1YJ9P

Crystal structure of the mutant 50s ribosomal subunit of haloarcula marismortui containing a three residue deletion in l22
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S Ribosomal RNA
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
molecule tags Ribosome
total genus 43
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2005-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1yj9P03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1yj9P01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1yj9P02
1KD1Q 1YJWP 3CMAP 3I55P 1YHQP 1QVGO 1K8AQ 1VQMP 3CPWO 1VQ7P 1VQOP 1M1KQ 3CXCO 3CCJP 1KC8Q 2QEXP 2OTLP 3CCMP 3I56P 3CCQP 3CMEP 1Q86Q 3CCSP 1JJ2O 1VQ5P 1NJIQ 3CD6P 3CC7P 1VQLP 1YJNP 1W2BO 1Q81Q 1VQKP 3G71P 3OW2O 3CCUP 1YJ9P 1YIJP 1M90Q 1VQ9P 3CC4P 1QVFO 3CC2P 1S72P 1VQNP 3G4SP 3CCRP 1VQ8P 1VQ6P 2QA4P 1KQSO 3CCVP 1YI2P 1Q82Q 1K73Q 3G6EP 1VQPP 1N8RQ 3CCLP 2OTJP 1YITP 3CCEP 1Q7YQ 1VQ4P 1K9MQ
chains in the Genus database with same CATH superfamily
1EZVG 2KG8A 1SVFA 5KJ7C 2Q7CA 4H44B 3GG2A 1H89A 2K92A 1SQBG 5KJ7A 1NTZK 1DEEG 1YJNP 4H44C 2CG5B 1SQPJ 2WTYA 3SWYA 2BHVA 3CCVP 5GTIH 1KTMA 1U57A 2GDXA 3JC22 4I6MC 1NTMG 2Z44A 4CPGA 3GHGA 5AVSB 2O1KA 2JKVA 2WPQA 2IFNA 5AW8B 1FDMA 1KB9D 2FYUG 1L2PA 1YIJP 2ZVOB 1NTKE 2EG5A 2MF4A 1JMMA 4AQRD 2JQ4A 1ZMBA 1AV1A 2Y0DA 2OTJP 2M8RA 3RL0g 4HJGH 3OJAB 1AVYA 1FOSF 3HD7D 1KYOH 2E5TA 2X2BA 3A7OA 1OXZA 1HH0A 5CJ4A 1T3UA 1JTHA 2ZVNB 2IZ1A 2BCCG 4JBZA 1USDA 4HKGA 3H32A 5KAFH 3EJEA 1IFDA 2PEJA 4CA3A 3AEFC 4DCKA 1NAYA 3QH9A 2R5BA 1FZGA 2QJKC 3L72E 2GZGA 3AE3C 3AE1C 3IF4A 5E79E 1BCCE 1E5WA 2MJZA 1YQ3C 2YIUB 2MR8A 5F2OA 4U3FE 4DG9A 1M1JB 2O01H 2FVFA 4OWFA 5HGNA 1W5CE 3MGEA 1H8AA 2JDIH 3O6QA 2XNDH 2M0BA 1VQ7P 2M3EA 3PP5A 4IL6E 1SQBE 1BE3D 1XTCC 1UJZA 2UWJE 4M0IA 1JOCA 1FBMA 1IZNB 2E75B 3Q5SA 2QJPC 2QJYB 1OR5A 1NTME 1URQB 1USEA 2E75C 4H13D 3S9OA 2QJYC 4PV1B 2OYIB 3CCMP 1GZLA 1LTTC 2XZ1C 3ABVC 2FYUE 2ZAEB 2CPSA 3KXDA 2OYIC 5AW2B 2WPSA 5EJDA 1KILD 1NTKK 3EJDA 2C0XA 1KFMA 1LWUC 1N2DC 1L0IA 4UB6H 3CWBJ 1SQVG 3H0DA 1LWUA 4ZKPA 2YKPA 2WSFJ 1JNMA 2NPSD 1Y47A 1M90Q 2JWDA 2VLPA 3B4SA 4TLFA 1HBWA 3SWFA 3DPHA 4U0FA 1S3JA 2KNCB 3HTKA 1HF9A 1KQGB 1A8OA 1KILE 2FYNB 3KDPB 3V2RA 5AVWB 1YBKA 1T6AA 3Q2YA 1FS0E 2KSJA 1L0NJ 3GMAA 1K04A 1NO4A 1RH5B 4U7JA 1N86A 1LTIC 2K9JA 3AECC 3H1LD 2WSEH 1IFPA 4C7NA 2J59M 2WT7A 1R8EA 2PY8A 1SQBK 3DS1A 1OVVA 1VF5D 4H2YC 3P8CD 2ZT9B 3HE5A 1BE3J 2ZFCA 5KP7B 1GL2D 1SQQG 4PD4H 1U7MA 2ZT9C 4PH1A 2OYHC 4AUWA 1N7SB 4YTPC 2QE7H 3H1LE 1JMBA 1ZRTD 2OYHA 2FFDC 2FYUK 4BXLA 3W68A 3CC2P 2ZJSE 2YKOA 3GZLA 1JY3P 1PEMA 2FFDA 2M5AA 2PRRA 2PFXA 3P8CE 3D6ZA 1HVVA 2I1JA 1P84I 5KP6B 3DTJA 4C46A 1KC8Q 3EFGA 1H88A 3AE7C 1Q86Q 2GM4A 1Z56A 1S9KD 2XT1A 2HPCA 3D70A 2RN0A 1W2EA 3GF7A 4I7ZC 3H1KD 4WYMA 1JB0J 2KB7P 1JO5A 3BVHA 1L0LD 1L4AB 1ZRTE 2P67A 2O01J 3CCLP 2CWOA 3FGAD 5H2FH 1RE3A 3RBXA 4D6TG 1T3JA 1KORA 2L22A 2M3BA 1BGYG 1NJIQ 3HUSC 4WB4A 1VQKP 5C39A 1VQ9P 3QWOC 3G4SP 2R3SA 1RE4C 1S9KE 3HUSA 3KYQA 2J5UA 3M91A 3H1KE 3L75G 2ERHA 1R5LA 2KIKA 2FAEA 2K5XA 4PD4D 1L0LE 5AVYB 5B5EH 1RE4A 2CNRA 1QX8A 1YTZI 2KLVA 1MUUA 3WBHA 1Q90D 5I4TG 1LT9B 1FZCA 1RQUA 1NWQA 1OVUA 1K9MQ 3RK2C 2EHTA 1SP4A 1KILC 3AEAC 1IK7A 1GW4A 3HYBA 1NU1J 3AEDC 1KILA 3CC4P 5AW5B 5KLVG 2Q6QA 1YI2P 4Y28J 1LTBC 3L74J 2KOOA 3H4EA 1NYHA 2I1KA 1QVGO 4H44D 4WWIA 2WSCJ 3H47A 5BU8B 1QLED 3L73E 4OGQB 2VRSA 1SQVK 2Y0CA 1EDLA 1FZBA 2HFED 1EDIA 2A45H 1M57D 2W83C 3VOPA 3O8ZA 3N7NA 2D2CB 1AQ5A 1OW8A 1FZAA 2N1TB 3FX0A 3E1RA 1X8YA 3Q5PA 1PEOA 1WT6A 5AVRB 2N1TC 3MTUE 4D6TE 2XV6A 3V5BA 1EC5A 1EXIA 3H1JJ 2N1TA 1RNIA 2VLOA 2JU2A 3NMDA 1M7LA 1MFTA 1AF8A 3L75E 2JO1A 1DH3A 4GR2A 2KG9A 1YITP 2KOSA 1NTZD 4BPGA 4WY4B 3CCJP 2WQYC 4BRYA 2YXRB 4GKGA 4GIFA 1M8OB 2EFJA 4WY4C 1GL2C 2V4HA 3FXDA 4C7RA 1RF1A 3L70D 1GL2A 3FWLA 1M6NA 1SQQK 2Z5HA 2IZ0A 1E79H 2WVRA 1NTZE 1JJ2O 1LT1A 2H88C 2Q3IA 1T8KA 2Z46A 1OZHA 2Z5IA 2A06D 1PZQA 4ASWA 1HGZA 3FWNA 2SPZA 3VMXA 3H1ID 1KFNA 3L70E 3VP9A 2E74B 2QSIA 3I56P 5GTHE 3AE9C 1X9VA 2XZ0D 4DZOA 2N98A 1J1EC 1LTJC 2POHA 3HZQA 2E75D 3RGUA 1LTJA 4OH8B 1PP9J 1H0TA 1PFIA 3VRLC 3B5NB 2BASA 4HH2A 1SQXJ 1VDFA 1K8AQ 4GDOA 2AFEA 3CXHD 3CLQA 2PNGA 3U1CA 1RO0A 3VMAA 2E1MA 1LTSC 1S72P 1RQVA 2P1JA 2J58A 1AFOA 3F5HA 2N5HA 1NKZB 5E79H 1OWAA 3A0HE 2C9NY 1YHQP 1DX7A 1DEBA 1WRGA 1KQLA 5CMZA 1BDCA 3CXHE 5K5GB 2LXBA 2QRXA 3CE7A 3V4WA 1BAJA 2MVUA 1FJPA 3F89A 3VN0A 4IFMA 4IL6H 2EHSA 2R3CA 4L75A 4WBAA 3CWBG 3L71J 2N9BA 4GOFA 3M1MA 2KZIA 2LMLA 1NTKD 1W2BO 4IFDK 4XROA 2KG6A 1FZEA 4XRQA 2HYNA 1XTGB 5KLVK 1OIPA 4L73A 2B89A 3KQGA 2E76B 1U7JA 1KZUB 4EIJA 3U1AA 3NY7B 3JCUE 1L0NG 5L8RJ 3H1HG 2DNWA 2N6ZA 3H1IJ 2PGDA 1Y9BA 3G1GA 5M1BA 1KYOI 2ZT9D 5DCKA 3L72D 1IO4A 3VTPC 1BCCD 3RK3B 3G28A 4IL6X 4BPHA 4U3FD 3RBZA 1JM0A 2QG4A 4IOIH 3M0DC 1EDKA 5APWA 1EZVD 3WUUA 2KUBA 3LRYA 3EJBA 2FBWC 2ZYDA 3M0DA 1SQBD 2PEIA 1RHZB 3N4XA 2H7HA 2JYLA 1GK4A 3V2NA 1HUCA 1JY2O 2MKVA 2I8DA 5CBNA 3A3YB 5F2KA 1NTMD 2KXPB 2R44A 1SFCB 3NTNA 5CCHC 2YIUC 2JO0A 4LLHA 2Y9ZA 2IFMA 4R0MA 1M1JC 2KP8A 2PEQA 2HLOA 1EZVE 2IYOA 2KSEA 5CCHA 3GJNA 3C8VA 2FYUD 1M1JA 1T8ZA 2L6EA 1M6EX 1QL1A 3PTZA 3KZIE 3G71P 3GW6A 2IPPA 4F37A 1IJDB 2Q9IA 4UB8E 1PEQA 1PGJA 3A5TA 2BCCD 3H1HE 3DS5A 1PGOA 1AQTA 3CX5I 1URQC 2P2UA 2YXQB 3SSUA 4HB1A 2K9YA 4IZ6A 3R4YA 2V7QH 4PV1C 1KMIZ 3RK2D 1URQA 2B87B 1G1JA 2PENA 3DS3A 5HV8A 2LIWA 3H25A 2AXTE 4L74A 2OYIA 2EIAA 2YNYA 2VSQA 1UIIA 2W6AA 3L72J 4PJ0E 2YMYA 3L37A 2MD9A 2FQ2A 2BCCE 3K5BA 3A0BH 4U3FJ 1PPJG 1LP1B 1N7LA 5AW9B 4W7ZA 4OGQD 2CQ8A 4DOJA 1KN7A 1A02J 1JEKA 3AEBC 3CI9A 1NU1G 2L91A 2M8LA 1SQBJ 2FYNC 3P32A 2KNCA 2N1TD 5AW0B 3WU2H 2PAJA 3L74G 1GTWA 2WSSH 4K3AA 1GU4A 2KW2A 3NTEA 1NTMJ 2WPRA 3FXEA 5DJUB 4XFJA 3VP8A 3M0AA 3HE4B 2LL8A 2FXMA 2FYUJ 1QVFO 2WITA 1ZXGA 1UNKA 2ZXXA 1SQVD 4LC1A 2JEEA 4K35A 4WY4D 3LMOA 1OW6A 3H1JG 3AE2C 4M3LA 1L0NK 2KGAA 2JR8A 2K94A 2YO3A 2MR7A 4XFXA 1N7SC 1IUQA 2FVAA 2AF8A 2PP6A 2JGPA 2IBZI 1N7SA 3AE4C 2KORA 3TK1A 3HD7B 1SQVE 5KLIB 4DJGA 2KLUA 2PEMA 1G1IA 2BUOA 4PXHB 3MHVA 2GA1A 2KYVA 3CCRP 3GLMA 2K0XA 3A0BE 1VQPP 5APUA 3CX5E 2GZFA 4H0LB 4R4LA 2QVAA 1L4AC 4H0LC 3EWKA 4Y99B 4HYTB 1VQ5P 1L4AA 4YPCA 1X0TA 3L74E 1SQQD 4Y99C 2ZYGA 3EQ2A 2IBZG 4L76A 2WPTA 4EOTA 3DS2A 3WU2E 4PH0A 3I55P 2P58A 2FKWB 3V4QA 2KS1B 5HGMA 2FVEA 2O3JA 2Z45A 3BCCG 1PP9G 3H1LJ 3TNUB 5KKZB 4N78D 5AVVB 1SQXG 1SQQE 3L73D 2KGCA 2M8PA 1ZP0C 2V7QJ 4XFYA 4EDFA 1LT9C 1IK9A 1BXIA 2WMMA 1G2CB 2LOLA 2G8YA 2G3AA 3BATA 3H6PA 4EYYQ 2KODA 1LT9A 2FHSC 5TISE 3TYYA 1CI6B 2FXOA 2C9LY 4ZMDA 4D6TD 1N8RQ 2A45I 4N78E 5GTHH 1BGYD 2ZXEB 2H89C 2K1AA 2KGEA 1NQ4A 1GK6A 3TGUG 1BDDA 2C0WA 2NPSB 1P84D 3L75D 4OGQC 4ZKUA 1WMKA 1PV3A 2LPKA 1NH4A 2DGYA 1R5SA 3L71G 3MP7B 2D2CC 4COPA 1KQFB 3PHLA 3H1KJ 1M1KQ 5JPAA 1L0LJ 2E5YA 1BGYE 2P7JA 1S2EA 1NU1K 2GUSA 1SQPG 2IBZE 1LGHB 4TT3H 2KR5A 1A02F 2WSEJ 2LIUA 2A45G 2OTKE 1P84E 3A0HH 2AFDA 1BSNA 3MUDC 3V6IA 1HQBA 4BWNA 3RK3D 1ZR2A 4NPFX 2M5RA 1IC2A 1YQ4C 4BPFA 3CXHH 5AW1B 5KLVD 5AVZB 3A2AA 1PL5A 3BCCE 2LTEA 5APYA 1GXGA 1GU5A 3MIWA 2RH0A 4ASVA 1NAFA 1SQXE 2HR3A 1Z6MA 5AW3B 1J1DB 1S5LE 4WY4A 1VKUA 3T97B 3RL0B 1ZR4A 4U0DA 1VQMP 5CZDB 3CXCO 1EOQA 1IFMA 3RK3E 5CCHD 3VMYA 2CK3H 1GXHA 3RL0C 2XXMA 3L73J 5APXA 3P8MC 1A43A 1HTLC 5KLVE 1PGPA 1HWTC 3C1LA 3PH0A 3AEGC 1OW7A 5EW5E 3BRVB 4KHXA 3JCUH 1HGVA 3ITKA 3S4RA 1VHNA 5CHXA 3TGUE 2VLNA 2BEZF 1DNYA 2E74C 2YO2A 2QNWA 4IPYA 2AEFA 4O9BA 3D71A 2CGQA 3BASA 1URQD 1J2JB 3L75J 3PRJA 2K37A 1KB9I 4Z1MH 1VQOP 4PV1D 4GODA 2P10A 1D1DA 3IN6A 3E2DA 1SQPE 2XDJA 3B5NC 3B5IA 3V2QA 3PJSK 3VYIA 1L0HA 5KTBA 3G1IA 2WWWA 3D6YA 3B5NA 1DD3A 1NVOA 4N3YB 5APTA 1Q82Q 4YXWH 1CZQA 3Q20A 2H8PD 2O1JA 1CW5A 2HODB 4COCA 1NKNA 1IFJA 2XNXA 3R2PA 2K88A 2L4BA 4LGDE 2JWAA 1QRJA 2Z4EA 1NTZJ 4U0AA 1LTGC 2Q3EA 3MZWB 1IMQA 1DV5A 1FDOA 1SQXK 2B88A 3W67A 1JY2N 4AYCA 2KI7B 1GPJA 1TU3F 3PLNA 2OYOA 3CMEP 3KZIH 3L70J 1OFCX 1JY3O 4W80A 4JYBA 2K93A 5B66E 4UB8H 3I5CA 3U43A 3U59A 3SFEC 2LF4A 5TJHA 1CEIA 2K2QA 2E76C 3NXSA 3GHGB 2CPBA 4U0BA 4NEOA 3L4FA 2AXTH 2RMZA 1K05A 2GDWA 3GHGC 1NGMB 4GR6A 2KZJA 2LXCB 1QL2A 4I1LA 1YJWP 3CMAP 4PJ0H 5CCGC 1LTAC 1N7SD 5KAIE 1QEXA 4WVZA 1QGKB 3RK3C 1VQLP 5CCGA 1SQPK 1JTHB 3CWBD 1BE3G 2JBGA 3H32B 1MKMA 2N5IA 2YKQA 2L9FA 3DS4A 2MVVA 1FDIA 3BRTB 4EI2A 2QJKB 5BS1A 2XZRA 2WPVB 4XFZA 2KWLA 1KB9E 2AVAA 1L4AD 1OX3A 1L0ND 2R5DA 4H0LD 3GZMA 3CWBE 3G3ZA 3H1HD 1PGQA 2FADA 1PIXA 3NFQA 1LJ2A 1GD2E 1SFCC 2NRGA 3O6QB 4UHPB 3L36A 5AVXB 3LW5H 1SFCA 3II6A 4RKUJ 2IDBA 3Q3DA 2FQ0A 2ROQA 5BVZA 3RG6C 1NTKJ 1LNQA 2VLQA 4OVNF 1L0NE 5EFWB 2GUVA 1D7MA 4NPEA 2PEKA 5CBOA 2QJPB 2JJLA 3AE5C 4A7PA 2JYGA 1VL2A 1VQ8P 1EXJA 1UIXA 2XKMA 5HGLA 1OMIA 1S4XA 1S1CX 2XU6A 5GTIE 1KYOD 1T2KD 4XA4A 3WUVA 3G0VA 4MRTC 2B87A 3M9QA 1BCCJ 3H1LG 1ZLLA 2R32A 3TDKA 1LWUB 4QMAA 1BE3E 5AW7B 1FJKA 3CX5H 2KOQA 2K0YA 4RO0A 2N50A 3OA7A 2P9XA 5APQA 1AYIA 1FE6A 3HTKB 3G29A 4KJMA 1KYOE 2KOPA 2JP3A 2JAZA 1GDTA 1EDJA 1LP1A 2D2CD 1VQNP 2WSCH 1EIAA 1E0HA 5KAFE 1FAVA 2QM7A 1GMJA 4W7YA 3B8EB 5AW4B 2ZYAA 1YTZT 5APSA 3DS0A 2K9JB 4MN4C 3SWKA 2L0QA 3E7KA 1SLQA 3H1HJ 1AJYA 4C7NB 4B86A 2WT7B 1X3OA 4PD4I 1ZMEC 2L5GB 2Y9YA 2K0DX 2KK7A 3LIEA 2FACA 3H1KG 3HE5B 3HE4A 1L0LG 5BU5A 5DJTB 1PPJD 5TISH 3CCSP 2BCCJ 3B71A 3CX5D 2QA4P 2OYHB 3RL0D 1NU1D 1NTMK 4RESB 1M74A 2GZJA 1ZW0A 2FFDB 2M5AB 3CCQP 3L74D 3KPEA 3CC7P 3HD7C 2DW3A 3OAKA 4IFFA 1FU1A 3L35A 5KLIC 1PPJE 1AVOA 1HY8A 1PEUA 2HPCB 1KQSO 2WZ7A 2LKIA 1FZFA 1K73Q 3HD7A 1KV4A 2E74D 4I7ZB 2YMKA 2ONTA 1NU1E 4UB6E 3L73G 4YXDC 5AVTB 3E1IA 1DIPA 1Q2NA 1P84H 1X22A 1RE3C 5AW6B 3H1JD 3AE6C 2N6YA 3LW5J 3B5ND 3S1KA 3EFFK 4U0EA 4JYCA 3HUSB 2LR2A 5KP8B 1KLPA 4PWVB 2K3RA 1FOSE 3TSIA 2XV5A 4JQ0D 1YJ9P 1ZN5A 3CCUP 1S5LH 1CSBA 5BS2A 2FXPA 2KS1A 1Q7YQ 2OQQA 3G9RA 5F2NA 5KKZC 1JUNA 4H13B 3H1JE 1FZCB 4H2WC 3USSA 1SQVJ 1BSHA 3TNUA 1IFNA 4H13C 1FZCC 1T2KC 1JY2P 3RK2B 3P05A 1EQ7A 1KILB 3G6EP 2IYPA 1X79B 3GF3A 4H2XC 1SS1A 1G2CA 1KD1Q 1AA0A 2Q5UA 4PD4E 2FY8A 2IBZD 5APVA 1NTZG 1CI6A 4QKOA 3TF5A 4KT0J 1RF0C 5KJ7D 1S5LX 2NPSC 2AXCA 2W6BA 2OARA 2E76D 1RF0A 3SFDC 1FC2C 5HGOA 2KOGA 4NPDA 3L70G 2NPSA 2GZEA 3BCCD 1PP9D 3G26A 1EMVA 1SQXD 1AUMA 3RG2A 3OW2O 1OVRA 5CCGD 3CXHI 1HJBA 1RY3A 4XE5B 2HG5D 4I2LC 3M9HA 5AVQB 3V2PA 2Y0EA 3CPWO 2A06G 1SQQJ 3MUDA 3WUTA 3KHUA 5H2FE 2RKLA 1ZV8A 3CD6P 1M56D 3H1IG 4BRYB 1IFIA 3MD0A 1YYCA 1PP9E 1GW3A 4R4MA 3LIDA 3CL3D 2BEQD 5HVCA 1VF5B 4GT1A 1K30A 3TGUD 2ITAA 1RF1B 1NHLA 1VF5C 2AEJA 3GKLC 1GL2B 2QEXP 1MFZA 2OTLP 1L0LK 1J1DC 5B5EE 1ZNVA 1RF1C 1E6JP 5B66H 2W90A 1Q81Q 3L71D 1VPCA 4DT0A 1SFCD 3T97A 4N6JA 5AVUB 1VQ4P 1IMPA 4GOEA 3P7KA 3JSVC 4ZNCA 1SQPD 2JU1A 1JY3N 1JCCA 3HRNA 4D6TJ 1N73B 2W6JH 2GZIA 1MV8A 1MZ9A 1BGYJ 2IX7C 1HJ0A 2W27A 2E42A 2FQ1A 3Q1MA 1VQ6P 3AE8C 2OGUA 1N73C 7CEIA 3AEEC 2KGDA 3L71E 2GDYA 3CCEP 3M9BA 2B9BA 2GYKA 1J1EB 1LTJB 1ACPA 1H0TB 1N73A 5KAIH 3G21A 3M06A 2Q1KA 2H43A 2M8NA 3Q5RA 3IFMA 3BCCJ 2QM8A 3IR9A 1NTKG 3C9IA 1FR2A 2A06E 4U0CA 1RO2A 3IAOA 1JCDA 3B4QA 2MY5A 1Y8AA 1EZVI 2AEMA 2BQ1E 3H1IE 1MZ8A 2QIWA 3ZDMA 1KB9H 2JB0A 4JPZB 1ZOYC 4QNBA 5KLVJ 2LKMA 3UIAA 2FYZA 2NO8A 2HODA 1DD4A 2WSFH 2W8ZA 3WMM0 2PEOA 3L72G 4HKZH 1BCCG 4RJTA 3TGUJ 2N9YB 3MGNA 2O01N 4U3FG 1NOHA 1F80D 3VMZA 2E43A 2NZ2A 5CJ0A 4JF7A
chains in the Genus database with same CATH topology
1KD1Q 4COPA 3CMAP 1YJWP 1YHQP 1M74A 1VQ7P 2JYLA 1VQOP 1M1KQ 3CCJP 3G0VA 5JPAA 3CCQP 1D1DA 3E2DA 3B5IA 2EFJA 2PY8A 2M8LA 1VQ5P 3DS1A 3CC7P 1VQLP 3WBHA 3G1IA 1YJNP 4M0IA 5F2KA 1VQ6P 5I4TG 2BHVA 1PEUA 1BAJA 2JO0A 1KQSO 3CCVP 1K73Q 1Q82Q 2PEQA 2OARA 3DS2A 4PH0A 3CCEP 1K9MQ 2P9XA 5HGOA 3I55P 3Q20A 2Z44A 3NTEA 1M6NA 3G29A 4PH1A 2ONTA 2L6EA 3M1MA 3G21A 3CCMP 1M6EX 4COCA 3DS4A 5HGMA 3G26A 1JJ2O 3HYBA 1AUMA 1W2BO 2M8NA 1QRJA 4XROA 3G71P 3OW2O 1YIJP 3CC4P 1QVFO 4U0AA 2Z45A 5BS1A 3CC2P 2EG5A 4XRQA 2Z46A 1VQNP 4XFZA 1EIAA 1ZMBA 1YI2P 1PEMA 1PEQA 2OTJP 3H4EA 2M8PA 4U0EA 4U0CA 1RO2A 4U0DA 4XFYA 1QVGO 1VQMP 3CPWO 3DTJA 3H47A 3CXCO 1KC8Q 3DS5A 1EOQA 3I56P 3CMEP 2BQ1E 3DS0A 3H0DA 1Q86Q 2XXMA 3CD6P 2XT1A 2KODA 1YJ9P 3G1GA 3HZQA 1A43A 3CCUP 1M90Q 4WYMA 4XFXA 2PENA 3DS3A 3DPHA 3RG6C 4U0FA 5DCKA 5BS2A 4QNBA 1IUQA 2PEJA 1PEOA 1N8RQ 1K30A 2CWOA 2EIAA 3CCLP 3VRLC 1Q7YQ 2LF4A 1A8OA 5F2NA 1K8AQ 3G28A 2XV6A 2PEOA 2QEXP 2OTLP 2PEKA 1RO0A 1E6JP 1RNIA 5F2OA 3CCSP 2PEMA 1NJIQ 2E1MA 2BUOA 4U0BA 1VQKP 1Q81Q 1VQ9P 2JYGA 4IPYA 5HGNA 1S72P 3G4SP 3CCRP 1VQ8P 3MGEA 2QA4P 5HGLA 3P05A 3LRYA 2DGYA 4GR2A 3G6EP 1VQPP 1YITP 4GR6A 1VQ4P 2PEIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KD1 Q;  1YJW P;  3CMA P;  3I55 P;  1YHQ P;  1QVG O;  1K8A Q;  1VQM P;  3CPW O;  1VQ7 P;  1VQO P;  1M1K Q;  3CXC O;  3CCJ P;  1KC8 Q;  2QEX P;  2OTL P;  3CCM P;  3I56 P;  3CCQ P;  3CME P;  1Q86 Q;  3CCS P;  1JJ2 O;  1VQ5 P;  1NJI Q;  3CD6 P;  3CC7 P;  1VQL P;  1YJN P;  1W2B O;  1Q81 Q;  1VQK P;  3G71 P;  3OW2 O;  3CCU P;  1YJ9 P;  1YIJ P;  1M90 Q;  1VQ9 P;  3CC4 P;  1QVF O;  3CC2 P;  1S72 P;  1VQN P;  3G4S P;  3CCR P;  1VQ8 P;  1VQ6 P;  2QA4 P;  1KQS O;  3CCV P;  1YI2 P;  1Q82 Q;  1K73 Q;  3G6E P;  1VQP P;  1N8R Q;  3CCL P;  2OTJ P;  1YIT P;  3CCE P;  1Q7Y Q;  1VQ4 P;  1K9M Q; 
#chains in the Genus database with same CATH topology
 1EZV G;  2KG8 A;  1SVF A;  5KJ7 C;  2Q7C A;  4H44 B;  3GG2 A;  1H89 A;  2K92 A;  1SQB G;  5KJ7 A;  1NTZ K;  1DEE G;  1YJN P;  4H44 C;  2CG5 B;  1SQP J;  2WTY A;  3SWY A;  2BHV A;  3CCV P;  5GTI H;  1KTM A;  1U57 A;  2GDX A;  3JC2 2;  4I6M C;  1NTM G;  2Z44 A;  4CPG A;  3GHG A;  5AVS B;  2O1K A;  2JKV A;  2WPQ A;  2IFN A;  5AW8 B;  1FDM A;  1KB9 D;  2FYU G;  1L2P A;  1YIJ P;  2ZVO B;  1NTK E;  2EG5 A;  2MF4 A;  1JMM A;  4AQR D;  2JQ4 A;  1ZMB A;  1AV1 A;  2Y0D A;  2OTJ P;  2M8R A;  3RL0 g;  4HJG H;  3OJA B;  1AVY A;  1FOS F;  3HD7 D;  1KYO H;  2E5T A;  2X2B A;  3A7O A;  1OXZ A;  1HH0 A;  5CJ4 A;  1T3U A;  1JTH A;  2ZVN B;  2IZ1 A;  2BCC G;  4JBZ A;  1USD A;  4HKG A;  3H32 A;  5KAF H;  3EJE A;  1IFD A;  2PEJ A;  4CA3 A;  3AEF C;  4DCK A;  1NAY A;  3QH9 A;  2R5B A;  1FZG A;  2QJK C;  3L72 E;  2GZG A;  3AE3 C;  3AE1 C;  3IF4 A;  5E79 E;  1BCC E;  1E5W A;  2MJZ A;  1YQ3 C;  2YIU B;  2MR8 A;  5F2O A;  4U3F E;  4DG9 A;  1M1J B;  2O01 H;  2FVF A;  4OWF A;  5HGN A;  1W5C E;  3MGE A;  1H8A A;  2JDI H;  3O6Q A;  2XND H;  2M0B A;  1VQ7 P;  2M3E A;  3PP5 A;  4IL6 E;  1SQB E;  1BE3 D;  1XTC C;  1UJZ A;  2UWJ E;  4M0I A;  1JOC A;  1FBM A;  1IZN B;  2E75 B;  3Q5S A;  2QJP C;  2QJY B;  1OR5 A;  1NTM E;  1URQ B;  1USE A;  2E75 C;  4H13 D;  3S9O A;  2QJY C;  4PV1 B;  2OYI B;  3CCM P;  1GZL A;  1LTT C;  2XZ1 C;  3ABV C;  2FYU E;  2ZAE B;  2CPS A;  3KXD A;  2OYI C;  5AW2 B;  2WPS A;  5EJD A;  1KIL D;  1NTK K;  3EJD A;  2C0X A;  1KFM A;  1LWU C;  1N2D C;  1L0I A;  4UB6 H;  3CWB J;  1SQV G;  3H0D A;  1LWU A;  4ZKP A;  2YKP A;  2WSF J;  1JNM A;  2NPS D;  1Y47 A;  1M90 Q;  2JWD A;  2VLP A;  3B4S A;  4TLF A;  1HBW A;  3SWF A;  3DPH A;  4U0F A;  1S3J A;  2KNC B;  3HTK A;  1HF9 A;  1KQG B;  1A8O A;  1KIL E;  2FYN B;  3KDP B;  3V2R A;  5AVW B;  1YBK A;  1T6A A;  3Q2Y A;  1FS0 E;  2KSJ A;  1L0N J;  3GMA A;  1K04 A;  1NO4 A;  1RH5 B;  4U7J A;  1N86 A;  1LTI C;  2K9J A;  3AEC C;  3H1L D;  2WSE H;  1IFP A;  4C7N A;  2J59 M;  2WT7 A;  1R8E A;  2PY8 A;  1SQB K;  3DS1 A;  1OVV A;  1VF5 D;  4H2Y C;  3P8C D;  2ZT9 B;  3HE5 A;  1BE3 J;  2ZFC A;  5KP7 B;  1GL2 D;  1SQQ G;  4PD4 H;  1U7M A;  2ZT9 C;  4PH1 A;  2OYH C;  4AUW A;  1N7S B;  4YTP C;  2QE7 H;  3H1L E;  1JMB A;  1ZRT D;  2OYH A;  2FFD C;  2FYU K;  4BXL A;  3W68 A;  3CC2 P;  2ZJS E;  2YKO A;  3GZL A;  1JY3 P;  1PEM A;  2FFD A;  2M5A A;  2PRR A;  2PFX A;  3P8C E;  3D6Z A;  1HVV A;  2I1J A;  1P84 I;  5KP6 B;  3DTJ A;  4C46 A;  1KC8 Q;  3EFG A;  1H88 A;  3AE7 C;  1Q86 Q;  2GM4 A;  1Z56 A;  1S9K D;  2XT1 A;  2HPC A;  3D70 A;  2RN0 A;  1W2E A;  3GF7 A;  4I7Z C;  3H1K D;  4WYM A;  1JB0 J;  2KB7 P;  1JO5 A;  3BVH A;  1L0L D;  1L4A B;  1ZRT E;  2P67 A;  2O01 J;  3CCL P;  2CWO A;  3FGA D;  5H2F H;  1RE3 A;  3RBX A;  4D6T G;  1T3J A;  1KOR A;  2L22 A;  2M3B A;  1BGY G;  1NJI Q;  3HUS C;  4WB4 A;  1VQK P;  5C39 A;  1VQ9 P;  3QWO C;  3G4S P;  2R3S A;  1RE4 C;  1S9K E;  3HUS A;  3KYQ A;  2J5U A;  3M91 A;  3H1K E;  3L75 G;  2ERH A;  1R5L A;  2KIK A;  2FAE A;  2K5X A;  4PD4 D;  1L0L E;  5AVY B;  5B5E H;  1RE4 A;  2CNR A;  1QX8 A;  1YTZ I;  2KLV A;  1MUU A;  3WBH A;  1Q90 D;  5I4T G;  1LT9 B;  1FZC A;  1RQU A;  1NWQ A;  1OVU A;  1K9M Q;  3RK2 C;  2EHT A;  1SP4 A;  1KIL C;  3AEA C;  1IK7 A;  1GW4 A;  3HYB A;  1NU1 J;  3AED C;  1KIL A;  3CC4 P;  5AW5 B;  5KLV G;  2Q6Q A;  1YI2 P;  4Y28 J;  1LTB C;  3L74 J;  2KOO A;  3H4E A;  1NYH A;  2I1K A;  1QVG O;  4H44 D;  4WWI A;  2WSC J;  3H47 A;  5BU8 B;  1QLE D;  3L73 E;  4OGQ B;  2VRS A;  1SQV K;  2Y0C A;  1EDL A;  1FZB A;  2HFE D;  1EDI A;  2A45 H;  1M57 D;  2W83 C;  3VOP A;  3O8Z A;  3N7N A;  2D2C B;  1AQ5 A;  1OW8 A;  1FZA A;  2N1T B;  3FX0 A;  3E1R A;  1X8Y A;  3Q5P A;  1PEO A;  1WT6 A;  5AVR B;  2N1T C;  3MTU E;  4D6T E;  2XV6 A;  3V5B A;  1EC5 A;  1EXI A;  3H1J J;  2N1T A;  1RNI A;  2VLO A;  2JU2 A;  3NMD A;  1M7L A;  1MFT A;  1AF8 A;  3L75 E;  2JO1 A;  1DH3 A;  4GR2 A;  2KG9 A;  1YIT P;  2KOS A;  1NTZ D;  4BPG A;  4WY4 B;  3CCJ P;  2WQY C;  4BRY A;  2YXR B;  4GKG A;  4GIF A;  1M8O B;  2EFJ A;  4WY4 C;  1GL2 C;  2V4H A;  3FXD A;  4C7R A;  1RF1 A;  3L70 D;  1GL2 A;  3FWL A;  1M6N A;  1SQQ K;  2Z5H A;  2IZ0 A;  1E79 H;  2WVR A;  1NTZ E;  1JJ2 O;  1LT1 A;  2H88 C;  2Q3I A;  1T8K A;  2Z46 A;  1OZH A;  2Z5I A;  2A06 D;  1PZQ A;  4ASW A;  1HGZ A;  3FWN A;  2SPZ A;  3VMX A;  3H1I D;  1KFN A;  3L70 E;  3VP9 A;  2E74 B;  2QSI A;  3I56 P;  5GTH E;  3AE9 C;  1X9V A;  2XZ0 D;  4DZO A;  2N98 A;  1J1E C;  1LTJ C;  2POH A;  3HZQ A;  2E75 D;  3RGU A;  1LTJ A;  4OH8 B;  1PP9 J;  1H0T A;  1PFI A;  3VRL C;  3B5N B;  2BAS A;  4HH2 A;  1SQX J;  1VDF A;  1K8A Q;  4GDO A;  2AFE A;  3CXH D;  3CLQ A;  2PNG A;  3U1C A;  1RO0 A;  3VMA A;  2E1M A;  1LTS C;  1S72 P;  1RQV A;  2P1J A;  2J58 A;  1AFO A;  3F5H A;  2N5H A;  1NKZ B;  5E79 H;  1OWA A;  3A0H E;  2C9N Y;  1YHQ P;  1DX7 A;  1DEB A;  1WRG A;  1KQL A;  5CMZ A;  1BDC A;  3CXH E;  5K5G B;  2LXB A;  2QRX A;  3CE7 A;  3V4W A;  1BAJ A;  2MVU A;  1FJP A;  3F89 A;  3VN0 A;  4IFM A;  4IL6 H;  2EHS A;  2R3C A;  4L75 A;  4WBA A;  3CWB G;  3L71 J;  2N9B A;  4GOF A;  3M1M A;  2KZI A;  2LML A;  1NTK D;  1W2B O;  4IFD K;  4XRO A;  2KG6 A;  1FZE A;  4XRQ A;  2HYN A;  1XTG B;  5KLV K;  1OIP A;  4L73 A;  2B89 A;  3KQG A;  2E76 B;  1U7J A;  1KZU B;  4EIJ A;  3U1A A;  3NY7 B;  3JCU E;  1L0N G;  5L8R J;  3H1H G;  2DNW A;  2N6Z A;  3H1I J;  2PGD A;  1Y9B A;  3G1G A;  5M1B A;  1KYO I;  2ZT9 D;  5DCK A;  3L72 D;  1IO4 A;  3VTP C;  1BCC D;  3RK3 B;  3G28 A;  4IL6 X;  4BPH A;  4U3F D;  3RBZ A;  1JM0 A;  2QG4 A;  4IOI H;  3M0D C;  1EDK A;  5APW A;  1EZV D;  3WUU A;  2KUB A;  3LRY A;  3EJB A;  2FBW C;  2ZYD A;  3M0D A;  1SQB D;  2PEI A;  1RHZ B;  3N4X A;  2H7H A;  2JYL A;  1GK4 A;  3V2N A;  1HUC A;  1JY2 O;  2MKV A;  2I8D A;  5CBN A;  3A3Y B;  5F2K A;  1NTM D;  2KXP B;  2R44 A;  1SFC B;  3NTN A;  5CCH C;  2YIU C;  2JO0 A;  4LLH A;  2Y9Z A;  2IFM A;  4R0M A;  1M1J C;  2KP8 A;  2PEQ A;  2HLO A;  1EZV E;  2IYO A;  2KSE A;  5CCH A;  3GJN A;  3C8V A;  2FYU D;  1M1J A;  1T8Z A;  2L6E A;  1M6E X;  1QL1 A;  3PTZ A;  3KZI E;  3G71 P;  3GW6 A;  2IPP A;  4F37 A;  1IJD B;  2Q9I A;  4UB8 E;  1PEQ A;  1PGJ A;  3A5T A;  2BCC D;  3H1H E;  3DS5 A;  1PGO A;  1AQT A;  3CX5 I;  1URQ C;  2P2U A;  2YXQ B;  3SSU A;  4HB1 A;  2K9Y A;  4IZ6 A;  3R4Y A;  2V7Q H;  4PV1 C;  1KMI Z;  3RK2 D;  1URQ A;  2B87 B;  1G1J A;  2PEN A;  3DS3 A;  5HV8 A;  2LIW A;  3H25 A;  2AXT E;  4L74 A;  2OYI A;  2EIA A;  2YNY A;  2VSQ A;  1UII A;  2W6A A;  3L72 J;  4PJ0 E;  2YMY A;  3L37 A;  2MD9 A;  2FQ2 A;  2BCC E;  3K5B A;  3A0B H;  4U3F J;  1PPJ G;  1LP1 B;  1N7L A;  5AW9 B;  4W7Z A;  4OGQ D;  2CQ8 A;  4DOJ A;  1KN7 A;  1A02 J;  1JEK A;  3AEB C;  3CI9 A;  1NU1 G;  2L91 A;  2M8L A;  1SQB J;  2FYN C;  3P32 A;  2KNC A;  2N1T D;  5AW0 B;  3WU2 H;  2PAJ A;  3L74 G;  1GTW A;  2WSS H;  4K3A A;  1GU4 A;  2KW2 A;  3NTE A;  1NTM J;  2WPR A;  3FXE A;  5DJU B;  4XFJ A;  3VP8 A;  3M0A A;  3HE4 B;  2LL8 A;  2FXM A;  2FYU J;  1QVF O;  2WIT A;  1ZXG A;  1UNK A;  2ZXX A;  1SQV D;  4LC1 A;  2JEE A;  4K35 A;  4WY4 D;  3LMO A;  1OW6 A;  3H1J G;  3AE2 C;  4M3L A;  1L0N K;  2KGA A;  2JR8 A;  2K94 A;  2YO3 A;  2MR7 A;  4XFX A;  1N7S C;  1IUQ A;  2FVA A;  2AF8 A;  2PP6 A;  2JGP A;  2IBZ I;  1N7S A;  3AE4 C;  2KOR A;  3TK1 A;  3HD7 B;  1SQV E;  5KLI B;  4DJG A;  2KLU A;  2PEM A;  1G1I A;  2BUO A;  4PXH B;  3MHV A;  2GA1 A;  2KYV A;  3CCR P;  3GLM A;  2K0X A;  3A0B E;  1VQP P;  5APU A;  3CX5 E;  2GZF A;  4H0L B;  4R4L A;  2QVA A;  1L4A C;  4H0L C;  3EWK A;  4Y99 B;  4HYT B;  1VQ5 P;  1L4A A;  4YPC A;  1X0T A;  3L74 E;  1SQQ D;  4Y99 C;  2ZYG A;  3EQ2 A;  2IBZ G;  4L76 A;  2WPT A;  4EOT A;  3DS2 A;  3WU2 E;  4PH0 A;  3I55 P;  2P58 A;  2FKW B;  3V4Q A;  2KS1 B;  5HGM A;  2FVE A;  2O3J A;  2Z45 A;  3BCC G;  1PP9 G;  3H1L J;  3TNU B;  5KKZ B;  4N78 D;  5AVV B;  1SQX G;  1SQQ E;  3L73 D;  2KGC A;  2M8P A;  1ZP0 C;  2V7Q J;  4XFY A;  4EDF A;  1LT9 C;  1IK9 A;  1BXI A;  2WMM A;  1G2C B;  2LOL A;  2G8Y A;  2G3A A;  3BAT A;  3H6P A;  4EYY Q;  2KOD A;  1LT9 A;  2FHS C;  5TIS E;  3TYY A;  1CI6 B;  2FXO A;  2C9L Y;  4ZMD A;  4D6T D;  1N8R Q;  2A45 I;  4N78 E;  5GTH H;  1BGY D;  2ZXE B;  2H89 C;  2K1A A;  2KGE A;  1NQ4 A;  1GK6 A;  3TGU G;  1BDD A;  2C0W A;  2NPS B;  1P84 D;  3L75 D;  4OGQ C;  4ZKU A;  1WMK A;  1PV3 A;  2LPK A;  1NH4 A;  2DGY A;  1R5S A;  3L71 G;  3MP7 B;  2D2C C;  4COP A;  1KQF B;  3PHL A;  3H1K J;  1M1K Q;  5JPA A;  1L0L J;  2E5Y A;  1BGY E;  2P7J A;  1S2E A;  1NU1 K;  2GUS A;  1SQP G;  2IBZ E;  1LGH B;  4TT3 H;  2KR5 A;  1A02 F;  2WSE J;  2LIU A;  2A45 G;  2OTK E;  1P84 E;  3A0H H;  2AFD A;  1BSN A;  3MUD C;  3V6I A;  1HQB A;  4BWN A;  3RK3 D;  1ZR2 A;  4NPF X;  2M5R A;  1IC2 A;  1YQ4 C;  4BPF A;  3CXH H;  5AW1 B;  5KLV D;  5AVZ B;  3A2A A;  1PL5 A;  3BCC E;  2LTE A;  5APY A;  1GXG A;  1GU5 A;  3MIW A;  2RH0 A;  4ASV A;  1NAF A;  1SQX E;  2HR3 A;  1Z6M A;  5AW3 B;  1J1D B;  1S5L E;  4WY4 A;  1VKU A;  3T97 B;  3RL0 B;  1ZR4 A;  4U0D A;  1VQM P;  5CZD B;  3CXC O;  1EOQ A;  1IFM A;  3RK3 E;  5CCH D;  3VMY A;  2CK3 H;  1GXH A;  3RL0 C;  2XXM A;  3L73 J;  5APX A;  3P8M C;  1A43 A;  1HTL C;  5KLV E;  1PGP A;  1HWT C;  3C1L A;  3PH0 A;  3AEG C;  1OW7 A;  5EW5 E;  3BRV B;  4KHX A;  3JCU H;  1HGV A;  3ITK A;  3S4R A;  1VHN A;  5CHX A;  3TGU E;  2VLN A;  2BEZ F;  1DNY A;  2E74 C;  2YO2 A;  2QNW A;  4IPY A;  2AEF A;  4O9B A;  3D71 A;  2CGQ A;  3BAS A;  1URQ D;  1J2J B;  3L75 J;  3PRJ A;  2K37 A;  1KB9 I;  4Z1M H;  1VQO P;  4PV1 D;  4GOD A;  2P10 A;  1D1D A;  3IN6 A;  3E2D A;  1SQP E;  2XDJ A;  3B5N C;  3B5I A;  3V2Q A;  3PJS K;  3VYI A;  1L0H A;  5KTB A;  3G1I A;  2WWW A;  3D6Y A;  3B5N A;  1DD3 A;  1NVO A;  4N3Y B;  5APT A;  1Q82 Q;  4YXW H;  1CZQ A;  3Q20 A;  2H8P D;  2O1J A;  1CW5 A;  2HOD B;  4COC A;  1NKN A;  1IFJ A;  2XNX A;  3R2P A;  2K88 A;  2L4B A;  4LGD E;  2JWA A;  1QRJ A;  2Z4E A;  1NTZ J;  4U0A A;  1LTG C;  2Q3E A;  3MZW B;  1IMQ A;  1DV5 A;  1FDO A;  1SQX K;  2B88 A;  3W67 A;  1JY2 N;  4AYC A;  2KI7 B;  1GPJ A;  1TU3 F;  3PLN A;  2OYO A;  3CME P;  3KZI H;  3L70 J;  1OFC X;  1JY3 O;  4W80 A;  4JYB A;  2K93 A;  5B66 E;  4UB8 H;  3I5C A;  3U43 A;  3U59 A;  3SFE C;  2LF4 A;  5TJH A;  1CEI A;  2K2Q A;  2E76 C;  3NXS A;  3GHG B;  2CPB A;  4U0B A;  4NEO A;  3L4F A;  2AXT H;  2RMZ A;  1K05 A;  2GDW A;  3GHG C;  1NGM B;  4GR6 A;  2KZJ A;  2LXC B;  1QL2 A;  4I1L A;  1YJW P;  3CMA P;  4PJ0 H;  5CCG C;  1LTA C;  1N7S D;  5KAI E;  1QEX A;  4WVZ A;  1QGK B;  3RK3 C;  1VQL P;  5CCG A;  1SQP K;  1JTH B;  3CWB D;  1BE3 G;  2JBG A;  3H32 B;  1MKM A;  2N5I A;  2YKQ A;  2L9F A;  3DS4 A;  2MVV A;  1FDI A;  3BRT B;  4EI2 A;  2QJK B;  5BS1 A;  2XZR A;  2WPV B;  4XFZ A;  2KWL A;  1KB9 E;  2AVA A;  1L4A D;  1OX3 A;  1L0N D;  2R5D A;  4H0L D;  3GZM A;  3CWB E;  3G3Z A;  3H1H D;  1PGQ A;  2FAD A;  1PIX A;  3NFQ A;  1LJ2 A;  1GD2 E;  1SFC C;  2NRG A;  3O6Q B;  4UHP B;  3L36 A;  5AVX B;  3LW5 H;  1SFC A;  3II6 A;  4RKU J;  2IDB A;  3Q3D A;  2FQ0 A;  2ROQ A;  5BVZ A;  3RG6 C;  1NTK J;  1LNQ A;  2VLQ A;  4OVN F;  1L0N E;  5EFW B;  2GUV A;  1D7M A;  4NPE A;  2PEK A;  5CBO A;  2QJP B;  2JJL A;  3AE5 C;  4A7P A;  2JYG A;  1VL2 A;  1VQ8 P;  1EXJ A;  1UIX A;  2XKM A;  5HGL A;  1OMI A;  1S4X A;  1S1C X;  2XU6 A;  5GTI E;  1KYO D;  1T2K D;  4XA4 A;  3WUV A;  3G0V A;  4MRT C;  2B87 A;  3M9Q A;  1BCC J;  3H1L G;  1ZLL A;  2R32 A;  3TDK A;  1LWU B;  4QMA A;  1BE3 E;  5AW7 B;  1FJK A;  3CX5 H;  2KOQ A;  2K0Y A;  4RO0 A;  2N50 A;  3OA7 A;  2P9X A;  5APQ A;  1AYI A;  1FE6 A;  3HTK B;  3G29 A;  4KJM A;  1KYO E;  2KOP A;  2JP3 A;  2JAZ A;  1GDT A;  1EDJ A;  1LP1 A;  2D2C D;  1VQN P;  2WSC H;  1EIA A;  1E0H A;  5KAF E;  1FAV A;  2QM7 A;  1GMJ A;  4W7Y A;  3B8E B;  5AW4 B;  2ZYA A;  1YTZ T;  5APS A;  3DS0 A;  2K9J B;  4MN4 C;  3SWK A;  2L0Q A;  3E7K A;  1SLQ A;  3H1H J;  1AJY A;  4C7N B;  4B86 A;  2WT7 B;  1X3O A;  4PD4 I;  1ZME C;  2L5G B;  2Y9Y A;  2K0D X;  2KK7 A;  3LIE A;  2FAC A;  3H1K G;  3HE5 B;  3HE4 A;  1L0L G;  5BU5 A;  5DJT B;  1PPJ D;  5TIS H;  3CCS P;  2BCC J;  3B71 A;  3CX5 D;  2QA4 P;  2OYH B;  3RL0 D;  1NU1 D;  1NTM K;  4RES B;  1M74 A;  2GZJ A;  1ZW0 A;  2FFD B;  2M5A B;  3CCQ P;  3L74 D;  3KPE A;  3CC7 P;  3HD7 C;  2DW3 A;  3OAK A;  4IFF A;  1FU1 A;  3L35 A;  5KLI C;  1PPJ E;  1AVO A;  1HY8 A;  1PEU A;  2HPC B;  1KQS O;  2WZ7 A;  2LKI A;  1FZF A;  1K73 Q;  3HD7 A;  1KV4 A;  2E74 D;  4I7Z B;  2YMK A;  2ONT A;  1NU1 E;  4UB6 E;  3L73 G;  4YXD C;  5AVT B;  3E1I A;  1DIP A;  1Q2N A;  1P84 H;  1X22 A;  1RE3 C;  5AW6 B;  3H1J D;  3AE6 C;  2N6Y A;  3LW5 J;  3B5N D;  3S1K A;  3EFF K;  4U0E A;  4JYC A;  3HUS B;  2LR2 A;  5KP8 B;  1KLP A;  4PWV B;  2K3R A;  1FOS E;  3TSI A;  2XV5 A;  4JQ0 D;  1YJ9 P;  1ZN5 A;  3CCU P;  1S5L H;  1CSB A;  5BS2 A;  2FXP A;  2KS1 A;  1Q7Y Q;  2OQQ A;  3G9R A;  5F2N A;  5KKZ C;  1JUN A;  4H13 B;  3H1J E;  1FZC B;  4H2W C;  3USS A;  1SQV J;  1BSH A;  3TNU A;  1IFN A;  4H13 C;  1FZC C;  1T2K C;  1JY2 P;  3RK2 B;  3P05 A;  1EQ7 A;  1KIL B;  3G6E P;  2IYP A;  1X79 B;  3GF3 A;  4H2X C;  1SS1 A;  1G2C A;  1KD1 Q;  1AA0 A;  2Q5U A;  4PD4 E;  2FY8 A;  2IBZ D;  5APV A;  1NTZ G;  1CI6 A;  4QKO A;  3TF5 A;  4KT0 J;  1RF0 C;  5KJ7 D;  1S5L X;  2NPS C;  2AXC A;  2W6B A;  2OAR A;  2E76 D;  1RF0 A;  3SFD C;  1FC2 C;  5HGO A;  2KOG A;  4NPD A;  3L70 G;  2NPS A;  2GZE A;  3BCC D;  1PP9 D;  3G26 A;  1EMV A;  1SQX D;  1AUM A;  3RG2 A;  3OW2 O;  1OVR A;  5CCG D;  3CXH I;  1HJB A;  1RY3 A;  4XE5 B;  2HG5 D;  4I2L C;  3M9H A;  5AVQ B;  3V2P A;  2Y0E A;  3CPW O;  2A06 G;  1SQQ J;  3MUD A;  3WUT A;  3KHU A;  5H2F E;  2RKL A;  1ZV8 A;  3CD6 P;  1M56 D;  3H1I G;  4BRY B;  1IFI A;  3MD0 A;  1YYC A;  1PP9 E;  1GW3 A;  4R4M A;  3LID A;  3CL3 D;  2BEQ D;  5HVC A;  1VF5 B;  4GT1 A;  1K30 A;  3TGU D;  2ITA A;  1RF1 B;  1NHL A;  1VF5 C;  2AEJ A;  3GKL C;  1GL2 B;  2QEX P;  1MFZ A;  2OTL P;  1L0L K;  1J1D C;  5B5E E;  1ZNV A;  1RF1 C;  1E6J P;  5B66 H;  2W90 A;  1Q81 Q;  3L71 D;  1VPC A;  4DT0 A;  1SFC D;  3T97 A;  4N6J A;  5AVU B;  1VQ4 P;  1IMP A;  4GOE A;  3P7K A;  3JSV C;  4ZNC A;  1SQP D;  2JU1 A;  1JY3 N;  1JCC A;  3HRN A;  4D6T J;  1N73 B;  2W6J H;  2GZI A;  1MV8 A;  1MZ9 A;  1BGY J;  2IX7 C;  1HJ0 A;  2W27 A;  2E42 A;  2FQ1 A;  3Q1M A;  1VQ6 P;  3AE8 C;  2OGU A;  1N73 C;  7CEI A;  3AEE C;  2KGD A;  3L71 E;  2GDY A;  3CCE P;  3M9B A;  2B9B A;  2GYK A;  1J1E B;  1LTJ B;  1ACP A;  1H0T B;  1N73 A;  5KAI H;  3G21 A;  3M06 A;  2Q1K A;  2H43 A;  2M8N A;  3Q5R A;  3IFM A;  3BCC J;  2QM8 A;  3IR9 A;  1NTK G;  3C9I A;  1FR2 A;  2A06 E;  4U0C A;  1RO2 A;  3IAO A;  1JCD A;  3B4Q A;  2MY5 A;  1Y8A A;  1EZV I;  2AEM A;  2BQ1 E;  3H1I E;  1MZ8 A;  2QIW A;  3ZDM A;  1KB9 H;  2JB0 A;  4JPZ B;  1ZOY C;  4QNB A;  5KLV J;  2LKM A;  3UIA A;  2FYZ A;  2NO8 A;  2HOD A;  1DD4 A;  2WSF H;  2W8Z A;  3WMM 0;  2PEO A;  3L72 G;  4HKZ H;  1BCC G;  4RJT A;  3TGU J;  2N9Y B;  3MGN A;  2O01 N;  4U3F G;  1NOH A;  1F80 D;  3VMZ A;  2E43 A;  2NZ2 A;  5CJ0 A;  4JF7 A; 
#chains in the Genus database with same CATH homology
 1KD1 Q;  4COP A;  3CMA P;  1YJW P;  1YHQ P;  1M74 A;  1VQ7 P;  2JYL A;  1VQO P;  1M1K Q;  3CCJ P;  3G0V A;  5JPA A;  3CCQ P;  1D1D A;  3E2D A;  3B5I A;  2EFJ A;  2PY8 A;  2M8L A;  1VQ5 P;  3DS1 A;  3CC7 P;  1VQL P;  3WBH A;  3G1I A;  1YJN P;  4M0I A;  5F2K A;  1VQ6 P;  5I4T G;  2BHV A;  1PEU A;  1BAJ A;  2JO0 A;  1KQS O;  3CCV P;  1K73 Q;  1Q82 Q;  2PEQ A;  2OAR A;  3DS2 A;  4PH0 A;  3CCE P;  1K9M Q;  2P9X A;  5HGO A;  3I55 P;  3Q20 A;  2Z44 A;  3NTE A;  1M6N A;  3G29 A;  4PH1 A;  2ONT A;  2L6E A;  3M1M A;  3G21 A;  3CCM P;  1M6E X;  4COC A;  3DS4 A;  5HGM A;  3G26 A;  1JJ2 O;  3HYB A;  1AUM A;  1W2B O;  2M8N A;  1QRJ A;  4XRO A;  3G71 P;  3OW2 O;  1YIJ P;  3CC4 P;  1QVF O;  4U0A A;  2Z45 A;  5BS1 A;  3CC2 P;  2EG5 A;  4XRQ A;  2Z46 A;  1VQN P;  4XFZ A;  1EIA A;  1ZMB A;  1YI2 P;  1PEM A;  1PEQ A;  2OTJ P;  3H4E A;  2M8P A;  4U0E A;  4U0C A;  1RO2 A;  4U0D A;  4XFY A;  1QVG O;  1VQM P;  3CPW O;  3DTJ A;  3H47 A;  3CXC O;  1KC8 Q;  3DS5 A;  1EOQ A;  3I56 P;  3CME P;  2BQ1 E;  3DS0 A;  3H0D A;  1Q86 Q;  2XXM A;  3CD6 P;  2XT1 A;  2KOD A;  1YJ9 P;  3G1G A;  3HZQ A;  1A43 A;  3CCU P;  1M90 Q;  4WYM A;  4XFX A;  2PEN A;  3DS3 A;  3DPH A;  3RG6 C;  4U0F A;  5DCK A;  5BS2 A;  4QNB A;  1IUQ A;  2PEJ A;  1PEO A;  1N8R Q;  1K30 A;  2CWO A;  2EIA A;  3CCL P;  3VRL C;  1Q7Y Q;  2LF4 A;  1A8O A;  5F2N A;  1K8A Q;  3G28 A;  2XV6 A;  2PEO A;  2QEX P;  2OTL P;  2PEK A;  1RO0 A;  1E6J P;  1RNI A;  5F2O A;  3CCS P;  2PEM A;  1NJI Q;  2E1M A;  2BUO A;  4U0B A;  1VQK P;  1Q81 Q;  1VQ9 P;  2JYG A;  4IPY A;  5HGN A;  1S72 P;  3G4S P;  3CCR P;  1VQ8 P;  3MGE A;  2QA4 P;  5HGL A;  3P05 A;  3LRY A;  2DGY A;  4GR2 A;  3G6E P;  1VQP P;  1YIT P;  4GR6 A;  1VQ4 P;  2PEI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...