3OW2O

Crystal structure of enhanced macrolide bound to 50s ribosomal subunit
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAKGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S RIBOSOMAL RNA
total genus 47
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2010-09-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3ow2O03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 3ow2O01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 3ow2O02
3G71P 3CXCO 3CMAP 1KC8Q 1JJ2O 1QVFO 3CD6P 3CCSP 3CCMP 1YI2P 2QA4P 3OW2O 1VQ6P 1VQ5P 1K9MQ 1K8AQ 1Q81Q 1VQMP 2OTJP 1KQSO 1NJIQ 3G6EP 1W2BO 1VQKP 3CCEP 2OTLP 1QVGO 1S72P 3CC7P 3CPWO 2QEXP 3CC2P 3CCUP 3G4SP 1N8RQ 3CC4P 3CCLP 1VQNP 1M90Q 1VQ4P 3CCRP 1YJNP 1VQ9P 1VQLP 1VQ8P 3CMEP 1YJWP 1Q86Q 1YHQP 3CCVP 3I56P 1VQOP 3CCJP 3I55P 1YIJP 3CCQP 1YITP 1Q82Q 1VQ7P 1YJ9P 1Q7YQ 1M1KQ 1KD1Q 1VQPP 1K73Q
chains in the Genus database with same CATH superfamily
2MVVA 2AEMA 1KILA 3L74E 5AW1B 3RK3E 2FVAA 3CC2P 3IR9A 4GR2A 1VQLP 1AA0A 3FWLA 2K2QA 2OYIB 3G0VA 1LTJC 2IBZG 2IZ0A 3CX5H 1KC8Q 1OW8A 3A0BH 1GW3A 1PGOA 3H1LD 2IBZE 3BATA 3L35A 1RH5B 3Q1MA 1NO4A 3L71J 3CXHI 5HGOA 2KGDA 1L0HA 5KLVD 1NTMD 4ASWA 3A7OA 2M3EA 4RKUJ 3Q5PA 1DX7A 1AVYA 4QKOA 1FS0E 4D6TG 2LL8A 2NZ2A 3H32A 2CG5B 1JO5A 2B89A 3L70D 2W6AA 1MFZA 3Q5SA 1N73C 2JAZA 2KGAA 1S2EA 1FZBA 2K9YA 1L0LK 2RN0A 3NMDA 3G28A 1VF5C 4N3YB 4OWFA 2KYVA 2P1JA 2CQ8A 2KS1A 1Q90D 2K92A 2KB7P 4O9BA 4MN4C 2N6YA 5DJUB 2Q5UA 1JEKA 2GZJA 3H32B 1JUNA 2J58A 5KP8B 1QL1A 2CWOA 2NPSB 4JYBA 3HZQA 1NTZJ 2WWWA 1NOHA 3T97B 4ZKUA 5CCGD 2ROQA 1A02J 1ZMEC 3Q3DA 2L4BA 4KT0J 1M74A 2ZVNB 3AEGC 4H2YC 3V4WA 3L75G 3RK3D 4DCKA 3KXDA 1HGZA 2L91A 4KJMA 2K88A 2BHVA 3E2DA 1BGYJ 5EW5E 1EDKA 2P7JA 1R8EA 1JMMA 3HE4A 1SQQG 3JCUE 1N73B 3LMOA 2OYHA 4XRQA 2YIUB 1NTZK 1T2KC 1S9KE 2N6ZA 1YTZI 3IAOA 3B4SA 3WU2E 3M9BA 1RO0A 2Q3IA 1SFCA 1KILB 2N1TC 2C0XA 3N4XA 2B87A 4EIJA 1KORA 4BXLA 4PD4E 3SWFA 4I2LC 3GMAA 1K9MQ 3FWNA 3L36A 2A06G 3O6QB 1CI6A 5KJ7C 3M1MA 2QE7H 4M0IA 4DZOA 1RO2A 4L74A 3RBXA 1NGMB 4R0MA 1N7SA 1EZVD 1PPJG 1SFCB 1CW5A 2Z46A 2LIUA 1IC2A 3OJAB 1DH3A 1X8YA 3CX5I 2K37A 2AFEA 2EHTA 2OYOA 2PEIA 1NTKK 2ZFCA 2NO8A 1L0LG 2H88C 2P10A 4U3FE 3G71P 2GM4A 1PIXA 2XNDH 1KILC 3CLQA 1NTME 1NYHA 1VPCA 3L4FA 2OTKE 1YQ3C 2O01H 1Y47A 1QL2A 4XFXA 2E76C 3I55P 2FYNB 5AVUB 4TLFA 3GHGC 3EJEA 1SQPG 1VQMP 2GUVA 1M1JC 3E1RA 1N2DC 4QNBA 1MKMA 5KKZB 5KLVE 3M06A 5AVVB 1LT9C 2WSFH 3A2AA 1XTGB 3SFEC 2A45H 2KLUA 3P05A 4K3AA 2XZ0D 2JYLA 1IMPA 3KZIH 4XA4A 5L8RJ 2MR8A 1NTZG 1ZOYC 4LC1A 3U1AA 1P84D 3CCEP 3DS5A 1S3JA 3FX0A 3S9OA 1EXJA 2JU1A 3AEDC 5KP7B 1KLPA 1P84E 2BEZF 2Y9YA 3L75J 3N7NA 4WVZA 1KQGB 3AE9C 2Z4EA 1OVRA 5F2NA 1J2JB 3GF7A 2KZJA 4W7ZA 5AVSB 2FXOA 1N86A 1QVFO 1KYOD 1T3JA 1IO4A 2EIAA 2B9BA 1AUMA 5AW0B 2FBWC 3VTPC 3H1LJ 3V2NA 2QJYB 2WT7B 2KW2A 3AE8C 4WBAA 1FOSF 2KGEA 3WBHA 3MHVA 1KD1Q 1OMIA 5KKZC 3S1KA 1ACPA 3CCMP 2FYZA 5TJHA 3G1GA 3G3ZA 5KAIE 1FDOA 5KTBA 3H0DA 5AVTB 2DNWA 3CE7A 1EZVI 3D71A 2B88A 2AVAA 4Y99B 4WB4A 3NTNA 1MUUA 1ZR2A 1IK9A 1Q86Q 3EQ2A 4C7NA 3VP8A 5AVYB 5F2KA 3SWYA 4C46A 1IFMA 3W68A 2QVAA 1BCCE 3HE4B 1XTCC 1GPJA 4RJTA 3G29A 3H4EA 4IL6X 4UB6E 1SQVJ 5CMZA 3MGEA 1BSHA 2Y0CA 4I7ZB 3P7KA 2ZYGA 1LTIC 4B86A 4XFYA 2AF8A 4UB6H 2N5IA 1YTZT 4LGDE 3H6PA 3L37A 5CCHA 2I8DA 4IL6E 3R2PA 5KLIB 3L72J 1LWUA 2H43A 3LIDA 3TGUE 1GK6A 3E1IA 1RHZB 2XT1A 3VRLC 3AE2C 2A06E 2XU6A 1L0NE 1K05A 2B87B 3A0HH 2YNYA 2W8ZA 4HKZH 2IBZI 2PRRA 1BGYE 3A5TA 1NU1G 5E79E 4PWVB 5APYA 2E5TA 3PTZA 4H0LD 3HD7C 1G1JA 4U0AA 1IFDA 1FZEA 3II6A 2E76B 5B5EH 5AVZB 4I7ZC 2JB0A 2WSSH 1LWUB 1VQ5P 2FACA 1OW7A 2M8RA 1ZRTD 2QG4A 1KB9I 5BS1A 3W67A 1JCDA 1KILE 2X2BA 2V7QH 4HKGA 1QLED 2JDIH 4M3LA 3MD0A 2KIKA 5KLIC 1K04A 2E76D 2L6EA 4LLHA 3FGAD 3RK2C 1URQB 4K35A 2ZT9B 2MF4A 1D1DA 3V4QA 3L73D 1BGYG 1W2BO 3H1HD 2FFDA 3H1JE 5GTIE 2FXPA 4OH8B 1RF1C 3H1KE 3EJDA 1L0ND 5APVA 3SWKA 1EZVG 1RF0C 2IDBA 2KK7A 1L0NK 3Q5RA 1GXHA 3TYYA 4A7PA 5APWA 3CX5D 3CCSP 4HJGH 4DG9A 2R5DA 3TGUG 1QGKB 2LOLA 2A45G 2PEJA 2IYOA 1BDCA 2K0XA 3I5CA 3EFGA 1GL2A 1SQBE 2LXCB 1H89A 1NQ4A 3BCCG 3C9IA 4GODA 2BCCD 2YXRB 1KV4A 2KUBA 3CMEP 3VOPA 5HGLA 1MV8A 1JY3P 4GKGA 1JCCA 1FOSE 2N1TB 2H8PD 1NU1E 3MUDC 5H2FH 3VP9A 3D70A 1VQ6P 1MFTA 1X22A 3IF4A 2OYHC 2LKMA 1BCCG 2K9JA 5APTA 1KB9E 2KP8A 4U0EA 3EJBA 1S5LX 1P84H 3G9RA 2KG9A 2WMMA 1YIJP 2ZT9C 2KG6A 2JP3A 1BE3E 2KOGA 2FFDB 1T2KD 2YO3A 4H2XC 2EFJA 1URQA 3DS1A 2VLPA 1QRJA 3TNUA 2FYUG 1KQLA 1PZQA 3RK3C 1VQ7P 1YJ9P 2VRSA 3VN0A 1SFCD 2K9JB 1X0TA 1USEA 1FE6A 3B71A 3IN6A 5AW4B 3L73J 3LIEA 3L70G 1YYCA 4WY4C 1KMIZ 1UJZA 4GIFA 3Q20A 4R4MA 3B5ND 1Y8AA 4JBZA 2OARA 3H1HG 4AUWA 3KQGA 2IFNA 1H8AA 1FJKA 1L4AB 2GUSA 4RO0A 2ZXEB 1NU1K 1H0TA 2WZ7A 2K1AA 3M0AA 1M90Q 1H88A 2EG5A 3AEAC 3E7KA 3CXHH 2JQ4A 1SQQK 2WITA 4WY4A 2E74B 1HUCA 1NU1D 1RF1A 2GDWA 3V2RA 2POHA 2JWDA 3BCCD 1SQPE 2I1JA 4IFMA 5AW6B 1PEUA 3C8VA 4IL6H 2GDXA 2P67A 2GZGA 1SLQA 1SQBG 3O6QA 5B66E 1NTKE 3HE5A 2R3SA 1NTZD 2Q7CA 1EIAA 1NTZE 3USSA 3HTKB 1MZ9A 1EMVA 2E43A 1URQC 4NPFX 5AVRB 1W2EA 1VDFA 1ZXGA 2MR7A 3CC4P 2FQ2A 2M5AA 1T8ZA 3EWKA 2PEQA 1YQ4C 2Q3EA 3U1CA 3AEBC 2FQ0A 1D7MA 5AVXB 4BPGA 2SPZA 1L4AA 3HYBA 2QJPC 3A0HE 2ZT9D 1NVOA 1ZW0A 2Q6QA 2M5RA 3H1KD 2FYUK 1UNKA 3CWBD 3B5NC 2P9XA 3VMYA 1AJYA 2HG5D 5AW5B 1M1KQ 2N50A 2Y0DA 3FXEA 4I1LA 1SQXE 1OFCX 1NAFA 3HE5B 1E6JP 1FZAA 3RL0C 4PH0A 3CI9A 4D6TJ 3B4QA 1E79H 3GZLA 1M56D 2E42A 3CCVP 5CCHC 3H1JJ 1RF0A 3AEFC 2AFDA 1NTKG 1S4XA 2OTJP 3K5BA 2FFDC 3B5IA 1PEQA 5AW8B 2O01J 2PEKA 3HD7B 4NPEA 1A02F 1FZFA 5CJ4A 1UIXA 4GT1A 1SQVE 1ZNVA 3L71D 1LTJA 2E75C 3C1LA 1YITP 2ZJSE 3AE7C 3PP5A 1NTMJ 4H2WC 1ZR4A 2WSCH 1JY2O 4GR6A 1L4AD 2KOSA 3TSIA 2J5UA 4XFZA 2R3CA 1MZ8A 3CL3D 4U0FA 2YIUC 4IOIH 1KTMA 2CGQA 2D2CC 4W80A 3LW5H 1OW6A 2NPSD 3TGUD 3MTUE 3TK1A 3WUVA 3WMM0 2MKVA 1K73Q 4IPYA 4IFDK 2HR3A 5CCHD 5AVWB 3AE4C 1AQTA 2BCCE 1RF1B 3HD7D 1GZLA 1JTHA 2GDYA 5AW2B 1OVVA 4GDOA 1FZCB 1LTGC 1JY2N 4N78D 7CEIA 3CX5E 2K94A 1X9VA 3CD6P 1BCCD 2N9YB 1FDIA 1E0HA 4OVNF 1JM0A 3RK2B 1RQVA 4PH1A 1L0IA 3RK2D 2O01N 5GTHE 3H1HE 5TISH 1PV3A 2AXTE 3KDPB 1FC2C 1VQPP 1AYIA 1SQBK 2L5GB 3VMZA 4YXWH 3CPWO 4H13C 1LP1A 5TISE 4RESB 2FADA 3CCQP 1FAVA 2NPSA 3Q2YA 5KP6B 3DTJA 3CMAP 1NHLA 1EOQA 4L73A 1S5LH 3L74G 1WRGA 3PH0A 2N9BA 2XV6A 3CXHE 4R4LA 4H44C 3TDKA 2L0QA 2VSQA 3R4YA 3G1IA 5HVCA 3SFDC 3V2QA 1HJ0A 4ZKPA 4XFJA 4GOFA 4NPDA 3P32A 2LMLA 2QJKC 2KGCA 2FYUJ 2W6JH 2JO0A 5CCGA 3G6EP 3H1KG 3M0DC 1OX3A 3HRNA 4NEOA 5KJ7D 5KLVG 2K93A 5GTIH 1PL5A 3AE1C 3PLNA 1GL2D 2J59M 4JQ0D 3M9QA 1YI2P 1GU4A 2QA4P 1JOCA 2QRXA 2WPSA 1FJPA 2I1KA 2OTLP 2WSEH 2KLVA 1FR2A 2W90A 3H1IE 4C7NB 1SQBD 2HLOA 1L0LE 1IFPA 3HUSC 1VQ8P 1PGQA 4TT3H 2YMYA 2GZIA 1DEBA 2Y9ZA 5CZDB 3L70E 2E75B 1EZVE 4WY4B 1SFCC 2PENA 1NKZB 5APUA 1PGPA 5BU8B 1ZP0C 2WQYC 5CHXA 5BVZA 1G1IA 1L4AC 1DNYA 1T3UA 3I56P 5HGMA 1JMBA 1A8OA 1LT9B 2E75D 1RE3C 2LR2A 3QH9A 3VYIA 1SQQJ 4COPA 1N7SD 1NKNA 3DPHA 2E5YA 2PEMA 2KNCA 1U57A 4JYCA 3BVHA 1K30A 1SQVG 1RE3A 2EHSA 4ZNCA 1H0TB 1KYOE 2QJPB 5BS2A 2LKIA 2HFED 5GTHH 4HYTB 2CNRA 3RL0D 2M8NA 4BPFA 4PJ0E 2GZEA 3MUDA 4PV1B 2WPRA 1VQ4P 1HTLC 1L0NJ 5KAFE 4WWIA 2M0BA 2RKLA 4EYYQ 1HJBA 5CJ0A 1IFIA 3MP7B 5H2FE 1WT6A 3BASA 1HWTC 3G4SP 2A06D 1SQBJ 4IZ6A 2BCCJ 1Q7YQ 1SQXJ 1PEMA 2N1TA 5B5EE 1JJ2O 2KSJA 1LTAC 3H1JG 1GDTA 1R5SA 3UIAA 3GW6A 2DW3A 3CWBG 4U0BA 2XV5A 5E79H 5KLVJ 4DT0A 3H1IG 1J1DB 2KOPA 4CA3A 1BE3J 3BRVB 2MVUA 2K5XA 2XZ1C 2PGDA 2YO2A 1GTWA 2WSFJ 2VLQA 1NTKD 4EDFA 1QVGO 2Q1KA 3RGUA 1NAYA 1KFMA 1JY3N 3H1LE 4YXDC 3RBZA 3WU2H 4PJ0H 1KN7A 3OA7A 4PD4D 2AXTH 5HV8A 4BRYB 3OAKA 5AVQB 4U0DA 3WUTA 1F80D 1NJIQ 2WPVB 1S9KD 1BAJA 2G3AA 2QM7A 2QNWA 1LTJB 4H0LC 2Z5HA 2O1KA 5BU5A 1VL2A 4PD4H 2GYKA 3HUSB 4JPZB 2JWAA 2KOOA 2N1TD 5APXA 4N6JA 3V2PA 3DS0A 4I6MC 2WPQA 2WPTA 2HYNA 1SQXK 4C7RA 1LNQA 3KYQA 3SSUA 2QSIA 4PV1D 1YJNP 3L74D 4DOJA 4UHPB 2QIWA 1G2CA 3PHLA 1CEIA 1U7JA 2KI7B 1FZCC 2W27A 1JY2P 1K8AQ 2HPCA 1LTTC 2CPSA 1IJDB 4H13B 2WT7A 2C9LY 2L22A 1VQKP 1N7LA 5CCGC 4QMAA 3CWBE 3L73G 2OGUA 3HTKA 3G21A 1CI6B 1PP9J 3CCJP 2M8PA 1SQVK 1U7MA 4U0CA 1FDMA 4PXHB 2NRGA 5CBNA 1GW4A 1BE3D 4H44B 4H13D 3O8ZA 2BQ1E 2MY5A 2NPSC 5I4TG 1ZV8A 2QJKB 4MRTC 3HD7A 1RE4A 1DD4A 1RNIA 1AV1A 4EI2A 1AVOA 3DS4A 4N78E 1IFNA 2K0YA 2DGYA 1L0LD 1ZLLA 2IBZD 2XKMA 1IFJA 3CWBJ 3DS2A 3FXDA 2Y0EA 2JU2A 2V4HA 3GLMA 4ZMDA 1KYOH 2E74D 2G8YA 3L70J 1JB0J 1NH4A 3L75E 1DIPA 5CBOA 2R44A 4U7JA 5K5GB 3S4RA 2OYIA 3A0BE 2UWJE 4D6TD 1PGJA 2HPCB 1USDA 4AQRD 2IX7C 1M1JB 1SQPD 1OR5A 2AEFA 1SP4A 3NTEA 4WYMA 1HF9A 5M1BA 1M1JA 3ZDMA 1SQVD 3L71E 3P8CD 1NWQA 4YTPC 2FKWB 2JJLA 1KILD 4BPHA 1FU1A 2XDJA 3CXHD 3EFFK 2ZXXA 1AQ5A 3RL0B 2XNXA 2H7HA 5APSA 3L72D 2YKPA 2C0WA 2HODB 1PP9E 1EDJA 3GG2A 2JYGA 1N8RQ 2OQQA 1HQBA 2ERHA 3CCRP 3P8MC 4U3FG 3TNUB 3LRYA 2CK3H 2W6BA 1ZMBA 3B5NB 1SVFA 4BRYA 2Z45A 1RY3A 2WTYA 1SQXD 2RMZA 2JO1A 2IYPA 2FVFA 3ITKA 1URQD 3BCCJ 4OGQC 1PPJE 3GKLC 4PV1C 4UB8H 1M57D 2KS1B 4UB8E 1EQ7A 1HBWA 1N7SC 3U59A 1L0LJ 2WVRA 1KB9D 3JCUH 1Q82Q 1PP9G 1L0NG 5KJ7A 2XZRA 2KR5A 1HGVA 1JTHB 1KZUB 5DJTB 4HH2A 2KZIA 3CCUP 3B8EB 3H1ID 3NFQA 3AE3C 3VMXA 1LT1A 2K3RA 1LTSC 1GD2E 2GA1A 2KOQA 1S5LE 3JC22 3B5NA 2JKVA 2BEQD 2KSEA 1BSNA 2KWLA 1LT9A 5KLVK 2A45I 3GF3A 3AE5C 1Q2NA 1S72P 3CC7P 3GHGA 1E5WA 1VQ9P 1KFNA 1YHQP 1PPJD 1X79B 3V6IA 3PJSK 5C39A 2FVEA 4WY4D 1OWAA 4EOTA 1R5LA 3H1LG 3KPEA 2RH0A 1IK7A 1N7SB 1CZQA 2YKOA 4U3FJ 3RL0g 3NY7B 2M8LA 1NTMG 2QJYC 1J1EC 2N98A 1VQOP 2IPPA 3IFMA 5EFWB 1OVUA 3H1JD 1FBMA 1ZRTE 2FYUD 1LGHB 2WSEJ 2O1JA 3OW2O 3MZWB 1IMQA 4GOEA 3M9HA 2LF4A 1OXZA 1JNMA 2MD9A 2QEXP 4Z1MH 1VF5B 1OIPA 3P8CE 2O3JA 2LTEA 3RG2A 1M6EX 2BASA 3KHUA 2PEOA 3MIWA 1N73A 1PFIA 1WMKA 3TF5A 2L9FA 2P58A 1CSBA 2JR8A 4BWNA 1GK4A 4D6TE 2M5AB 3AE6C 3H1IJ 5F2OA 1QEXA 4PD4I 3BRTB 1KB9H 1BE3G 2PFXA 2BUOA 1EDIA 2D2CB 1BGYD 1J1EB 1KQSO 1EC5A 1GXGA 1BXIA 1LP1B 3H1KJ 4F37A 1SQPK 3BCCE 3D6ZA 5AW3B 4KHXA 1SQQD 2Q9IA 1BDDA 3L72G 4DJGA 1OZHA 2JGPA 3NXSA 3VMAA 1P84I 2HODA 2ONTA 1AFOA 4YPCA 1EXIA 1LJ2A 4OGQB 1A43A 2FAEA 4COCA 3F5HA 2R5BA 2JEEA 2ZYDA 2PY8A 3L74J 1KYOI 1Y9BA 3H47A 5KAIH 1NU1J 3F89A 3WUUA 1DEEG 2Z44A 4H44D 1LTBC 1QX8A 3CCLP 3JSVC 1FZGA 1VHNA 2ZYAA 3KZIE 5AW7B 5HGNA 1M8OB 3HUSA 3U43A 3CXCO 2YKQA 3ABVC 1ZN5A 3T97A 2Z5IA 1GL2C 3GJNA 1L2PA 1JY3O 4L76A 2IZ1A 1LWUC 1X3OA 1RQUA 2JBGA 4Y28J 3DS3A 4OGQD 2WSCJ 1YJWP 3TGUJ 5APQA 4XROA 3L72E 1G2CB 3PRJA 2E74C 3AECC 3M0DA 2E1MA 1T8KA 2KODA 1TU3F 2GZFA 3L71G 2FHSC 1RE4C 1NTMK 1PEOA 1IUQA 3H25A 3GHGB 1DD3A 1HVVA 1BCCJ 1YBKA 2FY8A 3A3YB 1HH0A 1NTKJ 2LPKA 2ITAA 1M7LA 2VLOA 2QM8A 4CPGA 2C9NY 2KXPB 1GMJA 1VF5D 2N5HA 1GL2B 2M3BA 1SQPJ 2D2CD 3L75D 2LXBA 1GU5A 2FYNC 1SQQE 2AEJA 4L75A 2PNGA 1DV5A 2PAJA 2ZVOB 3D6YA 3H1HJ 4XE5B 1FZCA 4IFFA 1J1DC 2YXQB 3QWOC 3RG6C 2AXCA 2XXMA 1KQFB 3RK3B 2OYHB 4AYCA 5DCKA 2V7QJ 2LIWA 1VKUA 2FQ1A 1SS1A 1HY8A 3LW5J 4ASVA 5KAFH 2OYIC 2KORA 5EJDA 1Q81Q 3M91A 4JF7A 1M6NA 3AEEC 1SQXG 5B66H 2ZAEB 4U3FD 1Z6MA 2P2UA 2H89C 1VQNP 1Z56A 1AF8A 2IFMA 2YMKA 2KNCB 5AW9B 3L73E 1T6AA 4W7YA 3GZMA 3MGNA 2R32A 1UIIA 1IZNB 2KG8A 1W5CE 1EDLA 4Y99C 2MJZA 2K0DX 2BCCG 2FXMA 1S1CX 4H0LB 2W83C 3V5BA 5JPAA 2CPBA 4HB1A 1PP9D 2VLNA 3G26A 2PP6A 2FYUE
chains in the Genus database with same CATH topology
3DTJA 1EIAA 4GR6A 1EOQA 3HZQA 4COPA 2M8PA 3G71P 3CMAP 4U0CA 3CCMP 3DPHA 2ONTA 2XV6A 1VQ5P 3G1GA 2PEMA 5BS1A 4XFZA 2EFJA 3DS1A 1QVGO 3H0DA 4U0FA 2M8LA 1QRJA 3CC2P 2BQ1E 1M74A 2JYGA 1N8RQ 1A43A 3CC4P 4GR2A 4COCA 1K30A 3G1IA 3CCRP 1VQLP 2PY8A 3LRYA 1Q86Q 4XFXA 1VQOP 2PEQA 3I55P 5I4TG 3G0VA 1VQ7P 1ZMBA 1YJ9P 5F2KA 2BHVA 1K73Q 2Z45A 2L6EA 3E2DA 3H47A 1KC8Q 5BS2A 3HYBA 1RNIA 4IPYA 3OW2O 3G29A 3H4EA 2Z44A 4U0DA 2JO0A 1VQMP 3DS4A 1D1DA 4XRQA 1NJIQ 3G6EP 1W2BO 4QNBA 3MGEA 2M8NA 2LF4A 2DGYA 2QEXP 4XFYA 1RO0A 3CCLP 3RG6C 1BAJA 1VQ4P 3DS2A 2XXMA 5HGOA 2P9XA 5DCKA 3P05A 3Q20A 1Q82Q 1M6EX 1M1KQ 2PEOA 5HGNA 2JYLA 2OARA 3CXCO 3CD6P 3CCSP 1YI2P 2QA4P 1K9MQ 1Q81Q 3DS0A 1M6NA 2PEJA 3CCEP 2OTLP 3DS5A 1E6JP 2XT1A 3VRLC 4PH1A 4PH0A 3CCUP 3G4SP 1VQNP 3M1MA 1M90Q 3DS3A 5F2OA 2EG5A 4M0IA 1YJNP 1VQ8P 3CMEP 1YJWP 3CCVP 5HGLA 4XROA 1RO2A 1Q7YQ 5F2NA 1VQPP 2BUOA 3G28A 1PEMA 1JJ2O 2PENA 1QVFO 1VQ6P 1K8AQ 2OTJP 2EIAA 2Z46A 3NTEA 4WYMA 1KQSO 2E1MA 1AUMA 1VQKP 3B5IA 1PEQA 2KODA 1S72P 3CPWO 2PEKA 3CC7P 1PEUA 5JPAA 4U0EA 4U0BA 1PEOA 2PEIA 4U0AA 1IUQA 1VQ9P 3G21A 3G26A 3WBHA 3I56P 5HGMA 3CCJP 1YHQP 1YIJP 3CCQP 1YITP 1A8OA 2CWOA 1KD1Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G71 P;  3CXC O;  3CMA P;  1KC8 Q;  1JJ2 O;  1QVF O;  3CD6 P;  3CCS P;  3CCM P;  1YI2 P;  2QA4 P;  3OW2 O;  1VQ6 P;  1VQ5 P;  1K9M Q;  1K8A Q;  1Q81 Q;  1VQM P;  2OTJ P;  1KQS O;  1NJI Q;  3G6E P;  1W2B O;  1VQK P;  3CCE P;  2OTL P;  1QVG O;  1S72 P;  3CC7 P;  3CPW O;  2QEX P;  3CC2 P;  3CCU P;  3G4S P;  1N8R Q;  3CC4 P;  3CCL P;  1VQN P;  1M90 Q;  1VQ4 P;  3CCR P;  1YJN P;  1VQ9 P;  1VQL P;  1VQ8 P;  3CME P;  1YJW P;  1Q86 Q;  1YHQ P;  3CCV P;  3I56 P;  1VQO P;  3CCJ P;  3I55 P;  1YIJ P;  3CCQ P;  1YIT P;  1Q82 Q;  1VQ7 P;  1YJ9 P;  1Q7Y Q;  1M1K Q;  1KD1 Q;  1VQP P;  1K73 Q; 
#chains in the Genus database with same CATH topology
 2MVV A;  2AEM A;  1KIL A;  3L74 E;  5AW1 B;  3RK3 E;  2FVA A;  3CC2 P;  3IR9 A;  4GR2 A;  1VQL P;  1AA0 A;  3FWL A;  2K2Q A;  2OYI B;  3G0V A;  1LTJ C;  2IBZ G;  2IZ0 A;  3CX5 H;  1KC8 Q;  1OW8 A;  3A0B H;  1GW3 A;  1PGO A;  3H1L D;  2IBZ E;  3BAT A;  3L35 A;  1RH5 B;  3Q1M A;  1NO4 A;  3L71 J;  3CXH I;  5HGO A;  2KGD A;  1L0H A;  5KLV D;  1NTM D;  4ASW A;  3A7O A;  2M3E A;  4RKU J;  3Q5P A;  1DX7 A;  1AVY A;  4QKO A;  1FS0 E;  4D6T G;  2LL8 A;  2NZ2 A;  3H32 A;  2CG5 B;  1JO5 A;  2B89 A;  3L70 D;  2W6A A;  1MFZ A;  3Q5S A;  1N73 C;  2JAZ A;  2KGA A;  1S2E A;  1FZB A;  2K9Y A;  1L0L K;  2RN0 A;  3NMD A;  3G28 A;  1VF5 C;  4N3Y B;  4OWF A;  2KYV A;  2P1J A;  2CQ8 A;  2KS1 A;  1Q90 D;  2K92 A;  2KB7 P;  4O9B A;  4MN4 C;  2N6Y A;  5DJU B;  2Q5U A;  1JEK A;  2GZJ A;  3H32 B;  1JUN A;  2J58 A;  5KP8 B;  1QL1 A;  2CWO A;  2NPS B;  4JYB A;  3HZQ A;  1NTZ J;  2WWW A;  1NOH A;  3T97 B;  4ZKU A;  5CCG D;  2ROQ A;  1A02 J;  1ZME C;  3Q3D A;  2L4B A;  4KT0 J;  1M74 A;  2ZVN B;  3AEG C;  4H2Y C;  3V4W A;  3L75 G;  3RK3 D;  4DCK A;  3KXD A;  1HGZ A;  2L91 A;  4KJM A;  2K88 A;  2BHV A;  3E2D A;  1BGY J;  5EW5 E;  1EDK A;  2P7J A;  1R8E A;  1JMM A;  3HE4 A;  1SQQ G;  3JCU E;  1N73 B;  3LMO A;  2OYH A;  4XRQ A;  2YIU B;  1NTZ K;  1T2K C;  1S9K E;  2N6Z A;  1YTZ I;  3IAO A;  3B4S A;  3WU2 E;  3M9B A;  1RO0 A;  2Q3I A;  1SFC A;  1KIL B;  2N1T C;  2C0X A;  3N4X A;  2B87 A;  4EIJ A;  1KOR A;  4BXL A;  4PD4 E;  3SWF A;  4I2L C;  3GMA A;  1K9M Q;  3FWN A;  3L36 A;  2A06 G;  3O6Q B;  1CI6 A;  5KJ7 C;  3M1M A;  2QE7 H;  4M0I A;  4DZO A;  1RO2 A;  4L74 A;  3RBX A;  1NGM B;  4R0M A;  1N7S A;  1EZV D;  1PPJ G;  1SFC B;  1CW5 A;  2Z46 A;  2LIU A;  1IC2 A;  3OJA B;  1DH3 A;  1X8Y A;  3CX5 I;  2K37 A;  2AFE A;  2EHT A;  2OYO A;  2PEI A;  1NTK K;  2ZFC A;  2NO8 A;  1L0L G;  2H88 C;  2P10 A;  4U3F E;  3G71 P;  2GM4 A;  1PIX A;  2XND H;  1KIL C;  3CLQ A;  1NTM E;  1NYH A;  1VPC A;  3L4F A;  2OTK E;  1YQ3 C;  2O01 H;  1Y47 A;  1QL2 A;  4XFX A;  2E76 C;  3I55 P;  2FYN B;  5AVU B;  4TLF A;  3GHG C;  3EJE A;  1SQP G;  1VQM P;  2GUV A;  1M1J C;  3E1R A;  1N2D C;  4QNB A;  1MKM A;  5KKZ B;  5KLV E;  3M06 A;  5AVV B;  1LT9 C;  2WSF H;  3A2A A;  1XTG B;  3SFE C;  2A45 H;  2KLU A;  3P05 A;  4K3A A;  2XZ0 D;  2JYL A;  1IMP A;  3KZI H;  4XA4 A;  5L8R J;  2MR8 A;  1NTZ G;  1ZOY C;  4LC1 A;  3U1A A;  1P84 D;  3CCE P;  3DS5 A;  1S3J A;  3FX0 A;  3S9O A;  1EXJ A;  2JU1 A;  3AED C;  5KP7 B;  1KLP A;  1P84 E;  2BEZ F;  2Y9Y A;  3L75 J;  3N7N A;  4WVZ A;  1KQG B;  3AE9 C;  2Z4E A;  1OVR A;  5F2N A;  1J2J B;  3GF7 A;  2KZJ A;  4W7Z A;  5AVS B;  2FXO A;  1N86 A;  1QVF O;  1KYO D;  1T3J A;  1IO4 A;  2EIA A;  2B9B A;  1AUM A;  5AW0 B;  2FBW C;  3VTP C;  3H1L J;  3V2N A;  2QJY B;  2WT7 B;  2KW2 A;  3AE8 C;  4WBA A;  1FOS F;  2KGE A;  3WBH A;  3MHV A;  1KD1 Q;  1OMI A;  5KKZ C;  3S1K A;  1ACP A;  3CCM P;  2FYZ A;  5TJH A;  3G1G A;  3G3Z A;  5KAI E;  1FDO A;  5KTB A;  3H0D A;  5AVT B;  2DNW A;  3CE7 A;  1EZV I;  3D71 A;  2B88 A;  2AVA A;  4Y99 B;  4WB4 A;  3NTN A;  1MUU A;  1ZR2 A;  1IK9 A;  1Q86 Q;  3EQ2 A;  4C7N A;  3VP8 A;  5AVY B;  5F2K A;  3SWY A;  4C46 A;  1IFM A;  3W68 A;  2QVA A;  1BCC E;  3HE4 B;  1XTC C;  1GPJ A;  4RJT A;  3G29 A;  3H4E A;  4IL6 X;  4UB6 E;  1SQV J;  5CMZ A;  3MGE A;  1BSH A;  2Y0C A;  4I7Z B;  3P7K A;  2ZYG A;  1LTI C;  4B86 A;  4XFY A;  2AF8 A;  4UB6 H;  2N5I A;  1YTZ T;  4LGD E;  3H6P A;  3L37 A;  5CCH A;  2I8D A;  4IL6 E;  3R2P A;  5KLI B;  3L72 J;  1LWU A;  2H43 A;  3LID A;  3TGU E;  1GK6 A;  3E1I A;  1RHZ B;  2XT1 A;  3VRL C;  3AE2 C;  2A06 E;  2XU6 A;  1L0N E;  1K05 A;  2B87 B;  3A0H H;  2YNY A;  2W8Z A;  4HKZ H;  2IBZ I;  2PRR A;  1BGY E;  3A5T A;  1NU1 G;  5E79 E;  4PWV B;  5APY A;  2E5T A;  3PTZ A;  4H0L D;  3HD7 C;  1G1J A;  4U0A A;  1IFD A;  1FZE A;  3II6 A;  2E76 B;  5B5E H;  5AVZ B;  4I7Z C;  2JB0 A;  2WSS H;  1LWU B;  1VQ5 P;  2FAC A;  1OW7 A;  2M8R A;  1ZRT D;  2QG4 A;  1KB9 I;  5BS1 A;  3W67 A;  1JCD A;  1KIL E;  2X2B A;  2V7Q H;  4HKG A;  1QLE D;  2JDI H;  4M3L A;  3MD0 A;  2KIK A;  5KLI C;  1K04 A;  2E76 D;  2L6E A;  4LLH A;  3FGA D;  3RK2 C;  1URQ B;  4K35 A;  2ZT9 B;  2MF4 A;  1D1D A;  3V4Q A;  3L73 D;  1BGY G;  1W2B O;  3H1H D;  2FFD A;  3H1J E;  5GTI E;  2FXP A;  4OH8 B;  1RF1 C;  3H1K E;  3EJD A;  1L0N D;  5APV A;  3SWK A;  1EZV G;  1RF0 C;  2IDB A;  2KK7 A;  1L0N K;  3Q5R A;  1GXH A;  3TYY A;  4A7P A;  5APW A;  3CX5 D;  3CCS P;  4HJG H;  4DG9 A;  2R5D A;  3TGU G;  1QGK B;  2LOL A;  2A45 G;  2PEJ A;  2IYO A;  1BDC A;  2K0X A;  3I5C A;  3EFG A;  1GL2 A;  1SQB E;  2LXC B;  1H89 A;  1NQ4 A;  3BCC G;  3C9I A;  4GOD A;  2BCC D;  2YXR B;  1KV4 A;  2KUB A;  3CME P;  3VOP A;  5HGL A;  1MV8 A;  1JY3 P;  4GKG A;  1JCC A;  1FOS E;  2N1T B;  2H8P D;  1NU1 E;  3MUD C;  5H2F H;  3VP9 A;  3D70 A;  1VQ6 P;  1MFT A;  1X22 A;  3IF4 A;  2OYH C;  2LKM A;  1BCC G;  2K9J A;  5APT A;  1KB9 E;  2KP8 A;  4U0E A;  3EJB A;  1S5L X;  1P84 H;  3G9R A;  2KG9 A;  2WMM A;  1YIJ P;  2ZT9 C;  2KG6 A;  2JP3 A;  1BE3 E;  2KOG A;  2FFD B;  1T2K D;  2YO3 A;  4H2X C;  2EFJ A;  1URQ A;  3DS1 A;  2VLP A;  1QRJ A;  3TNU A;  2FYU G;  1KQL A;  1PZQ A;  3RK3 C;  1VQ7 P;  1YJ9 P;  2VRS A;  3VN0 A;  1SFC D;  2K9J B;  1X0T A;  1USE A;  1FE6 A;  3B71 A;  3IN6 A;  5AW4 B;  3L73 J;  3LIE A;  3L70 G;  1YYC A;  4WY4 C;  1KMI Z;  1UJZ A;  4GIF A;  3Q20 A;  4R4M A;  3B5N D;  1Y8A A;  4JBZ A;  2OAR A;  3H1H G;  4AUW A;  3KQG A;  2IFN A;  1H8A A;  1FJK A;  1L4A B;  2GUS A;  4RO0 A;  2ZXE B;  1NU1 K;  1H0T A;  2WZ7 A;  2K1A A;  3M0A A;  1M90 Q;  1H88 A;  2EG5 A;  3AEA C;  3E7K A;  3CXH H;  2JQ4 A;  1SQQ K;  2WIT A;  4WY4 A;  2E74 B;  1HUC A;  1NU1 D;  1RF1 A;  2GDW A;  3V2R A;  2POH A;  2JWD A;  3BCC D;  1SQP E;  2I1J A;  4IFM A;  5AW6 B;  1PEU A;  3C8V A;  4IL6 H;  2GDX A;  2P67 A;  2GZG A;  1SLQ A;  1SQB G;  3O6Q A;  5B66 E;  1NTK E;  3HE5 A;  2R3S A;  1NTZ D;  2Q7C A;  1EIA A;  1NTZ E;  3USS A;  3HTK B;  1MZ9 A;  1EMV A;  2E43 A;  1URQ C;  4NPF X;  5AVR B;  1W2E A;  1VDF A;  1ZXG A;  2MR7 A;  3CC4 P;  2FQ2 A;  2M5A A;  1T8Z A;  3EWK A;  2PEQ A;  1YQ4 C;  2Q3E A;  3U1C A;  3AEB C;  2FQ0 A;  1D7M A;  5AVX B;  4BPG A;  2SPZ A;  1L4A A;  3HYB A;  2QJP C;  3A0H E;  2ZT9 D;  1NVO A;  1ZW0 A;  2Q6Q A;  2M5R A;  3H1K D;  2FYU K;  1UNK A;  3CWB D;  3B5N C;  2P9X A;  3VMY A;  1AJY A;  2HG5 D;  5AW5 B;  1M1K Q;  2N50 A;  2Y0D A;  3FXE A;  4I1L A;  1SQX E;  1OFC X;  1NAF A;  3HE5 B;  1E6J P;  1FZA A;  3RL0 C;  4PH0 A;  3CI9 A;  4D6T J;  3B4Q A;  1E79 H;  3GZL A;  1M56 D;  2E42 A;  3CCV P;  5CCH C;  3H1J J;  1RF0 A;  3AEF C;  2AFD A;  1NTK G;  1S4X A;  2OTJ P;  3K5B A;  2FFD C;  3B5I A;  1PEQ A;  5AW8 B;  2O01 J;  2PEK A;  3HD7 B;  4NPE A;  1A02 F;  1FZF A;  5CJ4 A;  1UIX A;  4GT1 A;  1SQV E;  1ZNV A;  3L71 D;  1LTJ A;  2E75 C;  3C1L A;  1YIT P;  2ZJS E;  3AE7 C;  3PP5 A;  1NTM J;  4H2W C;  1ZR4 A;  2WSC H;  1JY2 O;  4GR6 A;  1L4A D;  2KOS A;  3TSI A;  2J5U A;  4XFZ A;  2R3C A;  1MZ8 A;  3CL3 D;  4U0F A;  2YIU C;  4IOI H;  1KTM A;  2CGQ A;  2D2C C;  4W80 A;  3LW5 H;  1OW6 A;  2NPS D;  3TGU D;  3MTU E;  3TK1 A;  3WUV A;  3WMM 0;  2MKV A;  1K73 Q;  4IPY A;  4IFD K;  2HR3 A;  5CCH D;  5AVW B;  3AE4 C;  1AQT A;  2BCC E;  1RF1 B;  3HD7 D;  1GZL A;  1JTH A;  2GDY A;  5AW2 B;  1OVV A;  4GDO A;  1FZC B;  1LTG C;  1JY2 N;  4N78 D;  7CEI A;  3CX5 E;  2K94 A;  1X9V A;  3CD6 P;  1BCC D;  2N9Y B;  1FDI A;  1E0H A;  4OVN F;  1JM0 A;  3RK2 B;  1RQV A;  4PH1 A;  1L0I A;  3RK2 D;  2O01 N;  5GTH E;  3H1H E;  5TIS H;  1PV3 A;  2AXT E;  3KDP B;  1FC2 C;  1VQP P;  1AYI A;  1SQB K;  2L5G B;  3VMZ A;  4YXW H;  3CPW O;  4H13 C;  1LP1 A;  5TIS E;  4RES B;  2FAD A;  3CCQ P;  1FAV A;  2NPS A;  3Q2Y A;  5KP6 B;  3DTJ A;  3CMA P;  1NHL A;  1EOQ A;  4L73 A;  1S5L H;  3L74 G;  1WRG A;  3PH0 A;  2N9B A;  2XV6 A;  3CXH E;  4R4L A;  4H44 C;  3TDK A;  2L0Q A;  2VSQ A;  3R4Y A;  3G1I A;  5HVC A;  3SFD C;  3V2Q A;  1HJ0 A;  4ZKP A;  4XFJ A;  4GOF A;  4NPD A;  3P32 A;  2LML A;  2QJK C;  2KGC A;  2FYU J;  2W6J H;  2JO0 A;  5CCG A;  3G6E P;  3H1K G;  3M0D C;  1OX3 A;  3HRN A;  4NEO A;  5KJ7 D;  5KLV G;  2K93 A;  5GTI H;  1PL5 A;  3AE1 C;  3PLN A;  1GL2 D;  2J59 M;  4JQ0 D;  3M9Q A;  1YI2 P;  1GU4 A;  2QA4 P;  1JOC A;  2QRX A;  2WPS A;  1FJP A;  2I1K A;  2OTL P;  2WSE H;  2KLV A;  1FR2 A;  2W90 A;  3H1I E;  4C7N B;  1SQB D;  2HLO A;  1L0L E;  1IFP A;  3HUS C;  1VQ8 P;  1PGQ A;  4TT3 H;  2YMY A;  2GZI A;  1DEB A;  2Y9Z A;  5CZD B;  3L70 E;  2E75 B;  1EZV E;  4WY4 B;  1SFC C;  2PEN A;  1NKZ B;  5APU A;  1PGP A;  5BU8 B;  1ZP0 C;  2WQY C;  5CHX A;  5BVZ A;  1G1I A;  1L4A C;  1DNY A;  1T3U A;  3I56 P;  5HGM A;  1JMB A;  1A8O A;  1LT9 B;  2E75 D;  1RE3 C;  2LR2 A;  3QH9 A;  3VYI A;  1SQQ J;  4COP A;  1N7S D;  1NKN A;  3DPH A;  2E5Y A;  2PEM A;  2KNC A;  1U57 A;  4JYC A;  3BVH A;  1K30 A;  1SQV G;  1RE3 A;  2EHS A;  4ZNC A;  1H0T B;  1KYO E;  2QJP B;  5BS2 A;  2LKI A;  2HFE D;  5GTH H;  4HYT B;  2CNR A;  3RL0 D;  2M8N A;  4BPF A;  4PJ0 E;  2GZE A;  3MUD A;  4PV1 B;  2WPR A;  1VQ4 P;  1HTL C;  1L0N J;  5KAF E;  4WWI A;  2M0B A;  2RKL A;  4EYY Q;  1HJB A;  5CJ0 A;  1IFI A;  3MP7 B;  5H2F E;  1WT6 A;  3BAS A;  1HWT C;  3G4S P;  2A06 D;  1SQB J;  4IZ6 A;  2BCC J;  1Q7Y Q;  1SQX J;  1PEM A;  2N1T A;  5B5E E;  1JJ2 O;  2KSJ A;  1LTA C;  3H1J G;  1GDT A;  1R5S A;  3UIA A;  3GW6 A;  2DW3 A;  3CWB G;  4U0B A;  2XV5 A;  5E79 H;  5KLV J;  4DT0 A;  3H1I G;  1J1D B;  2KOP A;  4CA3 A;  1BE3 J;  3BRV B;  2MVU A;  2K5X A;  2XZ1 C;  2PGD A;  2YO2 A;  1GTW A;  2WSF J;  2VLQ A;  1NTK D;  4EDF A;  1QVG O;  2Q1K A;  3RGU A;  1NAY A;  1KFM A;  1JY3 N;  3H1L E;  4YXD C;  3RBZ A;  3WU2 H;  4PJ0 H;  1KN7 A;  3OA7 A;  4PD4 D;  2AXT H;  5HV8 A;  4BRY B;  3OAK A;  5AVQ B;  4U0D A;  3WUT A;  1F80 D;  1NJI Q;  2WPV B;  1S9K D;  1BAJ A;  2G3A A;  2QM7 A;  2QNW A;  1LTJ B;  4H0L C;  2Z5H A;  2O1K A;  5BU5 A;  1VL2 A;  4PD4 H;  2GYK A;  3HUS B;  4JPZ B;  2JWA A;  2KOO A;  2N1T D;  5APX A;  4N6J A;  3V2P A;  3DS0 A;  4I6M C;  2WPQ A;  2WPT A;  2HYN A;  1SQX K;  4C7R A;  1LNQ A;  3KYQ A;  3SSU A;  2QSI A;  4PV1 D;  1YJN P;  3L74 D;  4DOJ A;  4UHP B;  2QIW A;  1G2C A;  3PHL A;  1CEI A;  1U7J A;  2KI7 B;  1FZC C;  2W27 A;  1JY2 P;  1K8A Q;  2HPC A;  1LTT C;  2CPS A;  1IJD B;  4H13 B;  2WT7 A;  2C9L Y;  2L22 A;  1VQK P;  1N7L A;  5CCG C;  4QMA A;  3CWB E;  3L73 G;  2OGU A;  3HTK A;  3G21 A;  1CI6 B;  1PP9 J;  3CCJ P;  2M8P A;  1SQV K;  1U7M A;  4U0C A;  1FDM A;  4PXH B;  2NRG A;  5CBN A;  1GW4 A;  1BE3 D;  4H44 B;  4H13 D;  3O8Z A;  2BQ1 E;  2MY5 A;  2NPS C;  5I4T G;  1ZV8 A;  2QJK B;  4MRT C;  3HD7 A;  1RE4 A;  1DD4 A;  1RNI A;  1AV1 A;  4EI2 A;  1AVO A;  3DS4 A;  4N78 E;  1IFN A;  2K0Y A;  2DGY A;  1L0L D;  1ZLL A;  2IBZ D;  2XKM A;  1IFJ A;  3CWB J;  3DS2 A;  3FXD A;  2Y0E A;  2JU2 A;  2V4H A;  3GLM A;  4ZMD A;  1KYO H;  2E74 D;  2G8Y A;  3L70 J;  1JB0 J;  1NH4 A;  3L75 E;  1DIP A;  5CBO A;  2R44 A;  4U7J A;  5K5G B;  3S4R A;  2OYI A;  3A0B E;  2UWJ E;  4D6T D;  1PGJ A;  2HPC B;  1USD A;  4AQR D;  2IX7 C;  1M1J B;  1SQP D;  1OR5 A;  2AEF A;  1SP4 A;  3NTE A;  4WYM A;  1HF9 A;  5M1B A;  1M1J A;  3ZDM A;  1SQV D;  3L71 E;  3P8C D;  1NWQ A;  4YTP C;  2FKW B;  2JJL A;  1KIL D;  4BPH A;  1FU1 A;  2XDJ A;  3CXH D;  3EFF K;  2ZXX A;  1AQ5 A;  3RL0 B;  2XNX A;  2H7H A;  5APS A;  3L72 D;  2YKP A;  2C0W A;  2HOD B;  1PP9 E;  1EDJ A;  3GG2 A;  2JYG A;  1N8R Q;  2OQQ A;  1HQB A;  2ERH A;  3CCR P;  3P8M C;  4U3F G;  3TNU B;  3LRY A;  2CK3 H;  2W6B A;  1ZMB A;  3B5N B;  1SVF A;  4BRY A;  2Z45 A;  1RY3 A;  2WTY A;  1SQX D;  2RMZ A;  2JO1 A;  2IYP A;  2FVF A;  3ITK A;  1URQ D;  3BCC J;  4OGQ C;  1PPJ E;  3GKL C;  4PV1 C;  4UB8 H;  1M57 D;  2KS1 B;  4UB8 E;  1EQ7 A;  1HBW A;  1N7S C;  3U59 A;  1L0L J;  2WVR A;  1KB9 D;  3JCU H;  1Q82 Q;  1PP9 G;  1L0N G;  5KJ7 A;  2XZR A;  2KR5 A;  1HGV A;  1JTH B;  1KZU B;  5DJT B;  4HH2 A;  2KZI A;  3CCU P;  3B8E B;  3H1I D;  3NFQ A;  3AE3 C;  3VMX A;  1LT1 A;  2K3R A;  1LTS C;  1GD2 E;  2GA1 A;  2KOQ A;  1S5L E;  3JC2 2;  3B5N A;  2JKV A;  2BEQ D;  2KSE A;  1BSN A;  2KWL A;  1LT9 A;  5KLV K;  2A45 I;  3GF3 A;  3AE5 C;  1Q2N A;  1S72 P;  3CC7 P;  3GHG A;  1E5W A;  1VQ9 P;  1KFN A;  1YHQ P;  1PPJ D;  1X79 B;  3V6I A;  3PJS K;  5C39 A;  2FVE A;  4WY4 D;  1OWA A;  4EOT A;  1R5L A;  3H1L G;  3KPE A;  2RH0 A;  1IK7 A;  1N7S B;  1CZQ A;  2YKO A;  4U3F J;  3RL0 g;  3NY7 B;  2M8L A;  1NTM G;  2QJY C;  1J1E C;  2N98 A;  1VQO P;  2IPP A;  3IFM A;  5EFW B;  1OVU A;  3H1J D;  1FBM A;  1ZRT E;  2FYU D;  1LGH B;  2WSE J;  2O1J A;  3OW2 O;  3MZW B;  1IMQ A;  4GOE A;  3M9H A;  2LF4 A;  1OXZ A;  1JNM A;  2MD9 A;  2QEX P;  4Z1M H;  1VF5 B;  1OIP A;  3P8C E;  2O3J A;  2LTE A;  3RG2 A;  1M6E X;  2BAS A;  3KHU A;  2PEO A;  3MIW A;  1N73 A;  1PFI A;  1WMK A;  3TF5 A;  2L9F A;  2P58 A;  1CSB A;  2JR8 A;  4BWN A;  1GK4 A;  4D6T E;  2M5A B;  3AE6 C;  3H1I J;  5F2O A;  1QEX A;  4PD4 I;  3BRT B;  1KB9 H;  1BE3 G;  2PFX A;  2BUO A;  1EDI A;  2D2C B;  1BGY D;  1J1E B;  1KQS O;  1EC5 A;  1GXG A;  1BXI A;  1LP1 B;  3H1K J;  4F37 A;  1SQP K;  3BCC E;  3D6Z A;  5AW3 B;  4KHX A;  1SQQ D;  2Q9I A;  1BDD A;  3L72 G;  4DJG A;  1OZH A;  2JGP A;  3NXS A;  3VMA A;  1P84 I;  2HOD A;  2ONT A;  1AFO A;  4YPC A;  1EXI A;  1LJ2 A;  4OGQ B;  1A43 A;  2FAE A;  4COC A;  3F5H A;  2R5B A;  2JEE A;  2ZYD A;  2PY8 A;  3L74 J;  1KYO I;  1Y9B A;  3H47 A;  5KAI H;  1NU1 J;  3F89 A;  3WUU A;  1DEE G;  2Z44 A;  4H44 D;  1LTB C;  1QX8 A;  3CCL P;  3JSV C;  1FZG A;  1VHN A;  2ZYA A;  3KZI E;  5AW7 B;  5HGN A;  1M8O B;  3HUS A;  3U43 A;  3CXC O;  2YKQ A;  3ABV C;  1ZN5 A;  3T97 A;  2Z5I A;  1GL2 C;  3GJN A;  1L2P A;  1JY3 O;  4L76 A;  2IZ1 A;  1LWU C;  1X3O A;  1RQU A;  2JBG A;  4Y28 J;  3DS3 A;  4OGQ D;  2WSC J;  1YJW P;  3TGU J;  5APQ A;  4XRO A;  3L72 E;  1G2C B;  3PRJ A;  2E74 C;  3AEC C;  3M0D A;  2E1M A;  1T8K A;  2KOD A;  1TU3 F;  2GZF A;  3L71 G;  2FHS C;  1RE4 C;  1NTM K;  1PEO A;  1IUQ A;  3H25 A;  3GHG B;  1DD3 A;  1HVV A;  1BCC J;  1YBK A;  2FY8 A;  3A3Y B;  1HH0 A;  1NTK J;  2LPK A;  2ITA A;  1M7L A;  2VLO A;  2QM8 A;  4CPG A;  2C9N Y;  2KXP B;  1GMJ A;  1VF5 D;  2N5H A;  1GL2 B;  2M3B A;  1SQP J;  2D2C D;  3L75 D;  2LXB A;  1GU5 A;  2FYN C;  1SQQ E;  2AEJ A;  4L75 A;  2PNG A;  1DV5 A;  2PAJ A;  2ZVO B;  3D6Y A;  3H1H J;  4XE5 B;  1FZC A;  4IFF A;  1J1D C;  2YXQ B;  3QWO C;  3RG6 C;  2AXC A;  2XXM A;  1KQF B;  3RK3 B;  2OYH B;  4AYC A;  5DCK A;  2V7Q J;  2LIW A;  1VKU A;  2FQ1 A;  1SS1 A;  1HY8 A;  3LW5 J;  4ASV A;  5KAF H;  2OYI C;  2KOR A;  5EJD A;  1Q81 Q;  3M91 A;  4JF7 A;  1M6N A;  3AEE C;  1SQX G;  5B66 H;  2ZAE B;  4U3F D;  1Z6M A;  2P2U A;  2H89 C;  1VQN P;  1Z56 A;  1AF8 A;  2IFM A;  2YMK A;  2KNC B;  5AW9 B;  3L73 E;  1T6A A;  4W7Y A;  3GZM A;  3MGN A;  2R32 A;  1UII A;  1IZN B;  2KG8 A;  1W5C E;  1EDL A;  4Y99 C;  2MJZ A;  2K0D X;  2BCC G;  2FXM A;  1S1C X;  4H0L B;  2W83 C;  3V5B A;  5JPA A;  2CPB A;  4HB1 A;  1PP9 D;  2VLN A;  3G26 A;  2PP6 A;  2FYU E; 
#chains in the Genus database with same CATH homology
 3DTJ A;  1EIA A;  4GR6 A;  1EOQ A;  3HZQ A;  4COP A;  2M8P A;  3G71 P;  3CMA P;  4U0C A;  3CCM P;  3DPH A;  2ONT A;  2XV6 A;  1VQ5 P;  3G1G A;  2PEM A;  5BS1 A;  4XFZ A;  2EFJ A;  3DS1 A;  1QVG O;  3H0D A;  4U0F A;  2M8L A;  1QRJ A;  3CC2 P;  2BQ1 E;  1M74 A;  2JYG A;  1N8R Q;  1A43 A;  3CC4 P;  4GR2 A;  4COC A;  1K30 A;  3G1I A;  3CCR P;  1VQL P;  2PY8 A;  3LRY A;  1Q86 Q;  4XFX A;  1VQO P;  2PEQ A;  3I55 P;  5I4T G;  3G0V A;  1VQ7 P;  1ZMB A;  1YJ9 P;  5F2K A;  2BHV A;  1K73 Q;  2Z45 A;  2L6E A;  3E2D A;  3H47 A;  1KC8 Q;  5BS2 A;  3HYB A;  1RNI A;  4IPY A;  3OW2 O;  3G29 A;  3H4E A;  2Z44 A;  4U0D A;  2JO0 A;  1VQM P;  3DS4 A;  1D1D A;  4XRQ A;  1NJI Q;  3G6E P;  1W2B O;  4QNB A;  3MGE A;  2M8N A;  2LF4 A;  2DGY A;  2QEX P;  4XFY A;  1RO0 A;  3CCL P;  3RG6 C;  1BAJ A;  1VQ4 P;  3DS2 A;  2XXM A;  5HGO A;  2P9X A;  5DCK A;  3P05 A;  3Q20 A;  1Q82 Q;  1M6E X;  1M1K Q;  2PEO A;  5HGN A;  2JYL A;  2OAR A;  3CXC O;  3CD6 P;  3CCS P;  1YI2 P;  2QA4 P;  1K9M Q;  1Q81 Q;  3DS0 A;  1M6N A;  2PEJ A;  3CCE P;  2OTL P;  3DS5 A;  1E6J P;  2XT1 A;  3VRL C;  4PH1 A;  4PH0 A;  3CCU P;  3G4S P;  1VQN P;  3M1M A;  1M90 Q;  3DS3 A;  5F2O A;  2EG5 A;  4M0I A;  1YJN P;  1VQ8 P;  3CME P;  1YJW P;  3CCV P;  5HGL A;  4XRO A;  1RO2 A;  1Q7Y Q;  5F2N A;  1VQP P;  2BUO A;  3G28 A;  1PEM A;  1JJ2 O;  2PEN A;  1QVF O;  1VQ6 P;  1K8A Q;  2OTJ P;  2EIA A;  2Z46 A;  3NTE A;  4WYM A;  1KQS O;  2E1M A;  1AUM A;  1VQK P;  3B5I A;  1PEQ A;  2KOD A;  1S72 P;  3CPW O;  2PEK A;  3CC7 P;  1PEU A;  5JPA A;  4U0E A;  4U0B A;  1PEO A;  2PEI A;  4U0A A;  1IUQ A;  1VQ9 P;  3G21 A;  3G26 A;  3WBH A;  3I56 P;  5HGM A;  3CCJ P;  1YHQ P;  1YIJ P;  3CCQ P;  1YIT P;  1A8O A;  2CWO A;  1KD1 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...