3OW2O

Crystal structure of enhanced macrolide bound to 50s ribosomal subunit
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAKGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S RIBOSOMAL RNA
total genus 47
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2010-09-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3ow2O03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 3ow2O01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 3ow2O02
1YI2P 2OTLP 3CD6P 3CCVP 1YHQP 1YJWP 3CCEP 1VQ6P 1Q86Q 1NJIQ 1YJ9P 1Q81Q 3G71P 1KQSO 1Q7YQ 3I55P 1K73Q 3CC4P 1K8AQ 3CCUP 3CPWO 2QA4P 3CMAP 3CC7P 1QVGO 3CCQP 1VQLP 1YIJP 1W2BO 1KD1Q 1VQ4P 1VQ8P 1YJNP 1VQKP 1VQNP 3CCMP 3G6EP 3CCRP 1N8RQ 1VQMP 1VQPP 1YITP 1JJ2O 3CC2P 1M90Q 1Q82Q 3CCLP 3CCJP 1VQOP 1S72P 3G4SP 3I56P 2QEXP 1K9MQ 1QVFO 3CCSP 3OW2O 1M1KQ 1KC8Q 1VQ5P 3CXCO 3CMEP 1VQ9P 1VQ7P 2OTJP
chains in the Genus database with same CATH superfamily
5AVWB 2M0BA 4GODA 1FZFA 4F37A 1JOCA 2M8PA 3NFQA 1NTMK 1RF1C 2SPZA 1NU1E 3H1IE 5BVZA 2IX7C 2QJKB 2XNXA 1YITP 1JJ2O 1VDFA 1YQ3C 2VSQA 1L0IA 1PPJD 5CJ4A 1U57A 4A7PA 3U1AA 2ZJSE 5APSA 5GTIE 1QGKB 2KZJA 2FQ0A 2R5DA 3VMYA 2FFDC 2JYGA 2WT7A 1SQQG 1EDKA 3EFGA 2V7QJ 3H1HJ 4H0LC 2L0QA 2PEKA 4U3FJ 2KI7B 1LTJB 1FZGA 2B87B 1BGYJ 5APWA 2Y0EA 3CX5H 7CEIA 3RBZA 1M7LA 2G3AA 1EIAA 4U0CA 4PV1D 1KFMA 1M1JB 5HGOA 2H8PD 4CA3A 2FXMA 1FR2A 1BDDA 2FKWB 1EDJA 1D7MA 1VF5B 4H13C 4XFJA 3EFFK 1AV1A 2RN0A 3H1JE 1AFOA 1VQ5P 1IK9A 2R3CA 3TNUB 2CG5B 1NTZG 2PY8A 1BAJA 5GTHH 1P84D 4IZ6A 3H0DA 2FXOA 2AEJA 1M56D 1CI6B 1IO4A 3HTKB 2K94A 2O01N 2A06D 3GLMA 2FACA 3VN0A 3LW5H 2KG8A 3TGUG 2YXQB 2E76C 1E5WA 1LGHB 5B5EE 3L74E 2QM7A 2ZT9D 1OWAA 1L4AB 3L72D 2XZ1C 1NAYA 2FYUD 2W6AA 4WBAA 4D6TD 1HGVA 3DPHA 1H8AA 2OARA 2C0XA 2IFNA 3TK1A 1PP9J 1ZR4A 5AVVB 1W2EA 2BHVA 4HKZH 3USSA 1JCCA 2GYKA 1HF9A 2HPCA 2MVVA 3V5BA 1IMPA 3M9QA 4Y28J 1SQPD 3D6ZA 2WPRA 1LJ2A 2NPSB 4HYTB 4WWIA 2PEMA 1VQ8P 3G28A 5CBOA 1N8RQ 3AE5C 2N50A 1KILB 4ASVA 3CWBG 3H1KJ 2LR2A 2V7QH 2WSCJ 1SQQE 3HYBA 1ZP0C 4XFXA 4PXHB 1DH3A 1PEOA 4IFDK 1F80D 3CI9A 2PFXA 2QRXA 2XXMA 2KNCA 2YKQA 3CCJP 1VQOP 3JCUH 2KGAA 1PZQA 1R5LA 3L73G 3E1IA 4EOTA 4NPDA 4XFYA 3V4QA 1SS1A 3CE7A 3SFDC 3VMZA 2AFEA 1SQXD 1LT9A 1YIJP 4I6MC 1VQPP 5CBNA 2QE7H 1NTZE 1BCCD 2M5AB 1WRGA 3Q3DA 1S2EA 1ZN5A 2VLPA 2AEFA 3NTNA 4IL6E 2KLVA 5BU8B 4OH8B 2WSEJ 3IFMA 5F2OA 4I1LA 5JPAA 2D2CD 2IBZG 2E5YA 1AQ5A 1JY2O 3CXHD 2R5BA 2QA4P 1BSHA 1PP9E 3CCQP 2P1JA 2FVEA 2XV6A 3B8EB 1N7SB 2PEOA 1A02F 2K92A 1CSBA 1T6AA 4RESB 2WSSH 3R4YA 3TGUE 3RG6C 3B5IA 3I5CA 3C8VA 1PEQA 2BQ1E 2ZVOB 4BWNA 3G29A 5CCHD 3FXDA 1FZCC 1T2KC 1UNKA 5K5GB 2BCCG 2ZFCA 3TDKA 1R8EA 3G26A 3Q5PA 5KAIE 1SFCC 1H89A 3CXCO 3GW6A 1QL2A 2IDBA 1W5CE 1NTMG 5CJ0A 5AW5B 2KIKA 1OFCX 1ZXGA 2E75B 1QLED 2HLOA 1OVUA 3SWFA 3BCCD 1K9MQ 3A5TA 4XFZA 2FYNC 2FHSC 4H2YC 3B5NA 2LPKA 2E74B 1P84I 5DJTB 2WPTA 1NVOA 1HH0A 3M0AA 1GW3A 2JWDA 2LMLA 3CWBE 2WSCH 2QNWA 2I1KA 2JR8A 2DW3A 1BE3G 1RF1B 1CW5A 2MVUA 1NTKK 1S72P 1GU5A 3DS4A 2EG5A 1L0ND 4IL6X 2ROQA 3IR9A 1PGPA 2Y9YA 1AJYA 1QRJA 4U0EA 1JO5A 1LTBC 3UIAA 1H0TA 1EMVA 1IFMA 1EXIA 2K9YA 1JTHA 1PFIA 2CQ8A 2FFDB 3BRTB 1NHLA 1IUQA 1NTKD 2JWAA 4H0LB 4C7NB 1GL2D 1S5LH 1KYOH 5I4TG 2N6ZA 4GKGA 2AEMA 3RL0g 1N86A 4C46A 5AVZB 1GD2E 2JU2A 3FGAD 2WSEH 4K35A 2PP6A 2XV5A 5B66E 2WPVB 2KUBA 1JM0A 1L0LG 2YKOA 4H13B 4WY4C 4L73A 4OWFA 1SQBD 1Y8AA 1X0TA 2QG4A 3H32B 3RK3E 2W6BA 2LIUA 4H44C 3RGUA 5CCGD 4L76A 4Z1MH 2N5IA 2WT7B 1LTIC 1DNYA 3KPEA 2XT1A 3W67A 4R4MA 2KSEA 3QWOC 1JNMA 4W7YA 1KQLA 2JEEA 3Q2YA 3RK3C 2KGDA 2JYLA 2HODB 1X22A 1Z6MA 1WT6A 2E5TA 4UB8E 3HD7C 2FYUJ 1NTME 4D6TJ 3M9BA 3P05A 2FVFA 2E76B 3S9OA 1VF5D 1S9KD 2KG9A 2CPSA 4COPA 2YO3A 2GZIA 2W83C 3OJAB 2HYNA 3M9HA 3CCMP 3L70D 2H7HA 2ONTA 2AVAA 3GJNA 2POHA 1WMKA 1G2CA 1EZVD 1FOSE 3E2DA 1MKMA 1BE3E 3L75G 2K37A 2KOGA 1KQFB 4DZOA 1VQ6P 5AW7B 2QVAA 3LIDA 1LTSC 4TLFA 4WYMA 1QL1A 2Z4EA 5E79E 3A0BE 1Q2NA 2XKMA 1AVOA 1P84E 2M8NA 1DEEG 3II6A 4TT3H 3V2QA 3HUSA 1LTTC 2WSFJ 3L4FA 1DX7A 1T8KA 1JY2P 3T97B 5KJ7D 2N9YB 5AVSB 1YJ9P 1L4AD 1IJDB 2A06E 2QIWA 4H2WC 2W27A 1GXGA 3LRYA 1ZRTD 1PEUA 2XU6A 3N7NA 1SQXJ 3NXSA 4H2XC 5KKZC 1LP1A 1FZAA 2J58A 4L75A 4PD4D 3EJBA 4RO0A 1BCCJ 2DGYA 2HPCB 2YO2A 3A2AA 2GDYA 1L0LE 4JYBA 3AE7C 1KD1Q 2G8YA 4LLHA 3D71A 2C9LY 2P7JA 4OGQC 2L91A 1SQVD 1R5SA 2NPSD 1JB0J 4IFFA 1J1EC 3HUSC 3SWKA 1YI2P 3H1HG 2NO8A 4U3FG 3DS5A 1KILD 3GF3A 1BGYG 3V6IA 1EC5A 3CX5E 5APUA 3CL3D 3MUDA 3M1MA 2KNCB 2Y0CA 1N73C 2RMZA 1NWQA 3PH0A 4R4LA 2JAZA 1S4XA 3PLNA 3LMOA 1URQC 2EIAA 1FZCB 5AW0B 5KLVD 5GTHE 1NO4A 2KS1A 2EHSA 2ZAEB 3BCCJ 1D1DA 1HJBA 1SFCB 3L36A 2JKVA 2OYIA 1HUCA 2KOPA 3D6YA 3VMXA 1IFIA 1PV3A 1GXHA 3L75E 3MUDC 3H4EA 3CCSP 5DCKA 2NRGA 2WZ7A 3HE5A 1N7SD 2DNWA 1HQBA 1BCCE 2K0XA 2FYNB 3RBXA 1NJIQ 2YMYA 1FU1A 4U0FA 3GG2A 3WU2H 3L71D 2WSFH 5CCHA 3E7KA 3F5HA 2KOQA 1VKUA 5H2FH 3VRLC 1PP9G 5HGNA 2WITA 3Q5RA 1A43A 1RNIA 3CCEP 4DT0A 1NTKJ 2FYUK 4AYCA 2OYIC 1IMQA 4ZNCA 2KOSA 1VL2A 2ITAA 2K1AA 2E75D 1IZNB 1JMBA 2GDWA 2OTJP 2FXPA 1YJWP 3CXHH 3H1KG 3A0HH 1IFPA 1SQPK 2E74D 2P58A 4YTPC 3MD0A 1SQBJ 3G1GA 2JBGA 2KP8A 3H1HE 3JC22 4U3FE 1EZVI 4UHPB 2X2BA 1BGYE 1QEXA 1KYOI 4ZKPA 2K93A 2KW2A 3W68A 3MTUE 1LWUA 2K88A 3M91A 3EQ2A 4WY4B 4BRYB 1RQVA 2KXPB 3JCUE 3CC7P 3FWLA 4H44B 3HRNA 1NU1D 3H1ID 3TYYA 3KHUA 1YHQP 5APTA 1RO0A 4IFMA 4DOJA 1GL2A 4H0LD 2HR3A 5BS2A 1A02J 3CCUP 2FBWC 4BXLA 2GM4A 3MGEA 1SQXK 3RK3B 1M6NA 1VQNP 3L35A 4C7RA 4PD4I 3P8CE 3ITKA 3CCLP 3HD7B 1Y47A 4DCKA 3H1LD 2K2QA 2Q1KA 2OYHA 1NTKE 4H13D 2V4HA 2HFED 1JCDA 3CC2P 3M06A 1GZLA 1U7MA 2JB0A 3MHVA 3OW2O 2K9JA 2RKLA 4XA4A 2N1TA 4WB4A 1ZOYC 4ZKUA 3P8MC 2MF4A 2O01J 2FQ1A 1G1IA 1LTJA 3H1JD 1RF0A 1K73Q 3KYQA 2CGQA 3KDPB 5APVA 1FZBA 4HKGA 1OW8A 1JMMA 4N78D 1RE4A 1EOQA 3D70A 3O6QB 5EW5E 3AEGC 1M1JA 3AEDC 2EFJA 2GDXA 2A45H 2FADA 1AA0A 3AEAC 1IFNA 1JUNA 2OYHC 4U0DA 3VOPA 2M5RA 1VPCA 2E76D 3RK2C 2BEQD 1NKNA 2ZXXA 1LT9C 2K3RA 1L2PA 1M90Q 3TNUA 3WUTA 4COCA 3H1KE 1PPJG 2YMKA 4NPFX 5HGMA 3KXDA 1SQVJ 5KKZB 1KFNA 1FDIA 3HTKA 3AEBC 3L74D 2IZ1A 1RF0C 4QMAA 3CPWO 5BS1A 4UB6H 3RL0C 1KTMA 1RE4C 2PNGA 3GZLA 3PJSK 1YBKA 2GZGA 2Z46A 1L0NK 4OGQB 3QH9A 1LT1A 2FVAA 3WBHA 1J1EB 4EI2A 5AW1B 2PGDA 3PHLA 4N6JA 3HUSB 4EIJA 2Q6QA 1K30A 2P10A 3CC4P 4Y99C 3G6EP 1S5LE 1KYOE 3GMAA 1RHZB 1BSNA 1N2DC 1HJ0A 2H88C 1ZV8A 1G1JA 1J2JB 1M74A 3E1RA 1HY8A 5KLVJ 2I8DA 1N73B 2Q7CA 1E0HA 2WVRA 4AUWA 1MFZA 1SQQD 2JDIH 3HZQA 2ZYAA 1URQB 1U7JA 3EWKA 2A06G 3B5NC 1KN7A 3DS0A 1SQBK 4LGDE 1RY3A 2KZIA 3U59A 3Q1MA 3MP7B 1KILA 2WPSA 5AVRB 1CEIA 2BASA 2R3SA 2O01H 2M3BA 3L71J 1KC8Q 3L72G 2GUVA 4AQRD 2FYUG 4D6TG 2L22A 2PEJA 3VTPC 1NTZD 3L37A 3AE9C 1J1DC 1JY3N 4W7ZA 2I1JA 1QX8A 2KSJA 2OGUA 3DS3A 2LKIA 4PD4H 1T2KD 1DEBA 1SQPG 3KZIH 3TSIA 1GK6A 3AE6C 5KAFH 1NKZB 1PPJE 2M5AA 1W2BO 1SFCD 2KG6A 3L72J 3TGUD 2OYIB 4BPHA 1S5LX 2W6JH 2L6EA 3GZMA 3DS1A 4YXWH 2IYPA 1ZLLA 1KMIZ 1N7SA 3HE5B 3PRJA 2KR5A 1GMJA 5AW9B 2LTEA 1EXJA 3AE8C 3U1CA 1OVVA 2K5XA 4I7ZC 1SQPJ 4U0BA 3DS2A 4GR2A 3B4SA 2M8RA 1RE3A 2OTLP 5HV8A 2Y0DA 3CXHI 4DJGA 4XROA 1SQXG 1NU1J 1NOHA 4PV1C 1IK7A 3H1IJ 1BCCG 3EJEA 3Q20A 2VLNA 2GZEA 1T8ZA 1ZMBA 3L71E 4K3AA 3C9IA 3CWBD 1Z56A 2AXTH 1N7LA 1EDLA 1MUUA 3U43A 1FJPA 4LC1A 4KT0J 3H1LJ 4GIFA 1FJKA 2XNDH 2WMMA 1SQVK 1HGZA 1OIPA 1MZ8A 4XE5B 3R2PA 2LXCB 5TISH 1RE3C 3L73D 3VP8A 3ZDMA 3S1KA 1Q86Q 4GDOA 2Z45A 2PEQA 1LWUB 2IPPA 2B89A 5APXA 3L72E 1NH4A 2N9BA 1FBMA 3AE1C 2FYUE 4WY4D 3GHGA 5AW6B 5F2NA 1Q82Q 2KYVA 4D6TE 4W80A 1RH5B 3H1JJ 1QVFO 2CNRA 1S1CX 5AW4B 2MD9A 4IPYA 1AUMA 4H44D 3F89A 2ZT9C 2L4BA 3BVHA 2IBZD 2ZVNB 2FQ2A 2LF4A 3BCCG 3ABVC 1OXZA 1VQLP 1PGOA 3RG2A 1E79H 4C7NA 3NTEA 2W90A 1SQPE 3IN6A 1GW4A 4QNBA 3RK3D 5KLVK 1RO2A 1OW7A 1OX3A 2L5GB 2Q5UA 1KB9H 3HD7D 2K0YA 2OYHB 2H89C 2CWOA 3RK2B 2BCCD 3GHGC 3WUUA 1L0NG 3L74J 3H32A 1LT9B 1KORA 4PJ0E 1K05A 2C0WA 1KV4A 2A45I 3WU2E 1SVFA 1CZQA 2W8ZA 4U7JA 2QJPC 2K9JB 1FZEA 1NTMD 4I2LC 5C39A 2N1TB 3H1LE 5H2FE 5BU5A 1NTKG 2ZYDA 2O3JA 3DTJA 5F2KA 2VLQA 1SQXE 2AXCA 3RL0B 2HODA 3IAOA 5AVTB 2A45G 3H47A 3FX0A 4PJ0H 2Z5IA 1L0NJ 2KOOA 1AYIA 5GTIH 1FC2C 1Y9BA 4Y99B 5AVUB 1BE3D 2PENA 3CXHE 3WUVA 3A0HE 4OVNF 1SQBG 5AVQB 4N78E 1SQQJ 2Z5HA 2WWWA 4PH1A 2J59M 3I55P 1OVRA 1YTZI 4MN4C 1PGJA 2L9FA 2D2CC 2B9BA 3JSVC 5TJHA 1FDOA 1YYCA 2E1MA 1GTWA 2N98A 3MIWA 1L0LK 3HE4A 3CLQA 5AW2B 4OGQD 3B5NB 1T3JA 3AE3C 2WQYC 4ASWA 1KB9D 5CHXA 5KP8B 3FXEA 3TF5A 1VQ4P 1USDA 1NTZJ 5CCHC 5HVCA 2XZRA 4YPCA 2JJLA 3AEEC 3T97A 2LL8A 1L0LD 1HTLC 1NU1K 3A7OA 3BCCE 2KWLA 3CCVP 4GOEA 2MY5A 2B88A 3O8ZA 1IFJA 1Q81Q 2FYZA 1JY3O 1FDMA 3L70G 3C1LA 4RKUJ 1H0TB 1J1DB 2AF8A 2XZ0D 1AVYA 2KODA 1EZVG 1JTHB 1VQ9P 3BATA 3G3ZA 2N6YA 5KP6B 1DV5A 2QJYC 3TGUJ 4WVZA 5B5EH 4KHXA 2YXRB 3CX5D 1NGMB 1URQD 2ZYGA 2WPQA 1L0NE 2OQQA 3G0VA 1Q7YQ 2Y9ZA 3PP5A 1ACPA 3GKLC 2JQ4A 3OA7A 4U0AA 1Q90D 3NY7B 1KLPA 2ZXEB 2YIUC 2Q3IA 4JQ0D 1LWUC 2YKPA 3L70J 2M3EA 2CK3H 2BEZF 2QM8A 5EJDA 1OW6A 1LTGC 5APYA 5HGLA 5M1BA 5CCGA 2E42A 1XTGB 1BDCA 4EDFA 4I7ZB 3M0DA 2IBZI 1GPJA 5AVYB 1ZW0A 3NMDA 3L75D 2MR8A 1GL2C 1FZCA 3CWBJ 2B87A 1SQBE 3A3YB 1SQVG 5KLIC 1EQ7A 1SFCA 4PV1B 1GU4A 1VHNA 5AW8B 1X8YA 2LOLA 3CD6P 4UB6E 1LNQA 3MZWB 4NPEA 3BASA 2QJKC 4O9BA 1UIXA 1SP4A 2R32A 5L8RJ 1JEKA 2VLOA 3L73J 2PRRA 4KJMA 2Q9IA 3V4WA 3S4RA 1HVVA 4N3YB 2LXBA 5CCGC 2BUOA 1VQ7P 3PTZA 3M0DC 1OR5A 1USEA 2N1TC 3FWNA 1CI6A 1XTCC 5AVXB 2LIWA 1G2CB 4IL6H 1LTJC 1IC2A 1S9KE 1FAVA 4GR6A 2VRSA 1FE6A 5KLVG 2P2UA 2R44A 1KZUB 1NAFA 3AEFC 3K5BA 1M1JC 2WTYA 1DD4A 3H1HD 4XRQA 3L70E 1RQUA 4U3FD 1VF5C 1UIIA 1BGYD 1EZVE 4YXDC 2ZT9B 5KJ7A 4RJTA 4EYYQ 1SQQK 1L4AA 2JU1A 4BPFA 3G4SP 4IOIH 4DG9A 3G9RA 3AE4C 2KGCA 2BCCJ 1S3JA 5KAIH 3H6PA 3L71G 1IFDA 1LP1B 1HBWA 1NTMJ 4GOFA 4JYCA 5CZDB 1EDIA 4WY4A 4BRYA 3GHGB 3SWYA 2NPSA 3G21A 2Z44A 1ZRTE 1L0HA 1KB9I 3P8CD 3VYIA 1NTZK 3N4XA 3AECC 4PD4E 3MGNA 2QJPB 3L73E 3V2NA 2UWJE 3CCRP 5KJ7C 2O1JA 2PEIA 2YNYA 2JO0A 5APQA 2P67A 1ZMEC 1L4AC 2IYOA 3SSUA 3SFEC 2NZ2A 1DIPA 3KZIE 2GUSA 4ZMDA 1ZR2A 2J5UA 5KAFE 1BE3J 1SQVE 2KGEA 2IZ0A 1H88A 3KQGA 5CMZA 3VMAA 2KK7A 1KQSO 4QKOA 3HD7A 2IFMA 1ZNVA 1KILE 2QSIA 2IBZE 3CX5I 3CMEP 2GA1A 1GK4A 3RK2D 3P7KA 1PP9D 4B86A 2NPSC 1OMIA 4JPZB 4PWVB 4HH2A 2KS1B 1JY3P 2GZJA 4MRTC 1MZ9A 2N5HA 1NYHA 1KILC 2OTKE 2ERHA 1YQ4C 3LIEA 2OYOA 1A8OA 2N1TD 2JO1A 2QEXP 2H43A 3AE2C 2D2CB 1NU1G 4NEOA 3H1IG 2BCCE 2FY8A 5B66H 1T3UA 3RL0D 5KLVE 1YTZT 3O6QA 3H1KD 1FOSF 1L0LJ 1PIXA 5KTBA 3B71A 2MKVA 1MV8A 3OAKA 2AXTE 3I56P 1AQTA 3H1LG 4L74A 3BRVB 3Q5SA 2P9XA 1KQGB 3GF7A 2FAEA 4HB1A 2E43A 1FS0E 1M57D 2JP3A 1TU3F 1QVGO 4JBZA 1YJNP 1GDTA 5TISE 2RH0A 4JF7A 1VQMP 1M8OB 1M1KQ 1X79B 4UB8H 4M3LA 4GT1A 3V2RA 1PEMA 1K04A 2O1KA 1KYOD 3P32A 3H1JG 3V2PA 3WMM0 3IF4A 1JY2N 2QJYB 3HE4B 1N7SC 1HWTC 2XDJA 1VQKP 4HJGH 5AW3B 2AFDA 1SLQA 2EHTA 3B5ND 2PAJA 2JGPA 4CPGA 4BPGA 1M6EX 2M8LA 4PH0A 2KLUA 2GZFA 1E6JP 1MFTA 2HG5D 2MR7A 2MJZA 1RF1A 2LKMA 2YIUB 3G71P 1UJZA 1LTAC 1PGQA 1K8AQ 1PL5A 1NQ4A 3G1IA 2CPBA 2KORA 2C9NY 3L75J 2KB7P 5E79H 1KB9E 3B4QA 1X9VA 3LW5J 3A0BH 5DJUB 1N73A 5EFWB 2E75C 1P84H 2K0DX 3L74G 1BXIA 2Q3EA 2FFDA 4R0MA 1AF8A 3CMAP 1URQA 3EJDA 1GL2B 1X3OA 5KP7B 2E74C 3H25A 1OZHA 4M0IA 3VP9A 5KLIB 1DD3A
chains in the Genus database with same CATH topology
5DCKA 2P9XA 5HGMA 3G21A 3CD6P 2Z44A 3CCVP 4XFYA 1YHQP 1RO0A 2PEJA 2DGYA 2M8PA 1NJIQ 2JYLA 5BS2A 1Q81Q 4U0FA 3CCUP 3CPWO 3MGEA 1QVGO 5BS1A 1M6NA 1YIJP 1KD1Q 1YJNP 1VQNP 3CCRP 2PEIA 1VQMP 2JO0A 1VQPP 1YITP 3DS3A 1JJ2O 3CCLP 1S72P 3DTJA 3P05A 5F2KA 3DS4A 2EG5A 2KODA 1M1KQ 3VRLC 2BUOA 2Z46A 1VQ9P 1VQ7P 5HGNA 3WBHA 1YI2P 1A43A 3DS5A 1PEMA 5F2OA 4COPA 1RNIA 3H47A 3CCEP 1QRJA 5JPAA 4U0EA 1Q86Q 2Z45A 3DPHA 3G0VA 1KQSO 1K30A 2JYGA 2OARA 2PEQA 1Q7YQ 3CC4P 2QA4P 3CCQP 4GR6A 1W2BO 2XV6A 1VQKP 3CCMP 3G6EP 2BHVA 2PEKA 3CC2P 1IUQA 4U0AA 5F2NA 1Q82Q 2PEOA 2PENA 2ONTA 1QVFO 3OW2O 1M6EX 3CMEP 2L6EA 3M1MA 2OTJP 2M8LA 4IPYA 4PH0A 3DS1A 1E6JP 3E2DA 1AUMA 3RG6C 1EIAA 4U0CA 3B5IA 5I4TG 4XRQA 1M74A 4PH1A 1YJWP 1VQ6P 1PEQA 5HGOA 2BQ1E 3G29A 3G71P 3I55P 1K73Q 4WYMA 1K8AQ 2LF4A 2PEMA 1VQLP 1VQ8P 3G28A 3G1GA 3G1IA 1N8RQ 2EIAA 3NTEA 3HZQA 1EOQA 1A8OA 3G26A 5HGLA 2M8NA 3G4SP 4QNBA 4U0BA 2QEXP 2E1MA 1RO2A 3DS2A 1VQ5P 3CXCO 4GR2A 2EFJA 2OTLP 3DS0A 3HYBA 1D1DA 2PY8A 1BAJA 4XFXA 4XROA 4U0DA 1YJ9P 3H0DA 3CMAP 3CC7P 1PEOA 2CWOA 1VQ4P 3LRYA 3Q20A 2XXMA 1M90Q 1PEUA 4COCA 3CCJP 1ZMBA 1VQOP 1K9MQ 3I56P 3H4EA 2XT1A 4M0IA 3CCSP 4XFZA 1KC8Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YI2 P;  2OTL P;  3CD6 P;  3CCV P;  1YHQ P;  1YJW P;  3CCE P;  1VQ6 P;  1Q86 Q;  1NJI Q;  1YJ9 P;  1Q81 Q;  3G71 P;  1KQS O;  1Q7Y Q;  3I55 P;  1K73 Q;  3CC4 P;  1K8A Q;  3CCU P;  3CPW O;  2QA4 P;  3CMA P;  3CC7 P;  1QVG O;  3CCQ P;  1VQL P;  1YIJ P;  1W2B O;  1KD1 Q;  1VQ4 P;  1VQ8 P;  1YJN P;  1VQK P;  1VQN P;  3CCM P;  3G6E P;  3CCR P;  1N8R Q;  1VQM P;  1VQP P;  1YIT P;  1JJ2 O;  3CC2 P;  1M90 Q;  1Q82 Q;  3CCL P;  3CCJ P;  1VQO P;  1S72 P;  3G4S P;  3I56 P;  2QEX P;  1K9M Q;  1QVF O;  3CCS P;  3OW2 O;  1M1K Q;  1KC8 Q;  1VQ5 P;  3CXC O;  3CME P;  1VQ9 P;  1VQ7 P;  2OTJ P; 
#chains in the Genus database with same CATH topology
 5AVW B;  2M0B A;  4GOD A;  1FZF A;  4F37 A;  1JOC A;  2M8P A;  3NFQ A;  1NTM K;  1RF1 C;  2SPZ A;  1NU1 E;  3H1I E;  5BVZ A;  2IX7 C;  2QJK B;  2XNX A;  1YIT P;  1JJ2 O;  1VDF A;  1YQ3 C;  2VSQ A;  1L0I A;  1PPJ D;  5CJ4 A;  1U57 A;  4A7P A;  3U1A A;  2ZJS E;  5APS A;  5GTI E;  1QGK B;  2KZJ A;  2FQ0 A;  2R5D A;  3VMY A;  2FFD C;  2JYG A;  2WT7 A;  1SQQ G;  1EDK A;  3EFG A;  2V7Q J;  3H1H J;  4H0L C;  2L0Q A;  2PEK A;  4U3F J;  2KI7 B;  1LTJ B;  1FZG A;  2B87 B;  1BGY J;  5APW A;  2Y0E A;  3CX5 H;  7CEI A;  3RBZ A;  1M7L A;  2G3A A;  1EIA A;  4U0C A;  4PV1 D;  1KFM A;  1M1J B;  5HGO A;  2H8P D;  4CA3 A;  2FXM A;  1FR2 A;  1BDD A;  2FKW B;  1EDJ A;  1D7M A;  1VF5 B;  4H13 C;  4XFJ A;  3EFF K;  1AV1 A;  2RN0 A;  3H1J E;  1AFO A;  1VQ5 P;  1IK9 A;  2R3C A;  3TNU B;  2CG5 B;  1NTZ G;  2PY8 A;  1BAJ A;  5GTH H;  1P84 D;  4IZ6 A;  3H0D A;  2FXO A;  2AEJ A;  1M56 D;  1CI6 B;  1IO4 A;  3HTK B;  2K94 A;  2O01 N;  2A06 D;  3GLM A;  2FAC A;  3VN0 A;  3LW5 H;  2KG8 A;  3TGU G;  2YXQ B;  2E76 C;  1E5W A;  1LGH B;  5B5E E;  3L74 E;  2QM7 A;  2ZT9 D;  1OWA A;  1L4A B;  3L72 D;  2XZ1 C;  1NAY A;  2FYU D;  2W6A A;  4WBA A;  4D6T D;  1HGV A;  3DPH A;  1H8A A;  2OAR A;  2C0X A;  2IFN A;  3TK1 A;  1PP9 J;  1ZR4 A;  5AVV B;  1W2E A;  2BHV A;  4HKZ H;  3USS A;  1JCC A;  2GYK A;  1HF9 A;  2HPC A;  2MVV A;  3V5B A;  1IMP A;  3M9Q A;  4Y28 J;  1SQP D;  3D6Z A;  2WPR A;  1LJ2 A;  2NPS B;  4HYT B;  4WWI A;  2PEM A;  1VQ8 P;  3G28 A;  5CBO A;  1N8R Q;  3AE5 C;  2N50 A;  1KIL B;  4ASV A;  3CWB G;  3H1K J;  2LR2 A;  2V7Q H;  2WSC J;  1SQQ E;  3HYB A;  1ZP0 C;  4XFX A;  4PXH B;  1DH3 A;  1PEO A;  4IFD K;  1F80 D;  3CI9 A;  2PFX A;  2QRX A;  2XXM A;  2KNC A;  2YKQ A;  3CCJ P;  1VQO P;  3JCU H;  2KGA A;  1PZQ A;  1R5L A;  3L73 G;  3E1I A;  4EOT A;  4NPD A;  4XFY A;  3V4Q A;  1SS1 A;  3CE7 A;  3SFD C;  3VMZ A;  2AFE A;  1SQX D;  1LT9 A;  1YIJ P;  4I6M C;  1VQP P;  5CBN A;  2QE7 H;  1NTZ E;  1BCC D;  2M5A B;  1WRG A;  3Q3D A;  1S2E A;  1ZN5 A;  2VLP A;  2AEF A;  3NTN A;  4IL6 E;  2KLV A;  5BU8 B;  4OH8 B;  2WSE J;  3IFM A;  5F2O A;  4I1L A;  5JPA A;  2D2C D;  2IBZ G;  2E5Y A;  1AQ5 A;  1JY2 O;  3CXH D;  2R5B A;  2QA4 P;  1BSH A;  1PP9 E;  3CCQ P;  2P1J A;  2FVE A;  2XV6 A;  3B8E B;  1N7S B;  2PEO A;  1A02 F;  2K92 A;  1CSB A;  1T6A A;  4RES B;  2WSS H;  3R4Y A;  3TGU E;  3RG6 C;  3B5I A;  3I5C A;  3C8V A;  1PEQ A;  2BQ1 E;  2ZVO B;  4BWN A;  3G29 A;  5CCH D;  3FXD A;  1FZC C;  1T2K C;  1UNK A;  5K5G B;  2BCC G;  2ZFC A;  3TDK A;  1R8E A;  3G26 A;  3Q5P A;  5KAI E;  1SFC C;  1H89 A;  3CXC O;  3GW6 A;  1QL2 A;  2IDB A;  1W5C E;  1NTM G;  5CJ0 A;  5AW5 B;  2KIK A;  1OFC X;  1ZXG A;  2E75 B;  1QLE D;  2HLO A;  1OVU A;  3SWF A;  3BCC D;  1K9M Q;  3A5T A;  4XFZ A;  2FYN C;  2FHS C;  4H2Y C;  3B5N A;  2LPK A;  2E74 B;  1P84 I;  5DJT B;  2WPT A;  1NVO A;  1HH0 A;  3M0A A;  1GW3 A;  2JWD A;  2LML A;  3CWB E;  2WSC H;  2QNW A;  2I1K A;  2JR8 A;  2DW3 A;  1BE3 G;  1RF1 B;  1CW5 A;  2MVU A;  1NTK K;  1S72 P;  1GU5 A;  3DS4 A;  2EG5 A;  1L0N D;  4IL6 X;  2ROQ A;  3IR9 A;  1PGP A;  2Y9Y A;  1AJY A;  1QRJ A;  4U0E A;  1JO5 A;  1LTB C;  3UIA A;  1H0T A;  1EMV A;  1IFM A;  1EXI A;  2K9Y A;  1JTH A;  1PFI A;  2CQ8 A;  2FFD B;  3BRT B;  1NHL A;  1IUQ A;  1NTK D;  2JWA A;  4H0L B;  4C7N B;  1GL2 D;  1S5L H;  1KYO H;  5I4T G;  2N6Z A;  4GKG A;  2AEM A;  3RL0 g;  1N86 A;  4C46 A;  5AVZ B;  1GD2 E;  2JU2 A;  3FGA D;  2WSE H;  4K35 A;  2PP6 A;  2XV5 A;  5B66 E;  2WPV B;  2KUB A;  1JM0 A;  1L0L G;  2YKO A;  4H13 B;  4WY4 C;  4L73 A;  4OWF A;  1SQB D;  1Y8A A;  1X0T A;  2QG4 A;  3H32 B;  3RK3 E;  2W6B A;  2LIU A;  4H44 C;  3RGU A;  5CCG D;  4L76 A;  4Z1M H;  2N5I A;  2WT7 B;  1LTI C;  1DNY A;  3KPE A;  2XT1 A;  3W67 A;  4R4M A;  2KSE A;  3QWO C;  1JNM A;  4W7Y A;  1KQL A;  2JEE A;  3Q2Y A;  3RK3 C;  2KGD A;  2JYL A;  2HOD B;  1X22 A;  1Z6M A;  1WT6 A;  2E5T A;  4UB8 E;  3HD7 C;  2FYU J;  1NTM E;  4D6T J;  3M9B A;  3P05 A;  2FVF A;  2E76 B;  3S9O A;  1VF5 D;  1S9K D;  2KG9 A;  2CPS A;  4COP A;  2YO3 A;  2GZI A;  2W83 C;  3OJA B;  2HYN A;  3M9H A;  3CCM P;  3L70 D;  2H7H A;  2ONT A;  2AVA A;  3GJN A;  2POH A;  1WMK A;  1G2C A;  1EZV D;  1FOS E;  3E2D A;  1MKM A;  1BE3 E;  3L75 G;  2K37 A;  2KOG A;  1KQF B;  4DZO A;  1VQ6 P;  5AW7 B;  2QVA A;  3LID A;  1LTS C;  4TLF A;  4WYM A;  1QL1 A;  2Z4E A;  5E79 E;  3A0B E;  1Q2N A;  2XKM A;  1AVO A;  1P84 E;  2M8N A;  1DEE G;  3II6 A;  4TT3 H;  3V2Q A;  3HUS A;  1LTT C;  2WSF J;  3L4F A;  1DX7 A;  1T8K A;  1JY2 P;  3T97 B;  5KJ7 D;  2N9Y B;  5AVS B;  1YJ9 P;  1L4A D;  1IJD B;  2A06 E;  2QIW A;  4H2W C;  2W27 A;  1GXG A;  3LRY A;  1ZRT D;  1PEU A;  2XU6 A;  3N7N A;  1SQX J;  3NXS A;  4H2X C;  5KKZ C;  1LP1 A;  1FZA A;  2J58 A;  4L75 A;  4PD4 D;  3EJB A;  4RO0 A;  1BCC J;  2DGY A;  2HPC B;  2YO2 A;  3A2A A;  2GDY A;  1L0L E;  4JYB A;  3AE7 C;  1KD1 Q;  2G8Y A;  4LLH A;  3D71 A;  2C9L Y;  2P7J A;  4OGQ C;  2L91 A;  1SQV D;  1R5S A;  2NPS D;  1JB0 J;  4IFF A;  1J1E C;  3HUS C;  3SWK A;  1YI2 P;  3H1H G;  2NO8 A;  4U3F G;  3DS5 A;  1KIL D;  3GF3 A;  1BGY G;  3V6I A;  1EC5 A;  3CX5 E;  5APU A;  3CL3 D;  3MUD A;  3M1M A;  2KNC B;  2Y0C A;  1N73 C;  2RMZ A;  1NWQ A;  3PH0 A;  4R4L A;  2JAZ A;  1S4X A;  3PLN A;  3LMO A;  1URQ C;  2EIA A;  1FZC B;  5AW0 B;  5KLV D;  5GTH E;  1NO4 A;  2KS1 A;  2EHS A;  2ZAE B;  3BCC J;  1D1D A;  1HJB A;  1SFC B;  3L36 A;  2JKV A;  2OYI A;  1HUC A;  2KOP A;  3D6Y A;  3VMX A;  1IFI A;  1PV3 A;  1GXH A;  3L75 E;  3MUD C;  3H4E A;  3CCS P;  5DCK A;  2NRG A;  2WZ7 A;  3HE5 A;  1N7S D;  2DNW A;  1HQB A;  1BCC E;  2K0X A;  2FYN B;  3RBX A;  1NJI Q;  2YMY A;  1FU1 A;  4U0F A;  3GG2 A;  3WU2 H;  3L71 D;  2WSF H;  5CCH A;  3E7K A;  3F5H A;  2KOQ A;  1VKU A;  5H2F H;  3VRL C;  1PP9 G;  5HGN A;  2WIT A;  3Q5R A;  1A43 A;  1RNI A;  3CCE P;  4DT0 A;  1NTK J;  2FYU K;  4AYC A;  2OYI C;  1IMQ A;  4ZNC A;  2KOS A;  1VL2 A;  2ITA A;  2K1A A;  2E75 D;  1IZN B;  1JMB A;  2GDW A;  2OTJ P;  2FXP A;  1YJW P;  3CXH H;  3H1K G;  3A0H H;  1IFP A;  1SQP K;  2E74 D;  2P58 A;  4YTP C;  3MD0 A;  1SQB J;  3G1G A;  2JBG A;  2KP8 A;  3H1H E;  3JC2 2;  4U3F E;  1EZV I;  4UHP B;  2X2B A;  1BGY E;  1QEX A;  1KYO I;  4ZKP A;  2K93 A;  2KW2 A;  3W68 A;  3MTU E;  1LWU A;  2K88 A;  3M91 A;  3EQ2 A;  4WY4 B;  4BRY B;  1RQV A;  2KXP B;  3JCU E;  3CC7 P;  3FWL A;  4H44 B;  3HRN A;  1NU1 D;  3H1I D;  3TYY A;  3KHU A;  1YHQ P;  5APT A;  1RO0 A;  4IFM A;  4DOJ A;  1GL2 A;  4H0L D;  2HR3 A;  5BS2 A;  1A02 J;  3CCU P;  2FBW C;  4BXL A;  2GM4 A;  3MGE A;  1SQX K;  3RK3 B;  1M6N A;  1VQN P;  3L35 A;  4C7R A;  4PD4 I;  3P8C E;  3ITK A;  3CCL P;  3HD7 B;  1Y47 A;  4DCK A;  3H1L D;  2K2Q A;  2Q1K A;  2OYH A;  1NTK E;  4H13 D;  2V4H A;  2HFE D;  1JCD A;  3CC2 P;  3M06 A;  1GZL A;  1U7M A;  2JB0 A;  3MHV A;  3OW2 O;  2K9J A;  2RKL A;  4XA4 A;  2N1T A;  4WB4 A;  1ZOY C;  4ZKU A;  3P8M C;  2MF4 A;  2O01 J;  2FQ1 A;  1G1I A;  1LTJ A;  3H1J D;  1RF0 A;  1K73 Q;  3KYQ A;  2CGQ A;  3KDP B;  5APV A;  1FZB A;  4HKG A;  1OW8 A;  1JMM A;  4N78 D;  1RE4 A;  1EOQ A;  3D70 A;  3O6Q B;  5EW5 E;  3AEG C;  1M1J A;  3AED C;  2EFJ A;  2GDX A;  2A45 H;  2FAD A;  1AA0 A;  3AEA C;  1IFN A;  1JUN A;  2OYH C;  4U0D A;  3VOP A;  2M5R A;  1VPC A;  2E76 D;  3RK2 C;  2BEQ D;  1NKN A;  2ZXX A;  1LT9 C;  2K3R A;  1L2P A;  1M90 Q;  3TNU A;  3WUT A;  4COC A;  3H1K E;  1PPJ G;  2YMK A;  4NPF X;  5HGM A;  3KXD A;  1SQV J;  5KKZ B;  1KFN A;  1FDI A;  3HTK A;  3AEB C;  3L74 D;  2IZ1 A;  1RF0 C;  4QMA A;  3CPW O;  5BS1 A;  4UB6 H;  3RL0 C;  1KTM A;  1RE4 C;  2PNG A;  3GZL A;  3PJS K;  1YBK A;  2GZG A;  2Z46 A;  1L0N K;  4OGQ B;  3QH9 A;  1LT1 A;  2FVA A;  3WBH A;  1J1E B;  4EI2 A;  5AW1 B;  2PGD A;  3PHL A;  4N6J A;  3HUS B;  4EIJ A;  2Q6Q A;  1K30 A;  2P10 A;  3CC4 P;  4Y99 C;  3G6E P;  1S5L E;  1KYO E;  3GMA A;  1RHZ B;  1BSN A;  1N2D C;  1HJ0 A;  2H88 C;  1ZV8 A;  1G1J A;  1J2J B;  1M74 A;  3E1R A;  1HY8 A;  5KLV J;  2I8D A;  1N73 B;  2Q7C A;  1E0H A;  2WVR A;  4AUW A;  1MFZ A;  1SQQ D;  2JDI H;  3HZQ A;  2ZYA A;  1URQ B;  1U7J A;  3EWK A;  2A06 G;  3B5N C;  1KN7 A;  3DS0 A;  1SQB K;  4LGD E;  1RY3 A;  2KZI A;  3U59 A;  3Q1M A;  3MP7 B;  1KIL A;  2WPS A;  5AVR B;  1CEI A;  2BAS A;  2R3S A;  2O01 H;  2M3B A;  3L71 J;  1KC8 Q;  3L72 G;  2GUV A;  4AQR D;  2FYU G;  4D6T G;  2L22 A;  2PEJ A;  3VTP C;  1NTZ D;  3L37 A;  3AE9 C;  1J1D C;  1JY3 N;  4W7Z A;  2I1J A;  1QX8 A;  2KSJ A;  2OGU A;  3DS3 A;  2LKI A;  4PD4 H;  1T2K D;  1DEB A;  1SQP G;  3KZI H;  3TSI A;  1GK6 A;  3AE6 C;  5KAF H;  1NKZ B;  1PPJ E;  2M5A A;  1W2B O;  1SFC D;  2KG6 A;  3L72 J;  3TGU D;  2OYI B;  4BPH A;  1S5L X;  2W6J H;  2L6E A;  3GZM A;  3DS1 A;  4YXW H;  2IYP A;  1ZLL A;  1KMI Z;  1N7S A;  3HE5 B;  3PRJ A;  2KR5 A;  1GMJ A;  5AW9 B;  2LTE A;  1EXJ A;  3AE8 C;  3U1C A;  1OVV A;  2K5X A;  4I7Z C;  1SQP J;  4U0B A;  3DS2 A;  4GR2 A;  3B4S A;  2M8R A;  1RE3 A;  2OTL P;  5HV8 A;  2Y0D A;  3CXH I;  4DJG A;  4XRO A;  1SQX G;  1NU1 J;  1NOH A;  4PV1 C;  1IK7 A;  3H1I J;  1BCC G;  3EJE A;  3Q20 A;  2VLN A;  2GZE A;  1T8Z A;  1ZMB A;  3L71 E;  4K3A A;  3C9I A;  3CWB D;  1Z56 A;  2AXT H;  1N7L A;  1EDL A;  1MUU A;  3U43 A;  1FJP A;  4LC1 A;  4KT0 J;  3H1L J;  4GIF A;  1FJK A;  2XND H;  2WMM A;  1SQV K;  1HGZ A;  1OIP A;  1MZ8 A;  4XE5 B;  3R2P A;  2LXC B;  5TIS H;  1RE3 C;  3L73 D;  3VP8 A;  3ZDM A;  3S1K A;  1Q86 Q;  4GDO A;  2Z45 A;  2PEQ A;  1LWU B;  2IPP A;  2B89 A;  5APX A;  3L72 E;  1NH4 A;  2N9B A;  1FBM A;  3AE1 C;  2FYU E;  4WY4 D;  3GHG A;  5AW6 B;  5F2N A;  1Q82 Q;  2KYV A;  4D6T E;  4W80 A;  1RH5 B;  3H1J J;  1QVF O;  2CNR A;  1S1C X;  5AW4 B;  2MD9 A;  4IPY A;  1AUM A;  4H44 D;  3F89 A;  2ZT9 C;  2L4B A;  3BVH A;  2IBZ D;  2ZVN B;  2FQ2 A;  2LF4 A;  3BCC G;  3ABV C;  1OXZ A;  1VQL P;  1PGO A;  3RG2 A;  1E79 H;  4C7N A;  3NTE A;  2W90 A;  1SQP E;  3IN6 A;  1GW4 A;  4QNB A;  3RK3 D;  5KLV K;  1RO2 A;  1OW7 A;  1OX3 A;  2L5G B;  2Q5U A;  1KB9 H;  3HD7 D;  2K0Y A;  2OYH B;  2H89 C;  2CWO A;  3RK2 B;  2BCC D;  3GHG C;  3WUU A;  1L0N G;  3L74 J;  3H32 A;  1LT9 B;  1KOR A;  4PJ0 E;  1K05 A;  2C0W A;  1KV4 A;  2A45 I;  3WU2 E;  1SVF A;  1CZQ A;  2W8Z A;  4U7J A;  2QJP C;  2K9J B;  1FZE A;  1NTM D;  4I2L C;  5C39 A;  2N1T B;  3H1L E;  5H2F E;  5BU5 A;  1NTK G;  2ZYD A;  2O3J A;  3DTJ A;  5F2K A;  2VLQ A;  1SQX E;  2AXC A;  3RL0 B;  2HOD A;  3IAO A;  5AVT B;  2A45 G;  3H47 A;  3FX0 A;  4PJ0 H;  2Z5I A;  1L0N J;  2KOO A;  1AYI A;  5GTI H;  1FC2 C;  1Y9B A;  4Y99 B;  5AVU B;  1BE3 D;  2PEN A;  3CXH E;  3WUV A;  3A0H E;  4OVN F;  1SQB G;  5AVQ B;  4N78 E;  1SQQ J;  2Z5H A;  2WWW A;  4PH1 A;  2J59 M;  3I55 P;  1OVR A;  1YTZ I;  4MN4 C;  1PGJ A;  2L9F A;  2D2C C;  2B9B A;  3JSV C;  5TJH A;  1FDO A;  1YYC A;  2E1M A;  1GTW A;  2N98 A;  3MIW A;  1L0L K;  3HE4 A;  3CLQ A;  5AW2 B;  4OGQ D;  3B5N B;  1T3J A;  3AE3 C;  2WQY C;  4ASW A;  1KB9 D;  5CHX A;  5KP8 B;  3FXE A;  3TF5 A;  1VQ4 P;  1USD A;  1NTZ J;  5CCH C;  5HVC A;  2XZR A;  4YPC A;  2JJL A;  3AEE C;  3T97 A;  2LL8 A;  1L0L D;  1HTL C;  1NU1 K;  3A7O A;  3BCC E;  2KWL A;  3CCV P;  4GOE A;  2MY5 A;  2B88 A;  3O8Z A;  1IFJ A;  1Q81 Q;  2FYZ A;  1JY3 O;  1FDM A;  3L70 G;  3C1L A;  4RKU J;  1H0T B;  1J1D B;  2AF8 A;  2XZ0 D;  1AVY A;  2KOD A;  1EZV G;  1JTH B;  1VQ9 P;  3BAT A;  3G3Z A;  2N6Y A;  5KP6 B;  1DV5 A;  2QJY C;  3TGU J;  4WVZ A;  5B5E H;  4KHX A;  2YXR B;  3CX5 D;  1NGM B;  1URQ D;  2ZYG A;  2WPQ A;  1L0N E;  2OQQ A;  3G0V A;  1Q7Y Q;  2Y9Z A;  3PP5 A;  1ACP A;  3GKL C;  2JQ4 A;  3OA7 A;  4U0A A;  1Q90 D;  3NY7 B;  1KLP A;  2ZXE B;  2YIU C;  2Q3I A;  4JQ0 D;  1LWU C;  2YKP A;  3L70 J;  2M3E A;  2CK3 H;  2BEZ F;  2QM8 A;  5EJD A;  1OW6 A;  1LTG C;  5APY A;  5HGL A;  5M1B A;  5CCG A;  2E42 A;  1XTG B;  1BDC A;  4EDF A;  4I7Z B;  3M0D A;  2IBZ I;  1GPJ A;  5AVY B;  1ZW0 A;  3NMD A;  3L75 D;  2MR8 A;  1GL2 C;  1FZC A;  3CWB J;  2B87 A;  1SQB E;  3A3Y B;  1SQV G;  5KLI C;  1EQ7 A;  1SFC A;  4PV1 B;  1GU4 A;  1VHN A;  5AW8 B;  1X8Y A;  2LOL A;  3CD6 P;  4UB6 E;  1LNQ A;  3MZW B;  4NPE A;  3BAS A;  2QJK C;  4O9B A;  1UIX A;  1SP4 A;  2R32 A;  5L8R J;  1JEK A;  2VLO A;  3L73 J;  2PRR A;  4KJM A;  2Q9I A;  3V4W A;  3S4R A;  1HVV A;  4N3Y B;  2LXB A;  5CCG C;  2BUO A;  1VQ7 P;  3PTZ A;  3M0D C;  1OR5 A;  1USE A;  2N1T C;  3FWN A;  1CI6 A;  1XTC C;  5AVX B;  2LIW A;  1G2C B;  4IL6 H;  1LTJ C;  1IC2 A;  1S9K E;  1FAV A;  4GR6 A;  2VRS A;  1FE6 A;  5KLV G;  2P2U A;  2R44 A;  1KZU B;  1NAF A;  3AEF C;  3K5B A;  1M1J C;  2WTY A;  1DD4 A;  3H1H D;  4XRQ A;  3L70 E;  1RQU A;  4U3F D;  1VF5 C;  1UII A;  1BGY D;  1EZV E;  4YXD C;  2ZT9 B;  5KJ7 A;  4RJT A;  4EYY Q;  1SQQ K;  1L4A A;  2JU1 A;  4BPF A;  3G4S P;  4IOI H;  4DG9 A;  3G9R A;  3AE4 C;  2KGC A;  2BCC J;  1S3J A;  5KAI H;  3H6P A;  3L71 G;  1IFD A;  1LP1 B;  1HBW A;  1NTM J;  4GOF A;  4JYC A;  5CZD B;  1EDI A;  4WY4 A;  4BRY A;  3GHG B;  3SWY A;  2NPS A;  3G21 A;  2Z44 A;  1ZRT E;  1L0H A;  1KB9 I;  3P8C D;  3VYI A;  1NTZ K;  3N4X A;  3AEC C;  4PD4 E;  3MGN A;  2QJP B;  3L73 E;  3V2N A;  2UWJ E;  3CCR P;  5KJ7 C;  2O1J A;  2PEI A;  2YNY A;  2JO0 A;  5APQ A;  2P67 A;  1ZME C;  1L4A C;  2IYO A;  3SSU A;  3SFE C;  2NZ2 A;  1DIP A;  3KZI E;  2GUS A;  4ZMD A;  1ZR2 A;  2J5U A;  5KAF E;  1BE3 J;  1SQV E;  2KGE A;  2IZ0 A;  1H88 A;  3KQG A;  5CMZ A;  3VMA A;  2KK7 A;  1KQS O;  4QKO A;  3HD7 A;  2IFM A;  1ZNV A;  1KIL E;  2QSI A;  2IBZ E;  3CX5 I;  3CME P;  2GA1 A;  1GK4 A;  3RK2 D;  3P7K A;  1PP9 D;  4B86 A;  2NPS C;  1OMI A;  4JPZ B;  4PWV B;  4HH2 A;  2KS1 B;  1JY3 P;  2GZJ A;  4MRT C;  1MZ9 A;  2N5H A;  1NYH A;  1KIL C;  2OTK E;  2ERH A;  1YQ4 C;  3LIE A;  2OYO A;  1A8O A;  2N1T D;  2JO1 A;  2QEX P;  2H43 A;  3AE2 C;  2D2C B;  1NU1 G;  4NEO A;  3H1I G;  2BCC E;  2FY8 A;  5B66 H;  1T3U A;  3RL0 D;  5KLV E;  1YTZ T;  3O6Q A;  3H1K D;  1FOS F;  1L0L J;  1PIX A;  5KTB A;  3B71 A;  2MKV A;  1MV8 A;  3OAK A;  2AXT E;  3I56 P;  1AQT A;  3H1L G;  4L74 A;  3BRV B;  3Q5S A;  2P9X A;  1KQG B;  3GF7 A;  2FAE A;  4HB1 A;  2E43 A;  1FS0 E;  1M57 D;  2JP3 A;  1TU3 F;  1QVG O;  4JBZ A;  1YJN P;  1GDT A;  5TIS E;  2RH0 A;  4JF7 A;  1VQM P;  1M8O B;  1M1K Q;  1X79 B;  4UB8 H;  4M3L A;  4GT1 A;  3V2R A;  1PEM A;  1K04 A;  2O1K A;  1KYO D;  3P32 A;  3H1J G;  3V2P A;  3WMM 0;  3IF4 A;  1JY2 N;  2QJY B;  3HE4 B;  1N7S C;  1HWT C;  2XDJ A;  1VQK P;  4HJG H;  5AW3 B;  2AFD A;  1SLQ A;  2EHT A;  3B5N D;  2PAJ A;  2JGP A;  4CPG A;  4BPG A;  1M6E X;  2M8L A;  4PH0 A;  2KLU A;  2GZF A;  1E6J P;  1MFT A;  2HG5 D;  2MR7 A;  2MJZ A;  1RF1 A;  2LKM A;  2YIU B;  3G71 P;  1UJZ A;  1LTA C;  1PGQ A;  1K8A Q;  1PL5 A;  1NQ4 A;  3G1I A;  2CPB A;  2KOR A;  2C9N Y;  3L75 J;  2KB7 P;  5E79 H;  1KB9 E;  3B4Q A;  1X9V A;  3LW5 J;  3A0B H;  5DJU B;  1N73 A;  5EFW B;  2E75 C;  1P84 H;  2K0D X;  3L74 G;  1BXI A;  2Q3E A;  2FFD A;  4R0M A;  1AF8 A;  3CMA P;  1URQ A;  3EJD A;  1GL2 B;  1X3O A;  5KP7 B;  2E74 C;  3H25 A;  1OZH A;  4M0I A;  3VP9 A;  5KLI B;  1DD3 A; 
#chains in the Genus database with same CATH homology
 5DCK A;  2P9X A;  5HGM A;  3G21 A;  3CD6 P;  2Z44 A;  3CCV P;  4XFY A;  1YHQ P;  1RO0 A;  2PEJ A;  2DGY A;  2M8P A;  1NJI Q;  2JYL A;  5BS2 A;  1Q81 Q;  4U0F A;  3CCU P;  3CPW O;  3MGE A;  1QVG O;  5BS1 A;  1M6N A;  1YIJ P;  1KD1 Q;  1YJN P;  1VQN P;  3CCR P;  2PEI A;  1VQM P;  2JO0 A;  1VQP P;  1YIT P;  3DS3 A;  1JJ2 O;  3CCL P;  1S72 P;  3DTJ A;  3P05 A;  5F2K A;  3DS4 A;  2EG5 A;  2KOD A;  1M1K Q;  3VRL C;  2BUO A;  2Z46 A;  1VQ9 P;  1VQ7 P;  5HGN A;  3WBH A;  1YI2 P;  1A43 A;  3DS5 A;  1PEM A;  5F2O A;  4COP A;  1RNI A;  3H47 A;  3CCE P;  1QRJ A;  5JPA A;  4U0E A;  1Q86 Q;  2Z45 A;  3DPH A;  3G0V A;  1KQS O;  1K30 A;  2JYG A;  2OAR A;  2PEQ A;  1Q7Y Q;  3CC4 P;  2QA4 P;  3CCQ P;  4GR6 A;  1W2B O;  2XV6 A;  1VQK P;  3CCM P;  3G6E P;  2BHV A;  2PEK A;  3CC2 P;  1IUQ A;  4U0A A;  5F2N A;  1Q82 Q;  2PEO A;  2PEN A;  2ONT A;  1QVF O;  3OW2 O;  1M6E X;  3CME P;  2L6E A;  3M1M A;  2OTJ P;  2M8L A;  4IPY A;  4PH0 A;  3DS1 A;  1E6J P;  3E2D A;  1AUM A;  3RG6 C;  1EIA A;  4U0C A;  3B5I A;  5I4T G;  4XRQ A;  1M74 A;  4PH1 A;  1YJW P;  1VQ6 P;  1PEQ A;  5HGO A;  2BQ1 E;  3G29 A;  3G71 P;  3I55 P;  1K73 Q;  4WYM A;  1K8A Q;  2LF4 A;  2PEM A;  1VQL P;  1VQ8 P;  3G28 A;  3G1G A;  3G1I A;  1N8R Q;  2EIA A;  3NTE A;  3HZQ A;  1EOQ A;  1A8O A;  3G26 A;  5HGL A;  2M8N A;  3G4S P;  4QNB A;  4U0B A;  2QEX P;  2E1M A;  1RO2 A;  3DS2 A;  1VQ5 P;  3CXC O;  4GR2 A;  2EFJ A;  2OTL P;  3DS0 A;  3HYB A;  1D1D A;  2PY8 A;  1BAJ A;  4XFX A;  4XRO A;  4U0D A;  1YJ9 P;  3H0D A;  3CMA P;  3CC7 P;  1PEO A;  2CWO A;  1VQ4 P;  3LRY A;  3Q20 A;  2XXM A;  1M90 Q;  1PEU A;  4COC A;  3CCJ P;  1ZMB A;  1VQO P;  1K9M Q;  3I56 P;  3H4E A;  2XT1 A;  4M0I A;  3CCS P;  4XFZ A;  1KC8 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...