1KZU B;  1RO0 A;  2L4B A;  4HB1 A;  4EDF A;  2QRX A;  3H1H G;  3H6P A;  5AVV B;  3C1L A;  1Y8A A;  3HUS C;  3V2R A;  3L71 D;  1RNI A;  4GKG A;  2ZT9 B;  2FQ0 A;  3H1L G;  1HGV A;  3MHV A;  3FWL A;  3BCC J;  3IF4 A;  1L0N G;  3MGN A;  3V2N A;  4D6T D;  5KAI E;  1ZOY C;  2FVF A;  3AED C;  5BVZ A;  5AW7 B;  3H32 A;  1KLP A;  2O01 H;  2M3B A;  2L5G B;  1X3O A;  1AJY A;  2KG8 A;  2OTK E;  1T6A A;  3RBZ A;  3RBX A;  2GM4 A;  5KLI C;  3A0H E;  1EOQ A;  1ZR4 A;  1S9K D;  1BDC A;  2IX7 C;  1UII A;  5I4T G;  1VQ9 P;  5KJ7 C;  1NYH A;  3TNU A;  2G8Y A;  3V2P A;  4HKZ H;  1DNY A;  5HGM A;  2WQY C;  1PEM A;  1KQL A;  2W90 A;  3CC4 P;  2I1J A;  2OTL P;  1L0N E;  1OW7 A;  2FYZ A;  1KB9 H;  2IYO A;  5AW5 B;  4N78 E;  3W68 A;  1S72 P;  2E75 C;  5CCH D;  2PRR A;  1URQ B;  1SQV G;  1NOH A;  2FQ1 A;  3EFG A;  3RK3 E;  2BCC J;  4PD4 H;  3B71 A;  4PV1 C;  1EIA A;  2W27 A;  1SQB E;  5CMZ A;  2XV6 A;  1GL2 A;  2C0X A;  3A7O A;  4WVZ A;  2B88 A;  1BCC E;  1OZH A;  5CHX A;  1SQQ E;  1GTW A;  1J2J B;  2N50 A;  2W6A A;  2W83 C;  2E74 D;  2SPZ A;  1RQU A;  1SQB J;  2AF8 A;  2N1T C;  4IZ6 A;  3CL3 D;  3G9R A;  4IL6 X;  3PLN A;  1RHZ B;  1L4A B;  1KTM A;  5GTH H;  1JTH A;  1Y47 A;  2WT7 A;  4H44 B;  2ZYA A;  3IFM A;  1ZV8 A;  1HBW A;  2W6J H;  3LIE A;  3AE9 C;  4GOE A;  4BXL A;  2Y0E A;  2JYL A;  2M0B A;  3L75 G;  2BEZ F;  1M1J C;  1FZF A;  1TU3 F;  4I1L A;  4ZKP A;  4BPH A;  1YQ4 C;  1FOS F;  2E75 D;  3P8C E;  2OYI C;  3CCQ P;  1AUM A;  1NGM B;  2CPB A;  2JWD A;  2FYU G;  2C9L Y;  1SQX D;  2KK7 A;  1VQ4 P;  1NTM D;  5GTI H;  4K3A A;  1AVO A;  1GK6 A;  2K0Y A;  2Z5H A;  1PGQ A;  3RG6 C;  1FR2 A;  2K5X A;  1IC2 A;  3HE5 A;  3HD7 A;  1PP9 J;  2KUB A;  2ROQ A;  3WUV A;  2LXB A;  3GF7 A;  1UIX A;  1EZV I;  3RL0 B;  2CQ8 A;  4PWV B;  2XXM A;  3LRY A;  2KOD A;  1ZLL A;  5AVW B;  1SQX G;  2MVV A;  4PV1 B;  2YIU C;  3BAS A;  2LIW A;  2P1J A;  3OW2 O;  4H2Y C;  4IFD K;  3RK2 D;  3L71 G;  3P8M C;  1YTZ T;  2BCC D;  5HVC A;  2R3C A;  2AFE A;  2C0W A;  1N7S B;  1GMJ A;  2PEO A;  3CCS P;  1KOR A;  4H0L D;  3CC7 P;  4H13 C;  3I55 P;  2KLV A;  1YJN P;  4I6M C;  3L35 A;  1RE4 C;  1J1D C;  5KLV E;  2N1T B;  2FYU D;  1XTC C;  1EC5 A;  1NO4 A;  2B89 A;  1N73 C;  1PV3 A;  5CJ4 A;  1MUU A;  1AV1 A;  3A0H H;  3GZM A;  1NU1 G;  3P7K A;  3GLM A;  3CPW O;  3Q3D A;  2QM8 A;  2JO1 A;  1QVF O;  3CWB E;  2IBZ E;  5F2N A;  4YXW H;  1LTG C;  2ZYG A;  5BS2 A;  3GW6 A;  2PP6 A;  2Q1K A;  3L72 J;  1ZW0 A;  4GIF A;  1K30 A;  3BAT A;  1M56 D;  2R32 A;  3H0D A;  1N8R Q;  2N6Z A;  2KSJ A;  4XFZ A;  4TLF A;  3DS0 A;  1NHL A;  2P67 A;  1NTM J;  4RO0 A;  3G4S P;  1DD4 A;  2HPC A;  1KB9 D;  1JUN A;  2A45 G;  4NEO A;  1FJK A;  1HGZ A;  1VF5 D;  5AVQ B;  1SQV D;  3P32 A;  1FZA A;  2Z4E A;  2YMY A;  3AEG C;  1PP9 G;  2MR7 A;  2N1T A;  1Q7Y Q;  3KQG A;  2FYN C;  2XND H;  1VKU A;  3G29 A;  1HQB A;  4BPF A;  3E7K A;  1VDF A;  1X22 A;  1JY2 P;  1VL2 A;  2E42 A;  1BCC D;  2C9N Y;  2ZXE B;  2J58 A;  2X2B A;  3KHU A;  1SFC A;  5CCH A;  1KYO H;  1VQ8 P;  3H1J J;  3H1K D;  4WY4 B;  3R4Y A;  1Q90 D;  2UWJ E;  1PP9 D;  2K0X A;  2JJL A;  3WU2 E;  3HUS A;  2BAS A;  3CX5 D;  1NTK K;  3WUT A;  3NXS A;  1HWT C;  4IPY A;  1NQ4 A;  3H1K G;  1U57 A;  4Z1M H;  2J5U A;  2KW2 A;  1KIL C;  1FZC C;  3CXH D;  1GW4 A;  1MFT A;  2OYH B;  1BCC G;  4PV1 D;  2NPS C;  1NTK E;  3S9O A;  4Y99 B;  2QIW A;  2M8P A;  5APT A;  2GDW A;  2JEE A;  4LC1 A;  5DJU B;  3AEA C;  2H43 A;  1SQB G;  1ZME C;  1QL2 A;  3RK2 B;  2LPK A;  2O1K A;  1HY8 A;  2K3R A;  2LKI A;  3H1L D;  2GZI A;  1K8A Q;  1BE3 G;  1FZE A;  2HPC B;  1PIX A;  1RQV A;  1JJ2 O;  2JGP A;  1E6J P;  2RMZ A;  3H1H E;  4C7N B;  2Z46 A;  3VP9 A;  1LTJ B;  3VMX A;  1FU1 A;  2QEX P;  1E79 H;  2LIU A;  1E5W A;  1AQ5 A;  3E2D A;  2IFN A;  4XFY A;  4DJG A;  1QX8 A;  2KSE A;  2XZR A;  1CEI A;  1KV4 A;  2LR2 A;  2O3J A;  3A0B H;  2FYU K;  2R5D A;  3D6Y A;  3CXH I;  2CNR A;  1SQV J;  1JEK A;  3Q5S A;  2FVE A;  4UB6 E;  4H13 B;  1Y9B A;  4N3Y B;  2IZ1 A;  2Y0D A;  3D71 A;  2JP3 A;  4YTP C;  3AE8 C;  3ZDM A;  3HYB A;  3BVH A;  4MN4 C;  4CA3 A;  1N7S A;  1KYO I;  1ACP A;  2YKO A;  3GJN A;  4GR2 A;  4DOJ A;  2M5A A;  2M8R A;  2IZ0 A;  2KS1 B;  2QA4 P;  2CGQ A;  1S3J A;  4WB4 A;  1X0T A;  5H2F E;  5KKZ B;  2FQ2 A;  3NMD A;  1SQP E;  1VF5 C;  2E5T A;  3G26 A;  3M0A A;  3DS5 A;  3Q20 A;  3H1I G;  5K5G B;  3M0D C;  1LWU C;  2JBG A;  3H1J G;  3OJA B;  1M6E X;  3MGE A;  2FBW C;  2I1K A;  4O9B A;  4H0L C;  2KOP A;  1H8A A;  2OQQ A;  1PL5 A;  4RES B;  2I8D A;  2KI7 B;  1NTM K;  3L73 D;  3TK1 A;  1GL2 D;  2R3S A;  2JKV A;  1E0H A;  4DZO A;  2CK3 H;  4UB8 H;  2B87 B;  1BGY D;  1WT6 A;  4U0A A;  2XKM A;  1EZV G;  3G21 A;  2RH0 A;  1M1J A;  2GUV A;  2VLP A;  3VMZ A;  2G3A A;  5APU A;  1KIL D;  2FAC A;  4M3L A;  1ZR2 A;  2K92 A;  3SWY A;  4H44 C;  1LP1 A;  1URQ A;  1LT9 C;  2MR8 A;  5DJT B;  2E76 C;  2FXM A;  4PD4 D;  2H88 C;  3GMA A;  4OGQ B;  5B5E E;  5CCG A;  3EQ2 A;  2KWL A;  1SQP D;  1D1D A;  4DG9 A;  2O01 J;  1LTS C;  1R5L A;  2DNW A;  4RJT A;  4R4M A;  4U0D A;  1H89 A;  1BAJ A;  2HFE D;  3U1A A;  1NTZ J;  5KAF H;  1U7J A;  1KIL A;  1FZC A;  2XU6 A;  3WU2 H;  3V5B A;  1K9M Q;  1SLQ A;  3U1C A;  4Y28 J;  2Y0C A;  2WSF J;  2PFX A;  3V4Q A;  5KLV G;  1QVG O;  2EFJ A;  2PEK A;  1MKM A;  1VQM P;  1SFC B;  1AQT A;  1USE A;  3L74 E;  1KFM A;  3AE3 C;  1RE3 A;  5TIS E;  4TT3 H;  2BQ1 E;  2WIT A;  2M8L A;  4BPG A;  3H4E A;  3CC2 P;  1YI2 P;  1JTH B;  3H1L J;  2XNX A;  3W67 A;  3AE5 C;  3CCU P;  1T3U A;  2YIU B;  1IO4 A;  5CCH C;  1A02 J;  1MZ9 A;  3KYQ A;  4I2L C;  4DCK A;  3Q5P A;  2WPS A;  1EXI A;  2EHS A;  1VHN A;  3OAK A;  3VMY A;  4GOF A;  1SQB K;  7CEI A;  1BSH A;  1VQO P;  2E76 D;  3EFF K;  1S1C X;  1YJW P;  3SWF A;  3CXH H;  2IDB A;  2PEQ A;  1EDL A;  5APY A;  3HD7 D;  1S4X A;  2KP8 A;  3HUS B;  2RKL A;  3G3Z A;  1VQP P;  2A06 E;  3HE4 B;  2VLQ A;  4EI2 A;  1VQK P;  3G28 A;  1PEU A;  3DS4 A;  4U3F G;  3MIW A;  2OYI A;  2ZYD A;  3KZI H;  3AE4 C;  1GL2 C;  3M06 A;  2JU1 A;  4KT0 J;  1WMK A;  1L0L D;  2DW3 A;  3RK3 D;  5BS1 A;  3IAO A;  4N6J A;  1LWU A;  1GZL A;  1IFM A;  3CCE P;  3WBH A;  4KHX A;  2VLN A;  4I7Z C;  1RE4 A;  4LLH A;  3G1I A;  1P84 D;  1HTL C;  2IPP A;  1KC8 Q;  3CD6 P;  2EIA A;  2ERH A;  2OGU A;  1CZQ A;  2WWW A;  3GKL C;  3PH0 A;  5KLV J;  3CCJ P;  4UHP B;  3VN0 A;  2YO3 A;  2L91 A;  4R4L A;  1N86 A;  3H1J D;  4PD4 I;  2WSS H;  2JYG A;  3JC2 2;  3H1I D;  1GXH A;  1LTA C;  1L0H A;  1RF1 B;  4W80 A;  2Z5I A;  3VP8 A;  3L71 J;  1JCC A;  2WPT A;  2E75 B;  3G6E P;  1DD3 A;  2KOO A;  2N1T D;  5CBO A;  5KJ7 D;  2L9F A;  2WSC H;  1KB9 I;  3L72 G;  3B5N C;  1NU1 K;  5B66 E;  2QJK B;  2FXO A;  2GZE A;  3L71 E;  4YPC A;  2Z45 A;  2ZJS E;  3CWB G;  1Q82 Q;  2LML A;  3M91 A;  1JY3 N;  1IFP A;  2AEM A;  4C7N A;  1BE3 D;  1NU1 E;  3A3Y B;  5AVZ B;  1LTB C;  3PTZ A;  2JAZ A;  2K94 A;  3JCU E;  1YQ3 C;  3B4S A;  1GW3 A;  1JM0 A;  1L0L K;  3L73 J;  4A7P A;  3WUU A;  3VRL C;  1UNK A;  1ZXG A;  3C9I A;  3RK2 C;  1PZQ A;  4GDO A;  2D2C C;  3AEC C;  1JY2 O;  1LGH B;  1PPJ G;  3H1J E;  1BGY J;  5KAF E;  2K9J B;  1FS0 E;  1W2E A;  1F80 D;  5AVU B;  1EQ7 A;  3LW5 J;  1PGJ A;  3CCR P;  1JMM A;  2N5H A;  4F37 A;  1KD1 Q;  1M6N A;  5JPA A;  4JBZ A;  2QNW A;  2V7Q H;  3CX5 E;  3M9H A;  2PNG A;  1M57 D;  2WTY A;  3NTE A;  1WRG A;  2P10 A;  1FDO A;  1SQX J;  4U3F E;  4EYY Q;  4ASW A;  3DTJ A;  1SQB D;  1AA0 A;  5APV A;  1IZN B;  3DS3 A;  4L76 A;  2FFD B;  1LTT C;  1KMI Z;  1NTK D;  1JY2 N;  1G1I A;  3RL0 g;  2LTE A;  1XTG B;  1KYO E;  2A45 I;  1Q2N A;  1OR5 A;  4WY4 D;  2L0Q A;  3H1H J;  1CI6 A;  1EZV E;  3B5I A;  2WSC J;  1OXZ A;  1KQS O;  2E74 C;  4HYT B;  2J59 M;  1LTJ C;  1FBM A;  3GHG A;  1NKN A;  3RL0 C;  2DGY A;  3B5N B;  1S5L H;  1A43 A;  3KXD A;  1P84 I;  4U7J A;  3CME P;  2YKP A;  2FYU E;  5KAI H;  2XDJ A;  3BCC E;  1VF5 B;  4IOI H;  1SQV E;  1T3J A;  1YHQ P;  1SQV K;  4BRY B;  1DH3 A;  3KDP B;  1A8O A;  3E1R A;  4OWF A;  5B66 H;  1QRJ A;  2MF4 A;  1J1E B;  1M7L A;  2YO2 A;  3H25 A;  2FXP A;  1Z6M A;  2OYI B;  3AE2 C;  1L0I A;  2FAD A;  3CWB D;  1YIJ P;  4JQ0 D;  1JY3 P;  2KZI A;  2FYU J;  1S5L X;  1UJZ A;  3AEF C;  1SQP K;  2NRG A;  5KP8 B;  1YJ9 P;  1L4A A;  2W6B A;  3HTK B;  3T97 A;  2AXT E;  1J1D B;  4HKG A;  1L2P A;  1N73 B;  2AXT H;  1RF1 C;  1A02 F;  1RF0 C;  1Q86 Q;  1EZV D;  2R5B A;  2ZAE B;  1P84 E;  2K37 A;  2FHS C;  2KS1 A;  3E1I A;  3HE5 B;  1USD A;  3B8E B;  1G1J A;  1JOC A;  1ZRT D;  1SQQ J;  3CE7 A;  4OGQ C;  1EXJ A;  2Q3E A;  1FDM A;  3MD0 A;  2QE7 H;  2IFM A;  3RG2 A;  2OYH A;  1OW6 A;  3TDK A;  2YKQ A;  1N7S C;  5APS A;  2Z44 A;  1VQN P;  3OA7 A;  2FFD C;  2BCC E;  1AVY A;  3MZW B;  1M8O B;  2WPV B;  1OIP A;  2GDX A;  1KQF B;  1MV8 A;  1HH0 A;  2V4H A;  2MY5 A;  1NTZ E;  3ABV C;  1HUC A;  2JO0 A;  4COP A;  2VRS A;  2PEN A;  1BCC J;  3M0D A;  1IUQ A;  1VQL P;  1KIL E;  1QEX A;  5HGN A;  3HZQ A;  1T2K C;  1SFC C;  2XZ0 D;  5GTH E;  2WMM A;  3S4R A;  1JCD A;  2N9B A;  3H1H D;  4IL6 E;  3G0V A;  2GZF A;  3L75 D;  3LID A;  3L74 J;  2IBZ G;  5EFW B;  2FAE A;  3EJB A;  2E5Y A;  3L36 A;  1W5C E;  1FDI A;  1SQX K;  3CLQ A;  5KP7 B;  3D70 A;  1EDK A;  1FJP A;  1ZN5 A;  4PXH B;  4U0C A;  3L72 D;  1DV5 A;  1LP1 B;  1GD2 E;  3NFQ A;  1W2B O;  1EDJ A;  2EHT A;  1YBK A;  1PPJ D;  3Q2Y A;  1G2C B;  2Q9I A;  2NPS B;  3BRV B;  3D6Z A;  3I56 P;  4Y99 C;  1NTZ D;  4H2W C;  2MKV A;  2N6Y A;  2N5I A;  1PEO A;  1SQQ D;  2PGD A;  4WY4 C;  3FXE A;  2KGA A;  3F89 A;  3G1G A;  4XRQ A;  1SQQ K;  1T8Z A;  1GL2 B;  3CX5 I;  4JYB A;  1OW8 A;  1AF8 A;  1KYO D;  1HVV A;  4ZKU A;  2E43 A;  2PEM A;  1SFC D;  1NTZ K;  2ITA A;  4WWI A;  2KR5 A;  1J1E C;  1L0L G;  1SQQ G;  2WPR A;  4KJM A;  1H0T B;  5KLI B;  1FE6 A;  1KIL B;  3EJD A;  1FZC B;  1H0T A;  2AFD A;  1HJB A;  2PY8 A;  3CCM P;  5KTB A;  3N4X A;  2M5R A;  5KJ7 A;  3CWB J;  4GOD A;  5H2F H;  1CI6 B;  3II6 A;  1L4A C;  4OGQ D;  2XV5 A;  3L74 G;  1IFI A;  1GU5 A;  1N2D C;  3L70 D;  2ZFC A;  1FAV A;  3DS1 A;  3U59 A;  3AE7 C;  4MRT C;  4D6T E;  1EDI A;  5AVT B;  2PAJ A;  3HD7 B;  1FOS E;  3A2A A;  2HOD A;  1S9K E;  4NPF X;  4OH8 B;  1YIT P;  1NTM E;  3A0B E;  1M1J B;  4IL6 H;  2CG5 B;  5BU5 A;  4L74 A;  1LT1 A;  2KOR A;  3MTU E;  4U0B A;  1NTM G;  2RN0 A;  2KOG A;  1ZNV A;  2QJK C;  3CI9 A;  2Q3I A;  3L73 G;  1CSB A;  2L6E A;  4UB6 H;  1L0N D;  3VYI A;  4GT1 A;  3TGU G;  3P8C D;  3B5N A;  1NAY A;  2QJP B;  3O6Q A;  1FC2 C;  2LOL A;  5BU8 B;  2HR3 A;  1QLE D;  2KXP B;  1BSN A;  1IFD A;  4PD4 E;  3RK3 B;  1IFN A;  4R0M A;  3IR9 A;  1VQ7 P;  2POH A;  4BRY A;  2A06 G;  2MVU A;  1PGP A;  5AW2 B;  1X79 B;  1X8Y A;  5DCK A;  3H1I E;  4PJ0 E;  3K5B A;  3UIA A;  3M1M A;  1JNM A;  2HG5 D;  3AE1 C;  4CPG A;  2D2C B;  1AFO A;  2KNC A;  3L70 E;  4XA4 A;  1QGK B;  3CCL P;  1LT9 A;  1NAF A;  2MJZ A;  4PJ0 H;  1IK7 A;  3CCV P;  3FWN A;  2E76 B;  3B4Q A;  3H1I J;  2CWO A;  5KKZ C;  1OVV A;  1SQP G;  3F5H A;  2YMK A;  1NTK J;  3VMA A;  2GUS A;  3USS A;  3G71 P;  4JPZ B;  2Y9Y A;  3GHG B;  3L73 E;  4AYC A;  1L0L J;  1D7M A;  2KNC B;  3GF3 A;  4QMA A;  1OX3 A;  1PGO A;  2AEJ A;  3FGA D;  3FX0 A;  1RY3 A;  3L75 E;  5AW6 B;  3RGU A;  2K1A A;  1L0N K;  1BGY E;  1M1K Q;  2K2Q A;  1NJI Q;  1K04 A;  5APX A;  3H47 A;  1BGY G;  2M3E A;  4NPE A;  2A06 D;  2KG6 A;  2WSE H;  3HD7 C;  3O6Q B;  1Q81 Q;  1JY3 O;  3MUD A;  4L73 A;  5AW8 B;  2E74 B;  3U43 A;  1VQ5 P;  4JYC A;  3HTK A;  2PEI A;  1YYC A;  3S1K A;  1RH5 B;  2WSF H;  1LTJ A;  2M5A B;  1MZ8 A;  2VSQ A;  3SFE C;  3AE6 C;  1VQ6 P;  4QKO A;  2QJP C;  5C39 A;  3H1K E;  4H2X C;  5AW4 B;  2HLO A;  3AEE C;  5AW9 B;  4ZMD A;  3PJS K;  2W8Z A;  2EG5 A;  2K0D X;  3A5T A;  3ITK A;  1Z56 A;  1S2E A;  3H1K J;  4U0E A;  2FFD A;  3V4W A;  2QSI A;  3VTP C;  4XFJ A;  3L37 A;  2FVA A;  1OWA A;  2O01 N;  4RKU J;  1NTZ G;  1NKZ B;  5HGL A;  4C7R A;  2V7Q J;  4HJG H;  4L75 A;  3BCC D;  4EIJ A;  4ZNC A;  1PFI A;  5KLV D;  1NH4 A;  2XT1 A;  5AW0 B;  1SQP J;  1QL1 A;  4UB8 E;  2WT7 B;  1BDD A;  3GHG C;  5HGO A;  3BCC G;  3C8V A;  2QM7 A;  3M9Q A;  2P58 A;  1RF1 A;  4H44 D;  2OYH C;  5AW3 B;  1DX7 A;  1L0N J;  2O1J A;  1KFN A;  1LNQ A;  1S5L E;  4NPD A;  3B5N D;  3T97 B;  1SP4 A;  2FY8 A;  2JU2 A;  3TSI A;  1IMP A;  2R44 A;  2NO8 A;  2KLU A;  2GZG A;  1GPJ A;  1N7S D;  3PRJ A;  1GXG A;  1NU1 D;  2GZJ A;  2HOD B;  2LXC B;  1IJD B;  2BUO A;  2OAR A;  5GTI E;  1GK4 A;  5APW A;  3EWK A;  2GDY A;  3AEB C;  2H8P D;  2JB0 A;  2OYO A;  1RO2 A;  3I5C A;  2QJY C;  1DEE G;  2VLO A;  5EW5 E;  2P2U A;  3V6I A;  2IBZ D;  2Y9Z A;  2KZJ A;  1IFJ A;  1M74 A;  2YXR B;  2H7H A;  2IBZ I;  2K9J A;  3NY7 B;  1DIP A;  4ASV A;  4D6T G;  5CZD B;  3VOP A;  5F2O A;  3RL0 D;  1LJ2 A;  2Q7C A;  4WBA A;  4M0I A;  4AUW A;  4HH2 A;  3LMO A;  1K05 A;  4U3F D;  3TGU D;  4W7Y A;  3Q1M A;  3PP5 A;  3CX5 H;  1FZG A;  2BHV A;  2JR8 A;  1IK9 A;  2WSE J;  3L4F A;  1HJ0 A;  3MUD C;  3WMM 0;  1OVU A;  5AVX B;  5F2K A;  1PP9 E;  3DPH A;  1AYI A;  4OVN F;  4U0F A;  1LWU B;  4LGD E;  2JDI H;  4H0L B;  2LL8 A;  2WZ7 A;  3TYY A;  1JO5 A;  1ZMB A;  2IYP A;  3L70 G;  2LF4 A;  1G2C A;  3KPE A;  3H1L E;  3CXH E;  4PH0 A;  1PPJ E;  4EOT A;  1GU4 A;  3TF5 A;  4IFM A;  3LW5 H;  4DT0 A;  2WPQ A;  3R2P A;  1R5S A;  2Q6Q A;  1RF0 A;  3NTN A;  2E1M A;  2N98 A;  1BE3 J;  3GG2 A;  4XRO A;  5AW1 B;  1N7L A;  2ZVN B;  1PEQ A;  4QNB A;  3TNU B;  2H89 C;  3N7N A;  2OTJ P;  4JF7 A;  1M90 Q;  2QG4 A;  1LT9 B;  2KOQ A;  2Q5U A;  4AQR D;  2KG9 A;  2NPS D;  1BE3 E;  1HF9 A;  5L8R J;  3HE4 A;  2BCC G;  4WYM A;  5M1B A;  2WVR A;  2LKM A;  1U7M A;  3MP7 B;  3GZL A;  1CW5 A;  5AVS B;  1ZP0 C;  3O8Z A;  3V2Q A;  2HYN A;  3QWO C;  3SFD C;  2YNY A;  1LTI C;  5KP6 B;  3HRN A;  1SVF A;  4GR6 A;  2CPS A;  5APQ A;  1OMI A;  2QVA A;  2ZT9 D;  4N78 D;  4XFX A;  1OVR A;  3CMA P;  1KB9 E;  1GDT A;  2ZVO B;  2FKW B;  5KLV K;  2XZ1 C;  4BWN A;  2KIK A;  2MD9 A;  1IMQ A;  1YTZ I;  2JWA A;  5AVR B;  2PEJ A;  2N9Y B;  1KQG B;  5CJ0 A;  2ZT9 C;  3H32 B;  1NWQ A;  1JMB A;  4D6T J;  4K35 A;  3P05 A;  5CCG D;  2KYV A;  2P7J A;  3L74 D;  5CBN A;  1KN7 A;  3SWK A;  2GYK A;  1NTK G;  3L72 E;  4B86 A;  3IN6 A;  2BEQ D;  3PHL A;  3Q5R A;  1URQ C;  1SS1 A;  3DS2 A;  1JB0 J;  1R8E A;  2P9X A;  5TIS H;  2B9B A;  3L70 J;  1NU1 J;  4W7Z A;  2B87 A;  1NVO A;  4IFF A;  5CCG C;  2KGE A;  1T8K A; 
#chains in the Genus database with same CATH homology
 2E1M A;  5DCK A;  2Z45 A;  4XRO A;  3G29 A;  1KQS O;  1Q82 Q;  1VQ6 P;  1PEQ A;  3M1M A;  2PEM A;  4QNB A;  2DGY A;  1VQP P;  3OW2 O;  1A43 A;  2JO0 A;  4COP A;  3CCL P;  2OTJ P;  1D1D A;  2PEN A;  1VQK P;  3G28 A;  2M8N A;  3CME P;  1PEU A;  1M90 Q;  1IUQ A;  3DS4 A;  1VQL P;  1RO2 A;  3CXC O;  1VQ8 P;  4COC A;  3CCV P;  5HGN A;  1YHQ P;  4U0D A;  2CWO A;  1A8O A;  2PEO A;  2PY8 A;  1BAJ A;  3HYB A;  2EG5 A;  3CCM P;  3CCS P;  3HZQ A;  3CC7 P;  3VRL C;  4WYM A;  1QRJ A;  3I55 P;  1YJN P;  4PH1 A;  1M74 A;  1YIJ P;  4U0E A;  2ONT A;  5BS1 A;  1EOQ A;  3G0V A;  4GR2 A;  1K9M Q;  4IPY A;  5F2O A;  3G71 P;  2QA4 P;  4GR6 A;  4M0I A;  5HGL A;  5I4T G;  3CCE P;  3WBH A;  1VQ9 P;  2JYL A;  3DS1 A;  3G26 A;  3CCR P;  1YJ9 P;  3CPW O;  3G1I A;  3DS5 A;  4XFX A;  3CMA P;  2BHV A;  3Q20 A;  1KC8 Q;  3CD6 P;  2EIA A;  1QVG O;  2EFJ A;  1KD1 Q;  5HGM A;  2PEK A;  1QVF O;  1M6N A;  4U0C A;  5JPA A;  1PEM A;  1VQM P;  5F2N A;  1M6E X;  2M8P A;  3CCJ P;  3CC4 P;  3MGE A;  2OTL P;  1W2B O;  1M1K Q;  2XT1 A;  1YIT P;  1NJI Q;  3CCQ P;  1AUM A;  3NTE A;  5BS2 A;  1Q86 Q;  2BQ1 E;  2PEJ A;  3H47 A;  5F2K A;  2M8L A;  3DPH A;  1S72 P;  1K30 A;  3DTJ A;  1K73 Q;  3H4E A;  1VQ4 P;  3CC2 P;  1K8A Q;  1YI2 P;  4U0B A;  3H0D A;  1N8R Q;  4U0F A;  5HGO A;  3P05 A;  3I56 P;  1Q81 Q;  3CCU P;  2JYG A;  1JJ2 O;  4XFZ A;  1E6J P;  2L6E A;  3DS3 A;  3RG6 C;  3DS0 A;  2Z46 A;  1VQ5 P;  4U0A A;  1ZMB A;  3G4S P;  2LF4 A;  1RO0 A;  2QEX P;  3G21 A;  3G6E P;  1EIA A;  3E2D A;  2PEI A;  4XFY A;  1PEO A;  2XV6 A;  3DS2 A;  1VQ7 P;  4PH0 A;  2P9X A;  1RNI A;  1VQO P;  2XXM A;  2Z44 A;  3LRY A;  1YJW P;  1VQN P;  2KOD A;  3G1G A;  1Q7Y Q;  2BUO A;  4XRQ A;  2PEQ A;  2OAR A;  3B5I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...