3OW2O

Crystal structure of enhanced macrolide bound to 50s ribosomal subunit
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAKGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RIBOSOMAL RNA
molecule tags Ribosome
total genus 47
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2010-09-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3ow2O03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 3ow2O01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 3ow2O02
3G71P 3CCSP 3G6EP 3CC4P 3CCQP 1YJ9P 1VQ9P 3CMAP 3CC7P 3OW2O 1YJWP 1VQKP 1YI2P 1KC8Q 3CCRP 3CPWO 1QVGO 3CCUP 1M1KQ 1KQSO 1VQLP 1VQMP 3CCJP 3I55P 3CMEP 1VQ8P 2QA4P 2OTLP 2QEXP 1VQ5P 1W2BO 3CXCO 3I56P 1YITP 1VQ6P 1N8RQ 1VQNP 1JJ2O 1NJIQ 1YIJP 2OTJP 1K8AQ 1S72P 1K9MQ 1VQ7P 1Q7YQ 3CD6P 3CCMP 1YJNP 1K73Q 3CCEP 1M90Q 3CC2P 1Q81Q 1Q86Q 1VQ4P 3CCVP 3CCLP 1QVFO 1KD1Q 1Q82Q 1YHQP 1VQOP 1VQPP 3G4SP
chains in the Genus database with same CATH superfamily
1AUMA 2FBWC 4H44B 4GOEA 1M1KQ 3H1JJ 5AVUB 1E6JP 1LT9A 2QA4P 1SQPG 1ZMEC 1J1DC 3DPHA 3P7KA 3M0DC 1BGYJ 3VMZA 1JCDA 2D2CD 3NY7B 1AFOA 1SFCA 3GHGB 4HYTB 4I1LA 1GU4A 3MIWA 1D7MA 4ZNCA 1IFJA 1GK6A 1SVFA 2HLOA 1ZLLA 3PHLA 3MZWB 2E5YA 4GODA 1VHNA 2FXMA 3KZIH 2QJPC 1KILD 1HBWA 2Y0CA 3L71E 1EDIA 1OW8A 1AJYA 3VOPA 3A7OA 2AXTE 3ABVC 2KB7P 2PENA 1NTMK 3KPEA 2PY8A 2ZYGA 3HUSA 1VF5C 1P84D 4Z1MH 3TNUA 1N7SB 1BXIA 3OJAB 1CZQA 1M1JC 2YIUC 3EQ2A 2CQ8A 3CX5E 1NAFA 2BCCJ 1SQBE 3WU2H 1DEEG 3L75G 1JO5A 2WSCJ 1IFMA 2QJYB 5KKZC 1ZV8A 1GW4A 2M5RA 2JGPA 4ASWA 1VPCA 4WY4D 2K5XA 5GTIH 3H1HE 1L0LG 2RKLA 3RK3E 1DV5A 1SQPD 2R5DA 2QVAA 3E1RA 3PJSK 4Y28J 2VSQA 3CCMP 2P10A 5B66E 1BDDA 3G21A 3HD7B 2N5IA 1Z56A 2OYOA 2XZRA 1KZUB 2B87B 2O3JA 3CCJP 2OTLP 3B5NB 2ROQA 3RL0C 3LMOA 4U0FA 4W80A 4RKUJ 3U59A 4HJGH 1KLPA 1L4AB 3P8MC 1A02F 4JYBA 2GM4A 1SQXG 1LTGC 5BS1A 3L4FA 2HFED 3EJBA 1FC2C 1NTMG 2K9JA 2N1TA 1RF1C 3O8ZA 1N73C 1UIXA 2JU1A 1H8AA 4NPEA 2FVEA 3CXHD 2FQ2A 4QNBA 1FZCC 1BSNA 5AVSB 3DTJA 1SQQD 5TISH 2M0BA 2IZ1A 3BVHA 1SQVJ 1GL2B 3SWFA 2M3BA 1LTIC 5KLVG 1NO4A 1PEUA 1UIIA 3D6YA 3L36A 2FYUE 1ZRTD 2KWLA 3GJNA 2PGDA 2K0DX 2FYNC 1JNMA 2E75C 3DS1A 1DH3A 2ONTA 2PNGA 3CE7A 1FR2A 2QM8A 1KYOD 2ZFCA 1S5LE 2OYIC 5TJHA 2MKVA 1LP1B 3CWBD 2HPCB 1QVFO 1URQA 2K3RA 1NTMD 2ZT9B 3L71G 2KR5A 4H13D 1A02J 1KB9E 1EDLA 1G2CB 1NKZB 3D70A 3B8EB 3CCEP 1EDJA 3V2RA 1VL2A 2KYVA 3CMAP 3H1LJ 2QNWA 4YXWH 2ZYAA 1RO2A 5K5GB 5BU8B 2N9YB 2KOQA 1AVYA 2LIWA 2NPSC 3L73D 4C46A 4BRYA 3OA7A 2QIWA 2QM7A 3H1HG 3A2AA 3HRNA 2OQQA 2KIKA 5KAIE 5AW4B 1BE3E 1RY3A 4W7YA 4H44D 2AXCA 4HH2A 2N6ZA 2ZXEB 2JDIH 4NEOA 2O01H 5AW2B 2EG5A 2H88C 4O9BA 2EFJA 3L70E 2I8DA 1KC8Q 2X2BA 2D2CB 3G1IA 2BHVA 1EZVD 2K2QA 1HGVA 2WSSH 2IBZD 5CZDB 1DNYA 4GIFA 2FKWB 1M1JA 2W8ZA 4YPCA 5KJ7C 4NPDA 3TNUB 1KMIZ 2WT7A 2OARA 2QJKB 2CPSA 2PRRA 4IOIH 1SQPJ 1JMBA 3TGUE 5APSA 3AE5C 5B5EE 3EJEA 5F2OA 3AE1C 1ZR2A 2G3AA 3H1JD 1N7SD 2ZYDA 4M3LA 1YQ4C 2IPPA 1JY2O 5HGMA 1BGYD 2JBGA 1FOSF 2LKIA 3BRTB 4L76A 4H0LC 3BCCG 5APYA 4K3AA 2Q6QA 2FYUG 2W6AA 2GUVA 4XA4A 3A5TA 1RH5B 1NU1E 3EFFK 2K0XA 3B4QA 2C9LY 3H1IE 3HE5A 1TU3F 3KZIE 2L6EA 3HD7D 5BVZA 2P2UA 3L75J 2MR8A 2D2CC 4U0AA 3HE4A 3NFQA 1M74A 2P7JA 1R8EA 5AVYB 2KODA 3H4EA 3B5ND 2KOOA 2K37A 2BCCD 4JYCA 2K9JB 3WU2E 1W5CE 2ZXXA 4A7PA 1L0LJ 2BQ1E 1JB0J 3AECC 1XTCC 2EIAA 1KILC 3AE8C 1JOCA 2JYLA 4EDFA 3H32B 2Z4EA 3V4QA 5CBOA 1OX3A 5GTIE 1IJDB 1U7JA 1KQGB 1JTHA 2W6BA 2Q3IA 3FX0A 1NH4A 3BCCD 1VQPP 2RMZA 2GZGA 4U0BA 3G6EP 2H7HA 2FY8A 1YYCA 4RO0A 1PPJD 2YXRB 3QWOC 5DJTB 1VQ8P 5L8RJ 1FAVA 1LT1A 3H6PA 2KOGA 1GL2D 2O01N 2OYHB 1SQXJ 2NO8A 1IK7A 3MD0A 2OYIA 3L72E 1NTMJ 2R44A 4WY4C 3M9HA 1MZ9A 1IFDA 1YHQP 1JM0A 5BS2A 2WITA 2WPQA 1BE3G 2WSFJ 1N86A 1IK9A 3CCUP 2J5UA 1KQSO 3G3ZA 3AEEC 4U0CA 2Q9IA 3FXEA 3VN0A 1PFIA 1URQB 1NYHA 3L70G 3L35A 2JP3A 3FGAD 1X3OA 4JF7A 2L4BA 1Q82Q 1LTTC 3S4RA 5KLVJ 1OFCX 2L5GB 2M8RA 5TISE 5M1BA 4U3FE 1W2BO 2JO1A 1U7MA 2ZT9D 1GPJA 2AEJA 1ZNVA 2NPSA 1RF0C 4ZKUA 1T3JA 3G1GA 3S9OA 5CCHA 1L0HA 3A3YB 3JC22 5APUA 1VQMP 1PGJA 3L74E 1EDKA 5F2NA 5DCKA 1AF8A 2A06E 3GKLC 4PD4D 5AW5B 3LRYA 1DIPA 3L71J 3Q5SA 3N7NA 1YTZI 2JWDA 1FJPA 3DS4A 1NU1G 2QEXP 3FWNA 2KGCA 4N78E 3ZDMA 3H1IG 3I5CA 4KT0J 3VMAA 2FFDA 1RE4A 2B9BA 3JCUH 3L70D 1RE3A 2HYNA 3O6QB 1OZHA 2IYOA 5APTA 3G28A 1LTJC 3LIEA 1M56D 1P84I 3NTEA 1L0LK 1A43A 5AVXB 2M3EA 2O1KA 3H1LD 3N4XA 1NTKE 1ACPA 3H1HJ 2V7QH 3PTZA 2LR2A 1OW7A 2L9FA 1USDA 2KS1A 4L75A 2YMKA 1VQOP 4H13C 1NKNA 3EWKA 4U0EA 2KZIA 1HJBA 3U1AA 1J2JB 2J59M 3R4YA 1AQTA 3L37A 2K1AA 2DW3A 4I7ZC 1SQXK 2LXCB 4H2XC 1PZQA 3A0HH 3P8CE 1DD4A 1P84H 1PP9D 4L74A 3AE6C 1T3UA 5KLIC 1LWUC 2XNXA 3HZQA 2XXMA 4LC1A 2AF8A 3HE5B 3L72G 1K8AQ 1OR5A 1HTLC 2KGEA 3RK3B 2P58A 2E5TA 4N6JA 4UB8E 2Y0EA 2Q3EA 3M0AA 5CMZA 3IR9A 2KORA 2WSEJ 4H44C 5KLVK 2W27A 1YBKA 4CA3A 1F80D 1JJ2O 3CXHI 3HYBA 1XTGB 2E42A 3EJDA 3GHGC 5KAFE 3MGEA 3BCCJ 1ZP0C 1X8YA 1MZ8A 2QSIA 4GDOA 2YKOA 3BATA 3IFMA 2FQ0A 3SWYA 2MR7A 2FYUJ 4KHXA 2N1TD 2Q7CA 1N7LA 3CMEP 1J1EB 1VQ5P 1EC5A 1FZAA 1SP4A 4L73A 3MUDC 1X0TA 1QGKB 5APQA 4MN4C 1LTBC 3L74G 1OIPA 3P32A 1KYOI 3WUVA 2FQ1A 2AEMA 1N7SC 1QL1A 1Y47A 3CXHH 5CHXA 1HWTC 2A06G 2JWAA 2GYKA 3L75D 3B71A 4ZKPA 1CI6B 3SFEC 1RQVA 5HGNA 2G8YA 2QJYC 2KGAA 1HUCA 3IAOA 1SQBK 2Z44A 3WMM0 5HGOA 3AEAC 1CEIA 4R4LA 2XKMA 1MKMA 1L0LD 1ZR4A 2VRSA 2N9BA 4WVZA 1M6EX 2KNCA 2YNYA 3HD7C 1WRGA 1URQD 3NXSA 1ZXGA 1M8OB 5AW6B 2GZIA 1KYOH 2HODB 4XFYA 2UWJE 1NTKG 3B5NC 4RJTA 1HQBA 1L4AC 1BE3J 1KN7A 5AVRB 4HKZH 1SQXD 3CCLP 1LGHB 2IFNA 3AE3C 5AW3B 3V2NA 4K35A 3NTNA 3B5IA 4WB4A 3L70J 1G1IA 4D6TE 1PGPA 2QG4A 1GU5A 2K92A 5APXA 4COCA 1S9KD 3T97A 1E5WA 4R4MA 3RBXA 1CW5A 5AVQB 4F37A 2WQYC 2C0XA 2HG5D 2DNWA 4GT1A 2Q5UA 4EIJA 1GL2C 1SQBG 2FFDB 1LTJA 3MTUE 1EZVI 3BRVB 5KLVD 1AVOA 2IBZI 2E76D 3KQGA 1UNKA 4GR2A 1SQVE 4WWIA 1FJKA 3M0DA 2JO0A 1M7LA 1LT9B 3DS3A 1GMJA 1S2EA 1IFIA 1HF9A 2FYUK 2A45I 1SFCB 2JU2A 1Y9BA 2ZVNB 2WVRA 4JBZA 1N8RQ 5CCGD 2KS1B 3H47A 3KYQA 1PP9J 3SWKA 1VQ4P 5E79H 1KV4A 4OGQB 1JUNA 3FWLA 3DS0A 1VQLP 2I1KA 2ZT9C 1KORA 1H0TA 3L71D 2OGUA 5H2FE 4UB8H 2WPRA 3H1KE 1LWUA 1IMQA 2JEEA 2XZ0D 1YJNP 1BCCE 3G9RA 3HUSB 3CC2P 3LW5H 4BXLA 1L0NE 2WPSA 3JCUE 3CX5D 1SQBD 2A45H 3AEBC 4QMAA 4C7NA 5KAFH 3G0VA 2KSEA 1FZEA 2O1JA 2N50A 4ASVA 4B86A 1ZN5A 1M90Q 1NOHA 1IFNA 3F5HA 3E1IA 1LT9C 3H1HD 2CGQA 2CG5B 3RK3D 2Y0DA 2JQ4A 2MF4A 1GW3A 5CJ4A 4XFXA 1NVOA 3V2PA 3WBHA 3DS5A 1VQNP 1DX7A 1YIJP 2KG6A 1KILE 4YTPC 1QX8A 4Y99B 4QKOA 3L72J 3A0HE 3KDPB 5AW7B 4ZMDA 2YKPA 1P84E 1T6AA 2IZ0A 5I4TG 1RF1A 2OTJP 2L0QA 2WPTA 1VQ7P 3TDKA 1JEKA 2WSCH 1N73A 1FZBA 1VDFA 2N1TB 2QJKC 4EOTA 1FZCA 4D6TG 4IFDK 1FZGA 3TYYA 3F89A 3Q1MA 4TLFA 1NWQA 1OVRA 2B88A 4KJMA 1SQPE 2SPZA 2KP8A 1Q7YQ 2BUOA 2YO2A 1PGOA 2XV6A 2B89A 3HTKA 3G29A 1T2KD 2PEMA 3W67A 1QEXA 1X22A 1S3JA 2VLOA 2FYUD 1K9MQ 3B5NA 3VYIA 1PEOA 1IZNB 4PWVB 1L4AA 3TK1A 2POHA 4GR6A 2LKMA 1KFMA 1NU1K 1T8ZA 5KTBA 3CXCO 3I56P 2VLNA 3RBZA 1HJ0A 3GZLA 2LOLA 4PV1B 1JY3N 1A8OA 2FVFA 4PD4I 2KW2A 3CXHE 7CEIA 2LF4A 2N1TC 1QLED 3Q5RA 1QL2A 3G4SP 1SQQE 2QE7H 4DOJA 5CCHD 1KB9D 1YI2P 3H1KG 2GZJA 1M6NA 1LJ2A 2JJLA 2PAJA 1BCCG 1NGMB 3TF5A 5C39A 1L0NG 3TGUG 5AVWB 1ZRTE 1NTKJ 2PEKA 4PJ0H 3CPWO 1QVGO 3AEFC 1J1DB 2FACA 1UJZA 2KGDA 4BRYB 4PH1A 1KYOE 1N2DC 5DJUB 2OYHC 4PD4H 2M8PA 2IX7C 1HGZA 1X79B 1HVVA 2BEZF 4UB6H 2PEIA 2Z46A 1LP1A 3CWBE 3NMDA 4DG9A 1FS0E 5H2FH 1BE3D 3VTPC 2E76B 1OXZA 1RHZB 1NTZE 1VQ6P 2QJPB 1K30A 1OWAA 2AEFA 5KP6B 3PRJA 1SFCD 2O01J 1URQC 3A0BH 3AEDC 1KTMA 5F2KA 5EFWB 1SQBJ 2BEQD 2YMYA 3CCQP 5KJ7A 2P9XA 4AQRD 3H1KD 1M1JB 2YIUB 1QRJA 2KG9A 2NRGA 3Q20A 4OGQD 3EFGA 4PH0A 5APVA 2K93A 5HV8A 2WT7B 3IN6A 1PGQA 3GZMA 4R0MA 3TGUD 3L73E 5KKZB 2N5HA 2Z5HA 2KOSA 2PEOA 1OVUA 4XFJA 3SFDC 4IZ6A 2MY5A 2PFXA 4GOFA 5GTHE 1EIAA 1H88A 4IL6X 1JY2P 5AW1B 2E43A 1Q86Q 2JAZA 3U43A 4JQ0D 2H89C 1Q2NA 2DGYA 2E76C 2KG8A 5E79E 3I55P 3RL0B 2K88A 2E1MA 1USEA 1YITP 1NU1D 3M9QA 2XDJA 3H1ID 4IL6H 4WYMA 2XU6A 1EZVE 4RESB 5AVVB 3DS2A 2KOPA 2IBZE 3PLNA 4XFZA 1NTZK 2XT1A 1KQLA 4NPFX 1KD1Q 1D1DA 1SLQA 3HE4B 2P1JA 1KFNA 1YJWP 1RF1B 5CCGC 2LXBA 1NQ4A 3AE4C 1Y8AA 1N73B 1GK4A 1SS1A 3V6IA 1KILA 1FZCB 1K73Q 3G26A 4H2WC 1SQQG 5AVZB 3H1JE 4W7ZA 2CWOA 1GXGA 1BGYE 3RK2D 4M0IA 4U3FG 3RG2A 2GZEA 1NTKK 5EW5E 3M9BA 1E79H 1EMVA 2MVVA 2GA1A 2KLVA 1JTHB 3HTKB 3WUUA 3B4SA 2K0YA 2FYNB 2E75B 1FZFA 1CSBA 1K05A 4WY4A 2FXPA 4EI2A 2ITAA 4DT0A 2OYIB 2PP6A 3L72D 3V4WA 3CWBG 3RK3C 2XV5A 1EXIA 2FYZA 2JKVA 1PV3A 4AYCA 4D6TJ 2BCCE 1NTZG 4GKGA 5CJ0A 4JPZB 4U0DA 4BWNA 3P05A 3AE9C 4HB1A 3VMXA 4PXHB 2WPVB 3H32A 4DCKA 2CK3H 5CBNA 2XZ1C 4PV1D 4DJGA 2LMLA 4U3FD 3W68A 1U57A 1VQKP 1RF0A 2E74D 2KLUA 3BCCE 4YXDC 1J1EC 1JY3P 1RQUA 1YQ3C 1PPJE 2NPSB 1DEBA 3L73G 3CI9A 1H89A 2ZAEB 3E2DA 1GXHA 3VP9A 1MFTA 3RGUA 2OYHA 1R5LA 1LTSC 2R32A 2I1JA 2VLQA 3L74D 1YJ9P 2EHTA 3CC7P 3LIDA 2WSFH 1WT6A 3WUTA 1AQ5A 5AW8B 1BDCA 2A06D 1MV8A 2KI7B 2GUSA 3H25A 2W6JH 1T2KC 3MP7B 2W83C 1NTZD 3H1KJ 2QRXA 3VRLC 2VLPA 2GDWA 2WZ7A 3C9IA 2M5AA 1BCCJ 1VKUA 4N78D 2RH0A 1EZVG 1JMMA 4UHPB 2C9NY 2IBZG 2R3SA 1L0NJ 2CNRA 3TGUJ 3Q5PA 1PL5A 1WMKA 3RL0g 1BAJA 2N6YA 2FAEA 2FVAA 3AE2C 1FDIA 4LLHA 2ZJSE 3CX5I 3AEGC 5KP7B 5GTHH 1JCCA 2A45G 2AVAA 2ZVOB 1NTKD 1VF5D 2AFEA 2JR8A 2V7QJ 3H1JG 3GLMA 1EQ7A 2PEQA 1NHLA 1X9VA 4PJ0E 2WTYA 1BSHA 1BGYG 2IYPA 5CCHC 1ZW0A 4H0LB 2FHSC 1T8KA 4BPGA 4PD4E 1NU1J 4I2LC 4EYYQ 3R2PA 2K94A 2YXQB 2WWWA 3H1IJ 3KHUA 4UB6E 2AXTH 3KXDA 1ZMBA 4N3YB 1FE6A 3P8CD 3FXDA 4BPHA 3CCVP 1JY2N 5BU5A 3CX5H 2Z5IA 3A0BE 3IF4A 2KXPB 2R3CA 2M8LA 3O6QA 5HVCA 2FFDC 2LTEA 1RE4C 2EHSA 1RNIA 1PIXA 1RE3C 5CCGA 4IPYA 3Q3DA 3RL0D 2BCCG 2YKQA 3ITKA 3H1LE 1FU1A 1HH0A 1PEQA 1Q90D 3GHGA 2RN0A 1MFZA 1AV1A 1KILB 1SQVK 5KP8B 2KZJA 3VMYA 5B66H 1KQFB 1SFCC 1OMIA 1RO0A 5EJDA 1YTZT 4TT3H 3USSA 2IDBA 1EXJA 1AA0A 1S72P 1S1CX 2KUBA 3QH9A 4I6MC 3MUDA 1M57D 4OGQC 1PPJG 1K04A 1PP9E 4OH8B 1GZLA 2JYGA 4COPA 1HY8A 1FBMA 1N7SA 5JPAA 3GF3A 2J58A 3RK2B 4WY4B 3C8VA 1IC2A 3HUSC 1EOQA 4IL6E 3U1CA 1G1JA 3CCRP 3CD6P 4OVNF 1IMPA 2E75D 2C0WA 2JB0A 2WSEH 1L0IA 1SQQJ 1IFPA 1S4XA 4LGDE 2M8NA 3V2QA 1L0NK 3D6ZA 4U3FJ 3CL3D 1L4AD 2H43A 2W90A 2GDYA 2OTKE 5AW9B 4H2YC 2ERHA 1S5LX 2R5BA 1KB9I 3CC4P 3H0DA 1LTAC 3HD7A 1E0HA 4IFFA 2KK7A 1SQVG 2KNCB 1ZOYC 3E7KA 1NJIQ 3M91A 2B87A 3L74J 4OWFA 5AW0B 1S5LH 1NAYA 3G71P 3CCSP 3OW2O 4Y99C 2MJZA 2N98A 1R5SA 2CPBA 2AFDA 2Z45A 1FDOA 3GF7A 3CWBJ 2HR3A 1GD2E 1Z6MA 1NTZJ 2V4HA 5HGLA 3RK2C 3L75E 3TSIA 2NPSD 2LL8A 2E74B 3JSVC 3PH0A 1KB9H 4DZOA 3C1LA 1CI6A 2L91A 2WMMA 1IO4A 3RG6C 4HKGA 4D6TD 3BASA 3S1KA 1AYIA 2IFMA 3T97B 1OW6A 1GL2A 2LPKA 1L0LE 4WBAA 4BPFA 2M5AB 3CLQA 2Q1KA 1LTJB 2MD9A 4MRTC 1FDMA 3GMAA 1VQ9P 1SQPK 3Q2YA 3L73J 1SQVD 1JY3O 3H1LG 4CPGA 3D71A 1IUQA 2HODA 3SSUA 1GTWA 5AVTB 4XROA 3II6A 5KAIH 1OVVA 2GDXA 2BASA 1LNQA 4H13B 3GG2A 1GDTA 5KJ7D 2K9YA 2NZ2A 2YO3A 1FOSE 1SQXE 2LIUA 4XRQA 2H8PD 3MHVA 3M06A 2HPCA 1NTME 2PEJA 4I7ZB 1PEMA 2Y9YA 4PV1C 1DD3A 3PP5A 3M1MA 1G2CA 2E74C 3K5BA 2KSJA 1H0TB 2GZFA 1S9KE 1PP9G 4AUWA 3VP8A 1VF5B 3AE7C 5KLIB 1LWUB 4H0LD 1L2PA 2P67A 4C7RA 4U7JA 2FXOA 1BCCD 2XNDH 3OAKA 3UIAA 2L22A 4XE5B 5KLVE 2Y9ZA 1SQQK 3MGNA 3GW6A 4IFMA 1Q81Q 1MUUA 2FADA 3LW5J 3V5BA 1L0ND 1W2EA 2MVUA 5B5EH 4C7NB 5APWA
chains in the Genus database with same CATH topology
1AUMA 4U0BA 2PEKA 2DGYA 3G6EP 3RG6C 4XFYA 3DS0A 4U0DA 3CPWO 1QVGO 1M1KQ 1VQLP 1E6JP 3I55P 3CCJP 2OTLP 2JYGA 3DS4A 2QA4P 1VQ8P 2QEXP 2E1MA 3DPHA 3P05A 4U0FA 1YITP 4COPA 5F2OA 1JJ2O 3HYBA 4PH1A 4WYMA 2PEQA 1Q7YQ 5JPAA 3DS2A 1YJNP 2M8PA 3MGEA 5HGMA 3CCEP 4XFZA 2BUOA 1EOQA 2XT1A 5BS1A 2XV6A 3G28A 1KD1Q 2PEIA 3CCLP 3CC2P 1YHQP 2Z46A 5BS2A 1D1DA 3G29A 1VQ9P 3CMAP 3NTEA 1YJWP 1VQKP 2PEMA 3CCRP 3CD6P 3CCUP 1KQSO 3CMEP 1A43A 1RO2A 3B5IA 1VQ5P 1VQ6P 4U0CA 3G0VA 1ZMBA 1K30A 1IUQA 2M8NA 1K9MQ 4QNBA 1PEOA 1K73Q 3G26A 4COCA 4XROA 1M90Q 3DTJA 3E2DA 5F2KA 3CCVP 2CWOA 2PENA 1Q82Q 4GR6A 1VQOP 4M0IA 3CC4P 2PY8A 3CCQP 1YJ9P 3CC7P 2L6EA 2M8LA 3H0DA 4U0EA 4XRQA 2P9XA 4XFXA 4U0AA 1QRJA 1W2BO 3CXCO 3Q20A 3WBHA 3I56P 1RNIA 3DS5A 1PEUA 1M74A 4PH0A 2PEJA 4IPYA 1VQNP 1NJIQ 4GR2A 1PEMA 2KODA 3H4EA 1YIJP 1A8OA 3M1MA 2JO0A 5HGNA 1PEQA 2LF4A 2EG5A 3DS3A 2EFJA 2Z44A 2PEOA 3DS1A 3VRLC 3G4SP 3G71P 3CCSP 5HGOA 2BQ1E 3G1GA 3OW2O 1YI2P 2ONTA 1KC8Q 2EIAA 3G1IA 1VQMP 1M6NA 3HZQA 2XXMA 2BHVA 2Z45A 2JYLA 1N8RQ 1RO0A 5F2NA 1EIAA 5DCKA 5I4TG 3H47A 2OTJP 1K8AQ 1S72P 1VQ7P 1M6EX 3CCMP 1BAJA 5HGLA 1Q81Q 3G21A 1Q86Q 1VQ4P 2OARA 3LRYA 1QVFO 1VQPP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G71 P;  3CCS P;  3G6E P;  3CC4 P;  3CCQ P;  1YJ9 P;  1VQ9 P;  3CMA P;  3CC7 P;  3OW2 O;  1YJW P;  1VQK P;  1YI2 P;  1KC8 Q;  3CCR P;  3CPW O;  1QVG O;  3CCU P;  1M1K Q;  1KQS O;  1VQL P;  1VQM P;  3CCJ P;  3I55 P;  3CME P;  1VQ8 P;  2QA4 P;  2OTL P;  2QEX P;  1VQ5 P;  1W2B O;  3CXC O;  3I56 P;  1YIT P;  1VQ6 P;  1N8R Q;  1VQN P;  1JJ2 O;  1NJI Q;  1YIJ P;  2OTJ P;  1K8A Q;  1S72 P;  1K9M Q;  1VQ7 P;  1Q7Y Q;  3CD6 P;  3CCM P;  1YJN P;  1K73 Q;  3CCE P;  1M90 Q;  3CC2 P;  1Q81 Q;  1Q86 Q;  1VQ4 P;  3CCV P;  3CCL P;  1QVF O;  1KD1 Q;  1Q82 Q;  1YHQ P;  1VQO P;  1VQP P;  3G4S P; 
#chains in the Genus database with same CATH topology
 1AUM A;  2FBW C;  4H44 B;  4GOE A;  1M1K Q;  3H1J J;  5AVU B;  1E6J P;  1LT9 A;  2QA4 P;  1SQP G;  1ZME C;  1J1D C;  3DPH A;  3P7K A;  3M0D C;  1BGY J;  3VMZ A;  1JCD A;  2D2C D;  3NY7 B;  1AFO A;  1SFC A;  3GHG B;  4HYT B;  4I1L A;  1GU4 A;  3MIW A;  1D7M A;  4ZNC A;  1IFJ A;  1GK6 A;  1SVF A;  2HLO A;  1ZLL A;  3PHL A;  3MZW B;  2E5Y A;  4GOD A;  1VHN A;  2FXM A;  3KZI H;  2QJP C;  1KIL D;  1HBW A;  2Y0C A;  3L71 E;  1EDI A;  1OW8 A;  1AJY A;  3VOP A;  3A7O A;  2AXT E;  3ABV C;  2KB7 P;  2PEN A;  1NTM K;  3KPE A;  2PY8 A;  2ZYG A;  3HUS A;  1VF5 C;  1P84 D;  4Z1M H;  3TNU A;  1N7S B;  1BXI A;  3OJA B;  1CZQ A;  1M1J C;  2YIU C;  3EQ2 A;  2CQ8 A;  3CX5 E;  1NAF A;  2BCC J;  1SQB E;  3WU2 H;  1DEE G;  3L75 G;  1JO5 A;  2WSC J;  1IFM A;  2QJY B;  5KKZ C;  1ZV8 A;  1GW4 A;  2M5R A;  2JGP A;  4ASW A;  1VPC A;  4WY4 D;  2K5X A;  5GTI H;  3H1H E;  1L0L G;  2RKL A;  3RK3 E;  1DV5 A;  1SQP D;  2R5D A;  2QVA A;  3E1R A;  3PJS K;  4Y28 J;  2VSQ A;  3CCM P;  2P10 A;  5B66 E;  1BDD A;  3G21 A;  3HD7 B;  2N5I A;  1Z56 A;  2OYO A;  2XZR A;  1KZU B;  2B87 B;  2O3J A;  3CCJ P;  2OTL P;  3B5N B;  2ROQ A;  3RL0 C;  3LMO A;  4U0F A;  4W80 A;  4RKU J;  3U59 A;  4HJG H;  1KLP A;  1L4A B;  3P8M C;  1A02 F;  4JYB A;  2GM4 A;  1SQX G;  1LTG C;  5BS1 A;  3L4F A;  2HFE D;  3EJB A;  1FC2 C;  1NTM G;  2K9J A;  2N1T A;  1RF1 C;  3O8Z A;  1N73 C;  1UIX A;  2JU1 A;  1H8A A;  4NPE A;  2FVE A;  3CXH D;  2FQ2 A;  4QNB A;  1FZC C;  1BSN A;  5AVS B;  3DTJ A;  1SQQ D;  5TIS H;  2M0B A;  2IZ1 A;  3BVH A;  1SQV J;  1GL2 B;  3SWF A;  2M3B A;  1LTI C;  5KLV G;  1NO4 A;  1PEU A;  1UII A;  3D6Y A;  3L36 A;  2FYU E;  1ZRT D;  2KWL A;  3GJN A;  2PGD A;  2K0D X;  2FYN C;  1JNM A;  2E75 C;  3DS1 A;  1DH3 A;  2ONT A;  2PNG A;  3CE7 A;  1FR2 A;  2QM8 A;  1KYO D;  2ZFC A;  1S5L E;  2OYI C;  5TJH A;  2MKV A;  1LP1 B;  3CWB D;  2HPC B;  1QVF O;  1URQ A;  2K3R A;  1NTM D;  2ZT9 B;  3L71 G;  2KR5 A;  4H13 D;  1A02 J;  1KB9 E;  1EDL A;  1G2C B;  1NKZ B;  3D70 A;  3B8E B;  3CCE P;  1EDJ A;  3V2R A;  1VL2 A;  2KYV A;  3CMA P;  3H1L J;  2QNW A;  4YXW H;  2ZYA A;  1RO2 A;  5K5G B;  5BU8 B;  2N9Y B;  2KOQ A;  1AVY A;  2LIW A;  2NPS C;  3L73 D;  4C46 A;  4BRY A;  3OA7 A;  2QIW A;  2QM7 A;  3H1H G;  3A2A A;  3HRN A;  2OQQ A;  2KIK A;  5KAI E;  5AW4 B;  1BE3 E;  1RY3 A;  4W7Y A;  4H44 D;  2AXC A;  4HH2 A;  2N6Z A;  2ZXE B;  2JDI H;  4NEO A;  2O01 H;  5AW2 B;  2EG5 A;  2H88 C;  4O9B A;  2EFJ A;  3L70 E;  2I8D A;  1KC8 Q;  2X2B A;  2D2C B;  3G1I A;  2BHV A;  1EZV D;  2K2Q A;  1HGV A;  2WSS H;  2IBZ D;  5CZD B;  1DNY A;  4GIF A;  2FKW B;  1M1J A;  2W8Z A;  4YPC A;  5KJ7 C;  4NPD A;  3TNU B;  1KMI Z;  2WT7 A;  2OAR A;  2QJK B;  2CPS A;  2PRR A;  4IOI H;  1SQP J;  1JMB A;  3TGU E;  5APS A;  3AE5 C;  5B5E E;  3EJE A;  5F2O A;  3AE1 C;  1ZR2 A;  2G3A A;  3H1J D;  1N7S D;  2ZYD A;  4M3L A;  1YQ4 C;  2IPP A;  1JY2 O;  5HGM A;  1BGY D;  2JBG A;  1FOS F;  2LKI A;  3BRT B;  4L76 A;  4H0L C;  3BCC G;  5APY A;  4K3A A;  2Q6Q A;  2FYU G;  2W6A A;  2GUV A;  4XA4 A;  3A5T A;  1RH5 B;  1NU1 E;  3EFF K;  2K0X A;  3B4Q A;  2C9L Y;  3H1I E;  3HE5 A;  1TU3 F;  3KZI E;  2L6E A;  3HD7 D;  5BVZ A;  2P2U A;  3L75 J;  2MR8 A;  2D2C C;  4U0A A;  3HE4 A;  3NFQ A;  1M74 A;  2P7J A;  1R8E A;  5AVY B;  2KOD A;  3H4E A;  3B5N D;  2KOO A;  2K37 A;  2BCC D;  4JYC A;  2K9J B;  3WU2 E;  1W5C E;  2ZXX A;  4A7P A;  1L0L J;  2BQ1 E;  1JB0 J;  3AEC C;  1XTC C;  2EIA A;  1KIL C;  3AE8 C;  1JOC A;  2JYL A;  4EDF A;  3H32 B;  2Z4E A;  3V4Q A;  5CBO A;  1OX3 A;  5GTI E;  1IJD B;  1U7J A;  1KQG B;  1JTH A;  2W6B A;  2Q3I A;  3FX0 A;  1NH4 A;  3BCC D;  1VQP P;  2RMZ A;  2GZG A;  4U0B A;  3G6E P;  2H7H A;  2FY8 A;  1YYC A;  4RO0 A;  1PPJ D;  2YXR B;  3QWO C;  5DJT B;  1VQ8 P;  5L8R J;  1FAV A;  1LT1 A;  3H6P A;  2KOG A;  1GL2 D;  2O01 N;  2OYH B;  1SQX J;  2NO8 A;  1IK7 A;  3MD0 A;  2OYI A;  3L72 E;  1NTM J;  2R44 A;  4WY4 C;  3M9H A;  1MZ9 A;  1IFD A;  1YHQ P;  1JM0 A;  5BS2 A;  2WIT A;  2WPQ A;  1BE3 G;  2WSF J;  1N86 A;  1IK9 A;  3CCU P;  2J5U A;  1KQS O;  3G3Z A;  3AEE C;  4U0C A;  2Q9I A;  3FXE A;  3VN0 A;  1PFI A;  1URQ B;  1NYH A;  3L70 G;  3L35 A;  2JP3 A;  3FGA D;  1X3O A;  4JF7 A;  2L4B A;  1Q82 Q;  1LTT C;  3S4R A;  5KLV J;  1OFC X;  2L5G B;  2M8R A;  5TIS E;  5M1B A;  4U3F E;  1W2B O;  2JO1 A;  1U7M A;  2ZT9 D;  1GPJ A;  2AEJ A;  1ZNV A;  2NPS A;  1RF0 C;  4ZKU A;  1T3J A;  3G1G A;  3S9O A;  5CCH A;  1L0H A;  3A3Y B;  3JC2 2;  5APU A;  1VQM P;  1PGJ A;  3L74 E;  1EDK A;  5F2N A;  5DCK A;  1AF8 A;  2A06 E;  3GKL C;  4PD4 D;  5AW5 B;  3LRY A;  1DIP A;  3L71 J;  3Q5S A;  3N7N A;  1YTZ I;  2JWD A;  1FJP A;  3DS4 A;  1NU1 G;  2QEX P;  3FWN A;  2KGC A;  4N78 E;  3ZDM A;  3H1I G;  3I5C A;  4KT0 J;  3VMA A;  2FFD A;  1RE4 A;  2B9B A;  3JCU H;  3L70 D;  1RE3 A;  2HYN A;  3O6Q B;  1OZH A;  2IYO A;  5APT A;  3G28 A;  1LTJ C;  3LIE A;  1M56 D;  1P84 I;  3NTE A;  1L0L K;  1A43 A;  5AVX B;  2M3E A;  2O1K A;  3H1L D;  3N4X A;  1NTK E;  1ACP A;  3H1H J;  2V7Q H;  3PTZ A;  2LR2 A;  1OW7 A;  2L9F A;  1USD A;  2KS1 A;  4L75 A;  2YMK A;  1VQO P;  4H13 C;  1NKN A;  3EWK A;  4U0E A;  2KZI A;  1HJB A;  3U1A A;  1J2J B;  2J59 M;  3R4Y A;  1AQT A;  3L37 A;  2K1A A;  2DW3 A;  4I7Z C;  1SQX K;  2LXC B;  4H2X C;  1PZQ A;  3A0H H;  3P8C E;  1DD4 A;  1P84 H;  1PP9 D;  4L74 A;  3AE6 C;  1T3U A;  5KLI C;  1LWU C;  2XNX A;  3HZQ A;  2XXM A;  4LC1 A;  2AF8 A;  3HE5 B;  3L72 G;  1K8A Q;  1OR5 A;  1HTL C;  2KGE A;  3RK3 B;  2P58 A;  2E5T A;  4N6J A;  4UB8 E;  2Y0E A;  2Q3E A;  3M0A A;  5CMZ A;  3IR9 A;  2KOR A;  2WSE J;  4H44 C;  5KLV K;  2W27 A;  1YBK A;  4CA3 A;  1F80 D;  1JJ2 O;  3CXH I;  3HYB A;  1XTG B;  2E42 A;  3EJD A;  3GHG C;  5KAF E;  3MGE A;  3BCC J;  1ZP0 C;  1X8Y A;  1MZ8 A;  2QSI A;  4GDO A;  2YKO A;  3BAT A;  3IFM A;  2FQ0 A;  3SWY A;  2MR7 A;  2FYU J;  4KHX A;  2N1T D;  2Q7C A;  1N7L A;  3CME P;  1J1E B;  1VQ5 P;  1EC5 A;  1FZA A;  1SP4 A;  4L73 A;  3MUD C;  1X0T A;  1QGK B;  5APQ A;  4MN4 C;  1LTB C;  3L74 G;  1OIP A;  3P32 A;  1KYO I;  3WUV A;  2FQ1 A;  2AEM A;  1N7S C;  1QL1 A;  1Y47 A;  3CXH H;  5CHX A;  1HWT C;  2A06 G;  2JWA A;  2GYK A;  3L75 D;  3B71 A;  4ZKP A;  1CI6 B;  3SFE C;  1RQV A;  5HGN A;  2G8Y A;  2QJY C;  2KGA A;  1HUC A;  3IAO A;  1SQB K;  2Z44 A;  3WMM 0;  5HGO A;  3AEA C;  1CEI A;  4R4L A;  2XKM A;  1MKM A;  1L0L D;  1ZR4 A;  2VRS A;  2N9B A;  4WVZ A;  1M6E X;  2KNC A;  2YNY A;  3HD7 C;  1WRG A;  1URQ D;  3NXS A;  1ZXG A;  1M8O B;  5AW6 B;  2GZI A;  1KYO H;  2HOD B;  4XFY A;  2UWJ E;  1NTK G;  3B5N C;  4RJT A;  1HQB A;  1L4A C;  1BE3 J;  1KN7 A;  5AVR B;  4HKZ H;  1SQX D;  3CCL P;  1LGH B;  2IFN A;  3AE3 C;  5AW3 B;  3V2N A;  4K35 A;  3NTN A;  3B5I A;  4WB4 A;  3L70 J;  1G1I A;  4D6T E;  1PGP A;  2QG4 A;  1GU5 A;  2K92 A;  5APX A;  4COC A;  1S9K D;  3T97 A;  1E5W A;  4R4M A;  3RBX A;  1CW5 A;  5AVQ B;  4F37 A;  2WQY C;  2C0X A;  2HG5 D;  2DNW A;  4GT1 A;  2Q5U A;  4EIJ A;  1GL2 C;  1SQB G;  2FFD B;  1LTJ A;  3MTU E;  1EZV I;  3BRV B;  5KLV D;  1AVO A;  2IBZ I;  2E76 D;  3KQG A;  1UNK A;  4GR2 A;  1SQV E;  4WWI A;  1FJK A;  3M0D A;  2JO0 A;  1M7L A;  1LT9 B;  3DS3 A;  1GMJ A;  1S2E A;  1IFI A;  1HF9 A;  2FYU K;  2A45 I;  1SFC B;  2JU2 A;  1Y9B A;  2ZVN B;  2WVR A;  4JBZ A;  1N8R Q;  5CCG D;  2KS1 B;  3H47 A;  3KYQ A;  1PP9 J;  3SWK A;  1VQ4 P;  5E79 H;  1KV4 A;  4OGQ B;  1JUN A;  3FWL A;  3DS0 A;  1VQL P;  2I1K A;  2ZT9 C;  1KOR A;  1H0T A;  3L71 D;  2OGU A;  5H2F E;  4UB8 H;  2WPR A;  3H1K E;  1LWU A;  1IMQ A;  2JEE A;  2XZ0 D;  1YJN P;  1BCC E;  3G9R A;  3HUS B;  3CC2 P;  3LW5 H;  4BXL A;  1L0N E;  2WPS A;  3JCU E;  3CX5 D;  1SQB D;  2A45 H;  3AEB C;  4QMA A;  4C7N A;  5KAF H;  3G0V A;  2KSE A;  1FZE A;  2O1J A;  2N50 A;  4ASV A;  4B86 A;  1ZN5 A;  1M90 Q;  1NOH A;  1IFN A;  3F5H A;  3E1I A;  1LT9 C;  3H1H D;  2CGQ A;  2CG5 B;  3RK3 D;  2Y0D A;  2JQ4 A;  2MF4 A;  1GW3 A;  5CJ4 A;  4XFX A;  1NVO A;  3V2P A;  3WBH A;  3DS5 A;  1VQN P;  1DX7 A;  1YIJ P;  2KG6 A;  1KIL E;  4YTP C;  1QX8 A;  4Y99 B;  4QKO A;  3L72 J;  3A0H E;  3KDP B;  5AW7 B;  4ZMD A;  2YKP A;  1P84 E;  1T6A A;  2IZ0 A;  5I4T G;  1RF1 A;  2OTJ P;  2L0Q A;  2WPT A;  1VQ7 P;  3TDK A;  1JEK A;  2WSC H;  1N73 A;  1FZB A;  1VDF A;  2N1T B;  2QJK C;  4EOT A;  1FZC A;  4D6T G;  4IFD K;  1FZG A;  3TYY A;  3F89 A;  3Q1M A;  4TLF A;  1NWQ A;  1OVR A;  2B88 A;  4KJM A;  1SQP E;  2SPZ A;  2KP8 A;  1Q7Y Q;  2BUO A;  2YO2 A;  1PGO A;  2XV6 A;  2B89 A;  3HTK A;  3G29 A;  1T2K D;  2PEM A;  3W67 A;  1QEX A;  1X22 A;  1S3J A;  2VLO A;  2FYU D;  1K9M Q;  3B5N A;  3VYI A;  1PEO A;  1IZN B;  4PWV B;  1L4A A;  3TK1 A;  2POH A;  4GR6 A;  2LKM A;  1KFM A;  1NU1 K;  1T8Z A;  5KTB A;  3CXC O;  3I56 P;  2VLN A;  3RBZ A;  1HJ0 A;  3GZL A;  2LOL A;  4PV1 B;  1JY3 N;  1A8O A;  2FVF A;  4PD4 I;  2KW2 A;  3CXH E;  7CEI A;  2LF4 A;  2N1T C;  1QLE D;  3Q5R A;  1QL2 A;  3G4S P;  1SQQ E;  2QE7 H;  4DOJ A;  5CCH D;  1KB9 D;  1YI2 P;  3H1K G;  2GZJ A;  1M6N A;  1LJ2 A;  2JJL A;  2PAJ A;  1BCC G;  1NGM B;  3TF5 A;  5C39 A;  1L0N G;  3TGU G;  5AVW B;  1ZRT E;  1NTK J;  2PEK A;  4PJ0 H;  3CPW O;  1QVG O;  3AEF C;  1J1D B;  2FAC A;  1UJZ A;  2KGD A;  4BRY B;  4PH1 A;  1KYO E;  1N2D C;  5DJU B;  2OYH C;  4PD4 H;  2M8P A;  2IX7 C;  1HGZ A;  1X79 B;  1HVV A;  2BEZ F;  4UB6 H;  2PEI A;  2Z46 A;  1LP1 A;  3CWB E;  3NMD A;  4DG9 A;  1FS0 E;  5H2F H;  1BE3 D;  3VTP C;  2E76 B;  1OXZ A;  1RHZ B;  1NTZ E;  1VQ6 P;  2QJP B;  1K30 A;  1OWA A;  2AEF A;  5KP6 B;  3PRJ A;  1SFC D;  2O01 J;  1URQ C;  3A0B H;  3AED C;  1KTM A;  5F2K A;  5EFW B;  1SQB J;  2BEQ D;  2YMY A;  3CCQ P;  5KJ7 A;  2P9X A;  4AQR D;  3H1K D;  1M1J B;  2YIU B;  1QRJ A;  2KG9 A;  2NRG A;  3Q20 A;  4OGQ D;  3EFG A;  4PH0 A;  5APV A;  2K93 A;  5HV8 A;  2WT7 B;  3IN6 A;  1PGQ A;  3GZM A;  4R0M A;  3TGU D;  3L73 E;  5KKZ B;  2N5H A;  2Z5H A;  2KOS A;  2PEO A;  1OVU A;  4XFJ A;  3SFD C;  4IZ6 A;  2MY5 A;  2PFX A;  4GOF A;  5GTH E;  1EIA A;  1H88 A;  4IL6 X;  1JY2 P;  5AW1 B;  2E43 A;  1Q86 Q;  2JAZ A;  3U43 A;  4JQ0 D;  2H89 C;  1Q2N A;  2DGY A;  2E76 C;  2KG8 A;  5E79 E;  3I55 P;  3RL0 B;  2K88 A;  2E1M A;  1USE A;  1YIT P;  1NU1 D;  3M9Q A;  2XDJ A;  3H1I D;  4IL6 H;  4WYM A;  2XU6 A;  1EZV E;  4RES B;  5AVV B;  3DS2 A;  2KOP A;  2IBZ E;  3PLN A;  4XFZ A;  1NTZ K;  2XT1 A;  1KQL A;  4NPF X;  1KD1 Q;  1D1D A;  1SLQ A;  3HE4 B;  2P1J A;  1KFN A;  1YJW P;  1RF1 B;  5CCG C;  2LXB A;  1NQ4 A;  3AE4 C;  1Y8A A;  1N73 B;  1GK4 A;  1SS1 A;  3V6I A;  1KIL A;  1FZC B;  1K73 Q;  3G26 A;  4H2W C;  1SQQ G;  5AVZ B;  3H1J E;  4W7Z A;  2CWO A;  1GXG A;  1BGY E;  3RK2 D;  4M0I A;  4U3F G;  3RG2 A;  2GZE A;  1NTK K;  5EW5 E;  3M9B A;  1E79 H;  1EMV A;  2MVV A;  2GA1 A;  2KLV A;  1JTH B;  3HTK B;  3WUU A;  3B4S A;  2K0Y A;  2FYN B;  2E75 B;  1FZF A;  1CSB A;  1K05 A;  4WY4 A;  2FXP A;  4EI2 A;  2ITA A;  4DT0 A;  2OYI B;  2PP6 A;  3L72 D;  3V4W A;  3CWB G;  3RK3 C;  2XV5 A;  1EXI A;  2FYZ A;  2JKV A;  1PV3 A;  4AYC A;  4D6T J;  2BCC E;  1NTZ G;  4GKG A;  5CJ0 A;  4JPZ B;  4U0D A;  4BWN A;  3P05 A;  3AE9 C;  4HB1 A;  3VMX A;  4PXH B;  2WPV B;  3H32 A;  4DCK A;  2CK3 H;  5CBN A;  2XZ1 C;  4PV1 D;  4DJG A;  2LML A;  4U3F D;  3W68 A;  1U57 A;  1VQK P;  1RF0 A;  2E74 D;  2KLU A;  3BCC E;  4YXD C;  1J1E C;  1JY3 P;  1RQU A;  1YQ3 C;  1PPJ E;  2NPS B;  1DEB A;  3L73 G;  3CI9 A;  1H89 A;  2ZAE B;  3E2D A;  1GXH A;  3VP9 A;  1MFT A;  3RGU A;  2OYH A;  1R5L A;  1LTS C;  2R32 A;  2I1J A;  2VLQ A;  3L74 D;  1YJ9 P;  2EHT A;  3CC7 P;  3LID A;  2WSF H;  1WT6 A;  3WUT A;  1AQ5 A;  5AW8 B;  1BDC A;  2A06 D;  1MV8 A;  2KI7 B;  2GUS A;  3H25 A;  2W6J H;  1T2K C;  3MP7 B;  2W83 C;  1NTZ D;  3H1K J;  2QRX A;  3VRL C;  2VLP A;  2GDW A;  2WZ7 A;  3C9I A;  2M5A A;  1BCC J;  1VKU A;  4N78 D;  2RH0 A;  1EZV G;  1JMM A;  4UHP B;  2C9N Y;  2IBZ G;  2R3S A;  1L0N J;  2CNR A;  3TGU J;  3Q5P A;  1PL5 A;  1WMK A;  3RL0 g;  1BAJ A;  2N6Y A;  2FAE A;  2FVA A;  3AE2 C;  1FDI A;  4LLH A;  2ZJS E;  3CX5 I;  3AEG C;  5KP7 B;  5GTH H;  1JCC A;  2A45 G;  2AVA A;  2ZVO B;  1NTK D;  1VF5 D;  2AFE A;  2JR8 A;  2V7Q J;  3H1J G;  3GLM A;  1EQ7 A;  2PEQ A;  1NHL A;  1X9V A;  4PJ0 E;  2WTY A;  1BSH A;  1BGY G;  2IYP A;  5CCH C;  1ZW0 A;  4H0L B;  2FHS C;  1T8K A;  4BPG A;  4PD4 E;  1NU1 J;  4I2L C;  4EYY Q;  3R2P A;  2K94 A;  2YXQ B;  2WWW A;  3H1I J;  3KHU A;  4UB6 E;  2AXT H;  3KXD A;  1ZMB A;  4N3Y B;  1FE6 A;  3P8C D;  3FXD A;  4BPH A;  3CCV P;  1JY2 N;  5BU5 A;  3CX5 H;  2Z5I A;  3A0B E;  3IF4 A;  2KXP B;  2R3C A;  2M8L A;  3O6Q A;  5HVC A;  2FFD C;  2LTE A;  1RE4 C;  2EHS A;  1RNI A;  1PIX A;  1RE3 C;  5CCG A;  4IPY A;  3Q3D A;  3RL0 D;  2BCC G;  2YKQ A;  3ITK A;  3H1L E;  1FU1 A;  1HH0 A;  1PEQ A;  1Q90 D;  3GHG A;  2RN0 A;  1MFZ A;  1AV1 A;  1KIL B;  1SQV K;  5KP8 B;  2KZJ A;  3VMY A;  5B66 H;  1KQF B;  1SFC C;  1OMI A;  1RO0 A;  5EJD A;  1YTZ T;  4TT3 H;  3USS A;  2IDB A;  1EXJ A;  1AA0 A;  1S72 P;  1S1C X;  2KUB A;  3QH9 A;  4I6M C;  3MUD A;  1M57 D;  4OGQ C;  1PPJ G;  1K04 A;  1PP9 E;  4OH8 B;  1GZL A;  2JYG A;  4COP A;  1HY8 A;  1FBM A;  1N7S A;  5JPA A;  3GF3 A;  2J58 A;  3RK2 B;  4WY4 B;  3C8V A;  1IC2 A;  3HUS C;  1EOQ A;  4IL6 E;  3U1C A;  1G1J A;  3CCR P;  3CD6 P;  4OVN F;  1IMP A;  2E75 D;  2C0W A;  2JB0 A;  2WSE H;  1L0I A;  1SQQ J;  1IFP A;  1S4X A;  4LGD E;  2M8N A;  3V2Q A;  1L0N K;  3D6Z A;  4U3F J;  3CL3 D;  1L4A D;  2H43 A;  2W90 A;  2GDY A;  2OTK E;  5AW9 B;  4H2Y C;  2ERH A;  1S5L X;  2R5B A;  1KB9 I;  3CC4 P;  3H0D A;  1LTA C;  3HD7 A;  1E0H A;  4IFF A;  2KK7 A;  1SQV G;  2KNC B;  1ZOY C;  3E7K A;  1NJI Q;  3M91 A;  2B87 A;  3L74 J;  4OWF A;  5AW0 B;  1S5L H;  1NAY A;  3G71 P;  3CCS P;  3OW2 O;  4Y99 C;  2MJZ A;  2N98 A;  1R5S A;  2CPB A;  2AFD A;  2Z45 A;  1FDO A;  3GF7 A;  3CWB J;  2HR3 A;  1GD2 E;  1Z6M A;  1NTZ J;  2V4H A;  5HGL A;  3RK2 C;  3L75 E;  3TSI A;  2NPS D;  2LL8 A;  2E74 B;  3JSV C;  3PH0 A;  1KB9 H;  4DZO A;  3C1L A;  1CI6 A;  2L91 A;  2WMM A;  1IO4 A;  3RG6 C;  4HKG A;  4D6T D;  3BAS A;  3S1K A;  1AYI A;  2IFM A;  3T97 B;  1OW6 A;  1GL2 A;  2LPK A;  1L0L E;  4WBA A;  4BPF A;  2M5A B;  3CLQ A;  2Q1K A;  1LTJ B;  2MD9 A;  4MRT C;  1FDM A;  3GMA A;  1VQ9 P;  1SQP K;  3Q2Y A;  3L73 J;  1SQV D;  1JY3 O;  3H1L G;  4CPG A;  3D71 A;  1IUQ A;  2HOD A;  3SSU A;  1GTW A;  5AVT B;  4XRO A;  3II6 A;  5KAI H;  1OVV A;  2GDX A;  2BAS A;  1LNQ A;  4H13 B;  3GG2 A;  1GDT A;  5KJ7 D;  2K9Y A;  2NZ2 A;  2YO3 A;  1FOS E;  1SQX E;  2LIU A;  4XRQ A;  2H8P D;  3MHV A;  3M06 A;  2HPC A;  1NTM E;  2PEJ A;  4I7Z B;  1PEM A;  2Y9Y A;  4PV1 C;  1DD3 A;  3PP5 A;  3M1M A;  1G2C A;  2E74 C;  3K5B A;  2KSJ A;  1H0T B;  2GZF A;  1S9K E;  1PP9 G;  4AUW A;  3VP8 A;  1VF5 B;  3AE7 C;  5KLI B;  1LWU B;  4H0L D;  1L2P A;  2P67 A;  4C7R A;  4U7J A;  2FXO A;  1BCC D;  2XND H;  3OAK A;  3UIA A;  2L22 A;  4XE5 B;  5KLV E;  2Y9Z A;  1SQQ K;  3MGN A;  3GW6 A;  4IFM A;  1Q81 Q;  1MUU A;  2FAD A;  3LW5 J;  3V5B A;  1L0N D;  1W2E A;  2MVU A;  5B5E H;  4C7N B;  5APW A; 
#chains in the Genus database with same CATH homology
 1AUM A;  4U0B A;  2PEK A;  2DGY A;  3G6E P;  3RG6 C;  4XFY A;  3DS0 A;  4U0D A;  3CPW O;  1QVG O;  1M1K Q;  1VQL P;  1E6J P;  3I55 P;  3CCJ P;  2OTL P;  2JYG A;  3DS4 A;  2QA4 P;  1VQ8 P;  2QEX P;  2E1M A;  3DPH A;  3P05 A;  4U0F A;  1YIT P;  4COP A;  5F2O A;  1JJ2 O;  3HYB A;  4PH1 A;  4WYM A;  2PEQ A;  1Q7Y Q;  5JPA A;  3DS2 A;  1YJN P;  2M8P A;  3MGE A;  5HGM A;  3CCE P;  4XFZ A;  2BUO A;  1EOQ A;  2XT1 A;  5BS1 A;  2XV6 A;  3G28 A;  1KD1 Q;  2PEI A;  3CCL P;  3CC2 P;  1YHQ P;  2Z46 A;  5BS2 A;  1D1D A;  3G29 A;  1VQ9 P;  3CMA P;  3NTE A;  1YJW P;  1VQK P;  2PEM A;  3CCR P;  3CD6 P;  3CCU P;  1KQS O;  3CME P;  1A43 A;  1RO2 A;  3B5I A;  1VQ5 P;  1VQ6 P;  4U0C A;  3G0V A;  1ZMB A;  1K30 A;  1IUQ A;  2M8N A;  1K9M Q;  4QNB A;  1PEO A;  1K73 Q;  3G26 A;  4COC A;  4XRO A;  1M90 Q;  3DTJ A;  3E2D A;  5F2K A;  3CCV P;  2CWO A;  2PEN A;  1Q82 Q;  4GR6 A;  1VQO P;  4M0I A;  3CC4 P;  2PY8 A;  3CCQ P;  1YJ9 P;  3CC7 P;  2L6E A;  2M8L A;  3H0D A;  4U0E A;  4XRQ A;  2P9X A;  4XFX A;  4U0A A;  1QRJ A;  1W2B O;  3CXC O;  3Q20 A;  3WBH A;  3I56 P;  1RNI A;  3DS5 A;  1PEU A;  1M74 A;  4PH0 A;  2PEJ A;  4IPY A;  1VQN P;  1NJI Q;  4GR2 A;  1PEM A;  2KOD A;  3H4E A;  1YIJ P;  1A8O A;  3M1M A;  2JO0 A;  5HGN A;  1PEQ A;  2LF4 A;  2EG5 A;  3DS3 A;  2EFJ A;  2Z44 A;  2PEO A;  3DS1 A;  3VRL C;  3G4S P;  3G71 P;  3CCS P;  5HGO A;  2BQ1 E;  3G1G A;  3OW2 O;  1YI2 P;  2ONT A;  1KC8 Q;  2EIA A;  3G1I A;  1VQM P;  1M6N A;  3HZQ A;  2XXM A;  2BHV A;  2Z45 A;  2JYL A;  1N8R Q;  1RO0 A;  5F2N A;  1EIA A;  5DCK A;  5I4T G;  3H47 A;  2OTJ P;  1K8A Q;  1S72 P;  1VQ7 P;  1M6E X;  3CCM P;  1BAJ A;  5HGL A;  1Q81 Q;  3G21 A;  1Q86 Q;  1VQ4 P;  2OAR A;  3LRY A;  1QVF O;  1VQP P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...