1YJ9P

Crystal structure of the mutant 50s ribosomal subunit of haloarcula marismortui containing a three residue deletion in l22
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S Ribosomal RNA
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
total genus 43
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2005-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1yj9P03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1yj9P01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1yj9P02
3CD6P 1K73Q 3CCLP 3CC7P 1YIJP 3CC2P 1KC8Q 3OW2O 3I56P 1VQ5P 3G71P 1YJ9P 1Q81Q 1M90Q 1YI2P 3CCEP 3G4SP 1QVFO 1VQ6P 2OTLP 3CPWO 1Q7YQ 3I55P 1YITP 3CMEP 1Q86Q 1VQ4P 1VQNP 1NJIQ 1VQMP 1JJ2O 1VQKP 3CXCO 1YJNP 1QVGO 1VQ7P 3CCMP 3CCSP 1YHQP 1W2BO 1Q82Q 3CC4P 1N8RQ 3CCRP 3CCVP 1VQ8P 1VQLP 1VQOP 1VQ9P 2OTJP 1S72P 1KD1Q 1VQPP 1K9MQ 1K8AQ 3G6EP 2QEXP 3CCJP 3CCQP 1YJWP 1M1KQ 2QA4P 3CCUP 1KQSO 3CMAP
chains in the Genus database with same CATH superfamily
4W7YA 1NAFA 1NTMG 2FVEA 1A02J 3GLMA 2FYZA 3H32B 1XTCC 3PHLA 2L4BA 2QIWA 4U0BA 2WT7A 1NTMJ 2LMLA 1N7SD 2K92A 1PP9E 1KYOD 3HD7C 3R4YA 2QJYC 1X3OA 5JPAA 2KSEA 3GKLC 2P67A 2DNWA 2LKMA 1JUNA 3G4SP 1NTKE 3DS3A 3AEAC 3RL0D 5KP7B 4N78E 2IZ1A 1YQ3C 1ZRTE 1Y9BA 2PEMA 1VQOP 3AE3C 5KAIE 4MN4C 2WQYC 1PP9D 2VLOA 1QLED 1AFOA 2Z46A 1EMVA 2BEZF 2ZXEB 5KLVJ 2JO1A 2YMYA 1YQ4C 2IBZE 1S9KE 1J1DC 1SQVE 3V2QA 4PV1C 1NTKD 2ZT9C 2UWJE 2JR8A 2P9XA 4N78D 1KD1Q 2GYKA 1X0TA 3L72J 1ZRTD 3NTEA 3U43A 4HJGH 4AYCA 1RF0A 2BQ1E 1IFNA 1T3JA 2WSCJ 4OGQD 1R5SA 4QMAA 4RKUJ 4U3FG 1P84E 7CEIA 1NU1K 4NEOA 1L4AA 2Y0CA 2QNWA 2IBZD 1S9KD 1SQVD 2OYIA 2WITA 2JWAA 3B4SA 3TGUJ 1NTZE 1GMJA 2KNCB 1VQMP 1URQC 3BVHA 3G0VA 2E43A 2R5BA 2YIUB 2KG9A 1TU3F 3H1HJ 1N73A 5KLIC 1FR2A 2QJPB 3HZQA 1P84D 1OVVA 1SFCB 3P8CE 2HR3A 1LTIC 2LXBA 2NPSB 3USSA 1QVGO 1SP4A 1NTZD 2RH0A 2PEQA 3NTNA 2YKPA 5E79H 1IFDA 1OMIA 1A02F 2FYNB 3B5NB 3CCEP 3BRVB 1KYOH 1QVFO 2NRGA 3P8CD 1U7JA 3H1LJ 4I2LC 1RO0A 2LIWA 2W83C 3DPHA 4YXWH 2OYHB 2QRXA 1OXZA 4H44C 3W68A 1JCDA 1L0NG 5KP6B 3CCQP 1LTJB 2PNGA 4H13C 3NXSA 3HUSA 1RF1B 1LJ2A 5CMZA 1RH5B 1BSHA 2CK3H 1LTBC 3C8VA 2P2UA 2PAJA 1BE3G 1SFCD 3H1IG 1SQXG 2B9BA 2NPSD 4WY4B 1JY2O 4Y28J 1SQXJ 5APUA 2KYVA 2CPBA 1KB9I 4N3YB 5DJUB 2LR2A 1IJDB 3HE5B 5KAIH 5APVA 1MFZA 1EOQA 1KFMA 4H0LB 1L4AC 1VQLP 1FZCC 1FZBA 1YTZI 1GXHA 5AW0B 1IFPA 1ZR4A 1FOSF 1HBWA 1IFMA 3SSUA 3VMYA 2YNYA 1J1EC 1SQBE 4LLHA 1Y47A 4EDFA 1YHQP 4UB8E 4PXHB 1LWUA 1BDCA 1A8OA 1KV4A 3WU2E 1SQQE 1BGYJ 1JTHB 2XKMA 3IF4A 3RK3B 3MIWA 1BXIA 4Z1MH 1OW6A 4WWIA 1Q7YQ 1P84H 1NAYA 5KJ7D 2M8LA 4H2XC 4KJMA 4WY4D 1PZQA 1SQBD 2W6AA 1SQPJ 3ITKA 3WBHA 2H7HA 2EHTA 3VP9A 1JY3P 1ZMEC 5AVYB 3RG2A 2JWDA 2ONTA 2K1AA 2EFJA 1ZN5A 1SQQD 4H0LD 4BPFA 5KAFE 3HRNA 3GG2A 3RK3E 5B66E 3LRYA 5CBNA 3G1IA 1LTSC 3CX5I 3L73G 1Q81Q 3HTKA 1HWTC 2VLPA 1X22A 2PEKA 2XNDH 2JYLA 2VSQA 3EFGA 3Q20A 1RE3A 1UJZA 3CCVP 2Q6QA 3ZDMA 3RK3D 2GZJA 5AVWB 2KOSA 3PTZA 1AVYA 4IOIH 2M0BA 1NWQA 1OZHA 2KG6A 4DOJA 2WPTA 1YBKA 3AEEC 3P05A 2E42A 3DS5A 4GR2A 3AE4C 1H88A 1L0LJ 4GR6A 4YXDC 1NU1E 1KLPA 1LP1A 2FYUK 4Y99B 2ERHA 1IFJA 1LT9A 3DS0A 2BASA 2R32A 2HFED 4F37A 2PEIA 3EJBA 2AF8A 1MZ8A 1AUMA 1SVFA 1PP9G 2PRRA 2CWOA 3L75E 1GL2C 4HKZH 2KB7P 1NOHA 2N1TB 2AFDA 1LWUC 1PP9J 1NU1D 1NTKG 1HH0A 2N9BA 3U1CA 2V7QJ 4GIFA 1AQTA 3VN0A 1EC5A 2GUSA 3CC7P 3H1IE 2GUVA 1FZEA 1Y8AA 1JOCA 4PD4I 1T3UA 1GTWA 1JJ2O 2Z45A 5F2KA 2MF4A 1MKMA 3G21A 5BS1A 3H25A 4RJTA 1NTZK 5APXA 4MRTC 3L75D 4NPDA 4UHPB 2XU6A 2E5TA 2KS1A 5M1BA 2KK7A 2IBZG 1SQVG 2QE7H 3A0HE 2P58A 1H0TB 1KC8Q 3M0AA 1MUUA 3MUDC 4UB8H 1N7SA 3K5BA 2KGAA 2FFDB 2KSJA 3RK2C 1HGZA 3R2PA 4HKGA 1DD3A 2HPCB 1OR5A 1GZLA 3WU2H 2Y9ZA 3CXHI 2JGPA 2OTJP 1S72P 3TSIA 2WWWA 4BPHA 3O6QA 1NKZB 4ZMDA 1ZV8A 2BCCJ 1IO4A 4OH8B 1PEUA 3D70A 3G71P 2R44A 2N1TD 3NY7B 3CWBE 3CXCO 2KW2A 3V4QA 4RO0A 3H1KE 5BU5A 4EOTA 1CI6A 3D71A 2JKVA 1NTZG 3L71E 5KAFH 2YMKA 5B66H 4UB6E 2KGCA 4XFZA 1L0HA 4EYYQ 2LL8A 1PGQA 2GDWA 3ABVC 3KPEA 5HV8A 3CWBD 3H32A 2K9JA 3H1KD 1NGMB 4XFXA 3B71A 2E76D 3L71D 2D2CC 5TISE 2FHSC 1PPJE 2IDBA 1VF5B 5AW4B 3H1JJ 2ZVNB 2QG4A 1GPJA 3BCCE 2H8PD 4D6TE 1IK7A 2XV6A 2BUOA 1PGPA 1HY8A 1H8AA 2DGYA 1KMIZ 5CJ0A 5TJHA 2MR8A 3FWNA 3V2NA 3L70E 2QJYB 2O01H 1SQBK 3VTPC 1RQVA 2IFMA 1LTAC 1PPJD 3SFEC 2KODA 3WUTA 4QNBA 3LW5H 3BCCD 2N6ZA 1PEMA 4D6TD 1SQQK 2Q1KA 1EIAA 2JAZA 3G3ZA 2KR5A 1W5CE 2M3EA 2GDXA 3IAOA 2JEEA 4GOFA 5AVTB 4WB4A 1KB9E 4BXLA 3L70D 4OGQB 2H43A 5KKZB 1FBMA 3VOPA 1EZVD 1ZLLA 2ZT9B 1VF5D 5AW6B 3CCRP 4LC1A 1S2EA 2KNCA 3A0HH 4YPCA 1EXJA 1SQBG 4L76A 1T2KC 3KYQA 1KB9D 3V6IA 1HF9A 1GW3A 2P10A 2M3BA 4IFMA 3F89A 3HD7D 2WPSA 2K0XA 1X79B 1ACPA 2KI7B 1FAVA 1SFCA 2FYUE 1IMQA 1HJ0A 2LXCB 1JY2N 3SFDC 1SQQG 1W2BO 2NPSA 5EW5E 4C7NB 2E75C 4PJ0E 4LGDE 3M06A 3CCUP 3V2RA 2J59M 2MKVA 1T2KD 3CL3D 1L0IA 1URQB 1JY3N 2WPVB 3B5NA 5KLIB 4ASWA 2OGUA 4JYBA 5CCGC 3CCSP 1U7MA 1M7LA 2FYUD 2C0XA 2WSSH 4JF7A 4PV1D 5H2FE 2ZT9D 3WMM0 4UB6H 2OYHA 2IYOA 5AW9B 4U3FJ 1KILC 2WT7B 2KLUA 1AQ5A 2B87B 2OYOA 3TNUB 1LTJA 1ZXGA 1KFNA 3CMEP 1M8OB 1EDKA 3AEFC 3LIEA 3CX5E 2W6BA 1KN7A 1RF1A 3CC4P 3GHGC 2P7JA 1FJKA 1AVOA 2J5UA 5AW3B 3H0DA 2FXPA 1RY3A 5KJ7A 4O9BA 5TISH 3OW2O 1Z6MA 1G2CB 3II6A 1QL2A 4WY4A 3I55P 1IZNB 1BDDA 2K5XA 4H13B 3CX5D 4NPEA 1URQD 3HE5A 2Q9IA 2KOGA 4PWVB 2YO2A 3CMAP 1FDIA 1MV8A 1LTGC 1NU1G 2N9YB 3AEBC 3L4FA 2ZYGA 3VMXA 1CZQA 5AVUB 3Q5RA 2GZIA 1IMPA 2POHA 2O1KA 1GDTA 1HQBA 2FXMA 3N4XA 3A5TA 3L75G 2YIUC 4W7ZA 2YKQA 2NO8A 3LW5J 3MHVA 2QJPC 1L0NJ 2OTLP 3FXEA 1FZCB 1JTHA 1KB9H 1LTTC 5APTA 1EZVI 5AVVB 1GD2E 4PD4E 1J1EB 3CE7A 4COPA 3IFMA 3NMDA 3H47A 2FVFA 4H2WC 4H44D 2E5YA 1MFTA 5CZDB 1RF0C 1BE3J 3H1IJ 3KXDA 4JBZA 4GKGA 2K0DX 4H13D 3B5NC 3B5IA 4U0DA 4TLFA 1FDOA 2A45I 4IFDK 1JB0J 1VKUA 2ZXXA 2WPQA 3Q5PA 2MVVA 3E1IA 1SQPK 2KLVA 4U7JA 2OYIC 4PD4D 3CXHE 4IFFA 1RHZB 1MZ9A 1JCCA 3SWKA 1LTJC 1CW5A 3AE7C 3MGNA 1SS1A 4M3LA 4U0EA 3GF3A 2PFXA 1DX7A 1RF1C 5CHXA 5CCHA 4PJ0H 2Z44A 4JQ0D 1VQPP 1N73C 1OFCX 1L4AD 3CWBG 3JSVC 3OJAB 3H1KG 5KLVE 5CBOA 1M6NA 1SLQA 3VMAA 4C46A 3M9HA 3CXHD 1JY2P 3CWBJ 4H2YC 5AVQB 5HGOA 2KZJA 3L71G 5H2FH 2K2QA 2M5RA 1OIPA 3KZIE 2G8YA 3MD0A 5I4TG 1K05A 3L72E 1AYIA 1KQGB 2KOQA 2C9LY 2GM4A 3UIAA 2K0YA 5AW1B 3PJSK 4I7ZB 2ROQA 1FOSE 3Q1MA 1CEIA 5KLVD 1Q82Q 4M0IA 1M74A 2YXRB 2WSEH 1NKNA 2N1TA 2ZYAA 1PPJG 4EIJA 3L72D 3QH9A 1M1JB 2FKWB 2JB0A 3HUSC 4W80A 3TGUE 1AA0A 3L36A 3BCCG 3GMAA 5AW7B 4D6TG 3TYYA 1JO5A 3L73J 1XTGB 3H1HE 2B88A 3RG6C 3M0DA 3BCCJ 5B5EE 1FU1A 1RE4A 4L75A 1GL2B 3L70G 2ZJSE 2KOOA 2OARA 4ZKPA 2AVAA 3AEGC 1EZVG 3LMOA 1D7MA 1NO4A 1H0TA 2MR7A 2KWLA 1ZW0A 3TGUD 3B4QA 5EJDA 1EDIA 2QJKC 2FFDA 5DJTB 2HPCA 2QA4P 3H1HD 1NQ4A 2BEQD 3U59A 3CD6P 1HGVA 3WUVA 4AQRD 1EXIA 2L5GB 3H1LE 1H89A 2L6EA 5KP8B 2N50A 4PD4H 1JMBA 4HB1A 5CCHC 3Q2YA 1AV1A 4JPZB 2LPKA 5CJ4A 2M5AB 1AF8A 3PLNA 1K30A 2E1MA 4IPYA 2ZAEB 1S1CX 2M8PA 5GTHE 1YIJP 2A06E 3E7KA 1DD4A 1DH3A 1KTMA 5AW5B 1NTKJ 2KP8A 1ZP0C 1VQ7P 2YKOA 4TT3H 1IC2A 2FXOA 3H1LD 1GL2D 1QGKB 3CXHH 2H89C 2FYUG 2NZ2A 2AEMA 2GZFA 2W8ZA 1PEOA 1S3JA 3CI9A 3L74E 1M57D 2FYUJ 1GW4A 2A06D 3LIDA 3DS1A 1K04A 1SQVJ 2E76B 2KZIA 2I8DA 2BHVA 1OVUA 2ZYDA 2K37A 3HE4B 4XROA 1DEEG 1KORA 1NYHA 4QKOA 3A0BE 3JC22 4DT0A 1M90Q 3S4RA 1IK9A 3KZIH 1F80D 1R5LA 4NPFX 3L74D 2LTEA 1RE3C 2HODB 1HUCA 1Q90D 2JBGA 1E6JP 3RK2D 2EIAA 1X8YA 2L22A 3KDPB 1FJPA 3TDKA 1JNMA 1BGYE 4XRQA 2WSCH 1FS0E 2M8RA 2Q5UA 1NTZJ 2WZ7A 3CCMP 1PV3A 1SQPE 1LT9C 2MD9A 3AE5C 3P7KA 3CCJP 3AECC 4CPGA 4DG9A 2CNRA 5HGMA 3VYIA 4BRYB 3OA7A 1BGYD 4K3AA 2PY8A 2JDIH 1PL5A 3G26A 2XNXA 1AJYA 2I1KA 2KS1B 3MP7B 4R4MA 5B5EH 1YTZT 2XDJA 1NTMK 4BPGA 3T97B 2RMZA 1WT6A 1SQPD 1T6AA 4OVNF 2E74C 1VQ6P 3L35A 1BSNA 2FBWC 2KXPB 3HD7B 1N7LA 3C1LA 1ZMBA 2D2CD 2CG5B 1DIPA 3G9RA 2GZEA 3SWFA 1PFIA 1EZVE 4WYMA 1T8KA 4OWFA 2LF4A 1OW8A 3GZLA 1DEBA 5APYA 1LNQA 1T8ZA 4C7NA 1CI6B 1L0LE 3PP5A 1N7SC 1S5LE 5KLVK 1URQA 3FGAD 2GDYA 2MY5A 1VQ8P 1W2EA 2G3AA 5GTHH 2ZFCA 1EDLA 4GDOA 3RL0C 1J1DB 4PV1B 1GXGA 2K9JB 1PGJA 2E75B 4L74A 3B8EB 1BCCE 1FDMA 2Y9YA 2B87A 5HGNA 3TNUA 4C7RA 1L0LD 1S5LX 1E0HA 3FWLA 3HYBA 1G1IA 3GF7A 5AW2B 2JJLA 4CA3A 1Q2NA 1PGOA 3P8MC 1VQ5P 1NHLA 3JCUE 1HVVA 4I1LA 1SQBJ 2Z5HA 2IFNA 3TK1A 2VRSA 1HJBA 3A3YB 5APSA 1G2CA 2EG5A 2PEOA 1KILB 1VHNA 5KLVG 1BCCD 3A0BH 1R8EA 2QEXP 1VPCA 1SQQJ 1BAJA 4DJGA 4OGQC 1N2DC 3GHGB 2Y0EA 3CPWO 3BATA 5KKZC 3L72G 3EFFK 1E5WA 2MVUA 1ZNVA 2SPZA 2BCCE 2E75D 1KILE 2O1JA 2FVAA 1K73Q 3V4WA 1WRGA 3PRJA 3DTJA 5KTBA 1CSBA 4IL6E 4GT1A 1HTLC 3S1KA 3O8ZA 1N86A 3N7NA 4WBAA 2FQ1A 2C9NY 1FZCA 1USDA 2Q3EA 4R0MA 1VQ9P 5CCGD 3TGUG 2N6YA 2FACA 2W27A 1A43A 5F2NA 3G1GA 2AEFA 3H1HG 2BCCD 1M56D 1KILD 4H44B 1L0NK 4IL6X 4XA4A 2Q7CA 2P1JA 2O3JA 1K8AQ 3I5CA 4N6JA 3TF5A 1FE6A 3P32A 4KHXA 5F2OA 1SQXK 3GW6A 2VLQA 1E79H 4XFYA 1NU1J 4A7PA 3H1JE 2HG5D 4ASVA 1L2PA 4XE5B 2FADA 1K9MQ 3A7OA 4L73A 2JYGA 2O01J 1M1KQ 3H1LG 1KZUB 1ZR2A 1S5LH 1YI2P 2LOLA 3M1MA 1L4AB 1OVRA 1SFCC 2K94A 1RNIA 2RKLA 3VP8A 2WSFH 3H6PA 3L75J 2OYIB 1S4XA 2OTKE 2AXTE 2NPSC 2XZ0D 3VRLC 2A06G 2A45H 4XFJA 4B86A 3H1JD 2J58A 1KYOI 1RQUA 2Y0DA 2GZGA 2FQ2A 1QL1A 3EQ2A 2HLOA 3G29A 2FYNC 1Q86Q 1N73B 3E1RA 2V4HA 3Q5SA 1NTME 1FZGA 1IFIA 3DS4A 2V7QH 1JM0A 2XZ1C 1OWAA 3L74G 2YXQB 4K35A 2N5IA 2IX7C 2K88A 2OYHC 3JCUH 2WVRA 1JEKA 3L74J 5K5GB 2X2BA 1M1JA 5AW8B 2JQ4A 1JY3O 2K9YA 3B5ND 2L0QA 3PH0A 1FZFA 1NTMD 3MGEA 5APQA 2KGEA 4BWNA 5L8RJ 5KJ7C 2CPSA 2CGQA 2N5HA 4GODA 3V2PA 5HGLA 4JYCA 4WY4C 3FXDA 1PEQA 1GL2A 1VDFA 3AE1C 3WUUA 1BGYG 2Q3IA 1KQLA 4U0FA 1GU4A 3H1KJ 2M8NA 3HUSB 1QRJA 2L9FA 4PH1A 4IL6H 3L71J 2K93A 4H0LC 2IBZI 3CC2P 3I56P 3CX5H 1SQPG 2FY8A 2FAEA 5AVXB 3RL0g 3GZMA 1L0LK 4GOEA 1YYCA 3L37A 3VMZA 2ZVOB 3NFQA 4U0AA 1YJWP 4U3FE 3OAKA 2M5AA 2R3SA 2KIKA 2EHSA 1P84I 2QJKB 3MUDA 2KORA 2QVAA 2W90A 1VQ4P 5BS2A 3RK3C 3RGUA 2KUBA 3AE2C 3EWKA 2FQ0A 2IPPA 2I1JA 2KOPA 2PP6A 3KHUA 1RO2A 3G6EP 1X9VA 4D6TJ 1UIIA 3M9BA 4I6MC 4U3FD 1NVOA 1LWUB 2PGDA 1YITP 2OQQA 1QEXA 3SWYA 1NTKK 1PIXA 1GK4A 3MTUE 3M91A 3L70J 4I7ZC 5APWA 1IUQA 1UNKA 1N8RQ 2JU2A 3EJDA 4RESB 2IZ0A 1L0LG 2B89A 4AUWA 2MJZA 3HE4A 2QM7A 2AXTH 1VQNP 1ZOYC 1NJIQ 1M1JC 4KT0J 4R4LA 2A45G 5BU8B 2Z4EA 1SQVK 3BRTB 5GTIE 4IZ6A 2XT1A 2WSFJ 2N98A 3A2AA 2HODA 1U57A 4ZKUA 1BCCG 2AXCA 3RK2B 1UIXA 1L0NE 4U0CA 4YTPC 1GK6A 1BCCJ 3RBZA 2PEJA 3HTKB 5CCHD 1QX8A 3MZWB 1BE3E 2WMMA 4Y99C 4EI2A 2PENA 1SQXE 5EFWB 3Q3DA 5HVCA 2WTYA 1J2JB 2ITAA 2QSIA 1L0ND 3CLQA 4BRYA 3IN6A 4COCA 2XXMA 1KQFB 4HYTB 2LKIA 1VL2A 2L91A 3C9IA 3QWOC 4HH2A 3IR9A 1KQSO 1LGHB 2N1TC 3U1AA 3V5BA 3FX0A 1DV5A 1LP1B 1YJ9P 3T97A 2KGDA 1FC2C 1LT9B 1BE3D 1Z56A 3BASA 3H1ID 1SQXD 2K3RA 2VLNA 2XZRA 2LIUA 3AE9C 2BCCG 4PH0A 1OX3A 3M0DC 3HD7A 2JP3A 2D2CB 1RE4C 1USEA 3H4EA 2QM8A 2WPRA 3S9OA 2Z5IA 5DCKA 1DNYA 1JMMA 3E2DA 3W67A 1GU5A 2E74B 1EQ7A 2FFDC 1D1DA 2R3CA 4DZOA 5C39A 2AFEA 2E76C 2KG8A 2W6JH 2WSEJ 2JO0A 1YJNP 1OW7A 1EDJA 3D6YA 2JU1A 3EJEA 2H88C 5AVZB 3RBXA 1M6EX 3DS2A 2GA1A 3GJNA 1G1JA 4ZNCA 1LT1A 2R5DA 1N7SB 1FZAA 5AVSB 3CCLP 3H1JG 2O01N 2DW3A 5BVZA 4DCKA 3AEDC 3AE6C 5CCGA 3F5HA 2IYPA 3O6QB 3L73E 1WMKA 4WVZA 1NH4A 3RL0B 2CQ8A 2XV5A 2RN0A 1KILA 3G28A 2HYNA 5E79E 3AE8C 3D6ZA 2YO3A 2C0WA 5AVRB 3KQGA 2E74D 1KYOE 3M9QA 1VQKP 5GTIH 3GHGA 3L73D 2AEJA 1VF5C
chains in the Genus database with same CATH topology
2BUOA 5HGMA 2M8PA 3H4EA 1YIJP 1KC8Q 1VQ5P 1Q81Q 2DGYA 2PEKA 5HGLA 5F2OA 2OTLP 2PY8A 5DCKA 2JYLA 1VQNP 1PEQA 1NJIQ 3G26A 4U0BA 3E2DA 1VQMP 4XFYA 1VQ7P 3Q20A 1EOQA 3CCSP 3G0VA 1Q82Q 2EG5A 4M0IA 2PEOA 4U0FA 3CCVP 1VQLP 2OTJP 2M8NA 1S72P 1D1DA 1M74A 2XT1A 1K9MQ 4COPA 2KODA 2JYGA 4QNBA 3HZQA 1QRJA 3H47A 2QEXP 1M1KQ 4PH1A 1BAJA 1PEOA 5JPAA 3CC2P 1PEMA 3I56P 1PEUA 3G71P 1VQ6P 1YI2P 3P05A 1EIAA 2JO0A 3DS5A 3G4SP 3DS3A 3M1MA 3CPWO 4GR2A 4U0CA 3CMEP 3B5IA 4U0DA 1RNIA 4GR6A 3CXCO 1YJNP 1QVGO 3DS1A 1YHQP 3CC4P 1ZMBA 2PEQA 3VRLC 3DS0A 1A8OA 2PEMA 3RG6C 1M6EX 1VQOP 3DS2A 2PEJA 2BHVA 4U0AA 4WYMA 2PEIA 4XROA 3H0DA 1YJWP 2LF4A 3CCEP 1K73Q 3CCLP 2PENA 3DTJA 2Z46A 3OW2O 2OARA 4XFZA 1AUMA 1M90Q 1QVFO 1Q7YQ 3G29A 3I55P 1Q86Q 1VQ4P 2CWOA 2M8LA 1RO0A 5BS2A 4U0EA 3DPHA 3DS4A 3CCRP 2Z44A 1VQ8P 1E6JP 2XXMA 2P9XA 4COCA 1VQ9P 1KD1Q 2EIAA 1VQPP 1RO2A 3WBHA 1A43A 3G6EP 3CCQP 3NTEA 5F2NA 4XRQA 2QA4P 3G1GA 1KQSO 3CMAP 3CD6P 3G28A 2BQ1E 4XFXA 3CC7P 2ONTA 2EFJA 1YJ9P 1M6NA 1YITP 2L6EA 1JJ2O 1VQKP 2Z45A 5F2KA 3G21A 5BS1A 4PH0A 5HGOA 3CCMP 5HGNA 1W2BO 1IUQA 1N8RQ 3LRYA 1K30A 5I4TG 3HYBA 3G1IA 3MGEA 2E1MA 1K8AQ 3CCJP 2XV6A 3CCUP 4IPYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CD6 P;  1K73 Q;  3CCL P;  3CC7 P;  1YIJ P;  3CC2 P;  1KC8 Q;  3OW2 O;  3I56 P;  1VQ5 P;  3G71 P;  1YJ9 P;  1Q81 Q;  1M90 Q;  1YI2 P;  3CCE P;  3G4S P;  1QVF O;  1VQ6 P;  2OTL P;  3CPW O;  1Q7Y Q;  3I55 P;  1YIT P;  3CME P;  1Q86 Q;  1VQ4 P;  1VQN P;  1NJI Q;  1VQM P;  1JJ2 O;  1VQK P;  3CXC O;  1YJN P;  1QVG O;  1VQ7 P;  3CCM P;  3CCS P;  1YHQ P;  1W2B O;  1Q82 Q;  3CC4 P;  1N8R Q;  3CCR P;  3CCV P;  1VQ8 P;  1VQL P;  1VQO P;  1VQ9 P;  2OTJ P;  1S72 P;  1KD1 Q;  1VQP P;  1K9M Q;  1K8A Q;  3G6E P;  2QEX P;  3CCJ P;  3CCQ P;  1YJW P;  1M1K Q;  2QA4 P;  3CCU P;  1KQS O;  3CMA P; 
#chains in the Genus database with same CATH topology
 4W7Y A;  1NAF A;  1NTM G;  2FVE A;  1A02 J;  3GLM A;  2FYZ A;  3H32 B;  1XTC C;  3PHL A;  2L4B A;  2QIW A;  4U0B A;  2WT7 A;  1NTM J;  2LML A;  1N7S D;  2K92 A;  1PP9 E;  1KYO D;  3HD7 C;  3R4Y A;  2QJY C;  1X3O A;  5JPA A;  2KSE A;  3GKL C;  2P67 A;  2DNW A;  2LKM A;  1JUN A;  3G4S P;  1NTK E;  3DS3 A;  3AEA C;  3RL0 D;  5KP7 B;  4N78 E;  2IZ1 A;  1YQ3 C;  1ZRT E;  1Y9B A;  2PEM A;  1VQO P;  3AE3 C;  5KAI E;  4MN4 C;  2WQY C;  1PP9 D;  2VLO A;  1QLE D;  1AFO A;  2Z46 A;  1EMV A;  2BEZ F;  2ZXE B;  5KLV J;  2JO1 A;  2YMY A;  1YQ4 C;  2IBZ E;  1S9K E;  1J1D C;  1SQV E;  3V2Q A;  4PV1 C;  1NTK D;  2ZT9 C;  2UWJ E;  2JR8 A;  2P9X A;  4N78 D;  1KD1 Q;  2GYK A;  1X0T A;  3L72 J;  1ZRT D;  3NTE A;  3U43 A;  4HJG H;  4AYC A;  1RF0 A;  2BQ1 E;  1IFN A;  1T3J A;  2WSC J;  4OGQ D;  1R5S A;  4QMA A;  4RKU J;  4U3F G;  1P84 E;  7CEI A;  1NU1 K;  4NEO A;  1L4A A;  2Y0C A;  2QNW A;  2IBZ D;  1S9K D;  1SQV D;  2OYI A;  2WIT A;  2JWA A;  3B4S A;  3TGU J;  1NTZ E;  1GMJ A;  2KNC B;  1VQM P;  1URQ C;  3BVH A;  3G0V A;  2E43 A;  2R5B A;  2YIU B;  2KG9 A;  1TU3 F;  3H1H J;  1N73 A;  5KLI C;  1FR2 A;  2QJP B;  3HZQ A;  1P84 D;  1OVV A;  1SFC B;  3P8C E;  2HR3 A;  1LTI C;  2LXB A;  2NPS B;  3USS A;  1QVG O;  1SP4 A;  1NTZ D;  2RH0 A;  2PEQ A;  3NTN A;  2YKP A;  5E79 H;  1IFD A;  1OMI A;  1A02 F;  2FYN B;  3B5N B;  3CCE P;  3BRV B;  1KYO H;  1QVF O;  2NRG A;  3P8C D;  1U7J A;  3H1L J;  4I2L C;  1RO0 A;  2LIW A;  2W83 C;  3DPH A;  4YXW H;  2OYH B;  2QRX A;  1OXZ A;  4H44 C;  3W68 A;  1JCD A;  1L0N G;  5KP6 B;  3CCQ P;  1LTJ B;  2PNG A;  4H13 C;  3NXS A;  3HUS A;  1RF1 B;  1LJ2 A;  5CMZ A;  1RH5 B;  1BSH A;  2CK3 H;  1LTB C;  3C8V A;  2P2U A;  2PAJ A;  1BE3 G;  1SFC D;  3H1I G;  1SQX G;  2B9B A;  2NPS D;  4WY4 B;  1JY2 O;  4Y28 J;  1SQX J;  5APU A;  2KYV A;  2CPB A;  1KB9 I;  4N3Y B;  5DJU B;  2LR2 A;  1IJD B;  3HE5 B;  5KAI H;  5APV A;  1MFZ A;  1EOQ A;  1KFM A;  4H0L B;  1L4A C;  1VQL P;  1FZC C;  1FZB A;  1YTZ I;  1GXH A;  5AW0 B;  1IFP A;  1ZR4 A;  1FOS F;  1HBW A;  1IFM A;  3SSU A;  3VMY A;  2YNY A;  1J1E C;  1SQB E;  4LLH A;  1Y47 A;  4EDF A;  1YHQ P;  4UB8 E;  4PXH B;  1LWU A;  1BDC A;  1A8O A;  1KV4 A;  3WU2 E;  1SQQ E;  1BGY J;  1JTH B;  2XKM A;  3IF4 A;  3RK3 B;  3MIW A;  1BXI A;  4Z1M H;  1OW6 A;  4WWI A;  1Q7Y Q;  1P84 H;  1NAY A;  5KJ7 D;  2M8L A;  4H2X C;  4KJM A;  4WY4 D;  1PZQ A;  1SQB D;  2W6A A;  1SQP J;  3ITK A;  3WBH A;  2H7H A;  2EHT A;  3VP9 A;  1JY3 P;  1ZME C;  5AVY B;  3RG2 A;  2JWD A;  2ONT A;  2K1A A;  2EFJ A;  1ZN5 A;  1SQQ D;  4H0L D;  4BPF A;  5KAF E;  3HRN A;  3GG2 A;  3RK3 E;  5B66 E;  3LRY A;  5CBN A;  3G1I A;  1LTS C;  3CX5 I;  3L73 G;  1Q81 Q;  3HTK A;  1HWT C;  2VLP A;  1X22 A;  2PEK A;  2XND H;  2JYL A;  2VSQ A;  3EFG A;  3Q20 A;  1RE3 A;  1UJZ A;  3CCV P;  2Q6Q A;  3ZDM A;  3RK3 D;  2GZJ A;  5AVW B;  2KOS A;  3PTZ A;  1AVY A;  4IOI H;  2M0B A;  1NWQ A;  1OZH A;  2KG6 A;  4DOJ A;  2WPT A;  1YBK A;  3AEE C;  3P05 A;  2E42 A;  3DS5 A;  4GR2 A;  3AE4 C;  1H88 A;  1L0L J;  4GR6 A;  4YXD C;  1NU1 E;  1KLP A;  1LP1 A;  2FYU K;  4Y99 B;  2ERH A;  1IFJ A;  1LT9 A;  3DS0 A;  2BAS A;  2R32 A;  2HFE D;  4F37 A;  2PEI A;  3EJB A;  2AF8 A;  1MZ8 A;  1AUM A;  1SVF A;  1PP9 G;  2PRR A;  2CWO A;  3L75 E;  1GL2 C;  4HKZ H;  2KB7 P;  1NOH A;  2N1T B;  2AFD A;  1LWU C;  1PP9 J;  1NU1 D;  1NTK G;  1HH0 A;  2N9B A;  3U1C A;  2V7Q J;  4GIF A;  1AQT A;  3VN0 A;  1EC5 A;  2GUS A;  3CC7 P;  3H1I E;  2GUV A;  1FZE A;  1Y8A A;  1JOC A;  4PD4 I;  1T3U A;  1GTW A;  1JJ2 O;  2Z45 A;  5F2K A;  2MF4 A;  1MKM A;  3G21 A;  5BS1 A;  3H25 A;  4RJT A;  1NTZ K;  5APX A;  4MRT C;  3L75 D;  4NPD A;  4UHP B;  2XU6 A;  2E5T A;  2KS1 A;  5M1B A;  2KK7 A;  2IBZ G;  1SQV G;  2QE7 H;  3A0H E;  2P58 A;  1H0T B;  1KC8 Q;  3M0A A;  1MUU A;  3MUD C;  4UB8 H;  1N7S A;  3K5B A;  2KGA A;  2FFD B;  2KSJ A;  3RK2 C;  1HGZ A;  3R2P A;  4HKG A;  1DD3 A;  2HPC B;  1OR5 A;  1GZL A;  3WU2 H;  2Y9Z A;  3CXH I;  2JGP A;  2OTJ P;  1S72 P;  3TSI A;  2WWW A;  4BPH A;  3O6Q A;  1NKZ B;  4ZMD A;  1ZV8 A;  2BCC J;  1IO4 A;  4OH8 B;  1PEU A;  3D70 A;  3G71 P;  2R44 A;  2N1T D;  3NY7 B;  3CWB E;  3CXC O;  2KW2 A;  3V4Q A;  4RO0 A;  3H1K E;  5BU5 A;  4EOT A;  1CI6 A;  3D71 A;  2JKV A;  1NTZ G;  3L71 E;  5KAF H;  2YMK A;  5B66 H;  4UB6 E;  2KGC A;  4XFZ A;  1L0H A;  4EYY Q;  2LL8 A;  1PGQ A;  2GDW A;  3ABV C;  3KPE A;  5HV8 A;  3CWB D;  3H32 A;  2K9J A;  3H1K D;  1NGM B;  4XFX A;  3B71 A;  2E76 D;  3L71 D;  2D2C C;  5TIS E;  2FHS C;  1PPJ E;  2IDB A;  1VF5 B;  5AW4 B;  3H1J J;  2ZVN B;  2QG4 A;  1GPJ A;  3BCC E;  2H8P D;  4D6T E;  1IK7 A;  2XV6 A;  2BUO A;  1PGP A;  1HY8 A;  1H8A A;  2DGY A;  1KMI Z;  5CJ0 A;  5TJH A;  2MR8 A;  3FWN A;  3V2N A;  3L70 E;  2QJY B;  2O01 H;  1SQB K;  3VTP C;  1RQV A;  2IFM A;  1LTA C;  1PPJ D;  3SFE C;  2KOD A;  3WUT A;  4QNB A;  3LW5 H;  3BCC D;  2N6Z A;  1PEM A;  4D6T D;  1SQQ K;  2Q1K A;  1EIA A;  2JAZ A;  3G3Z A;  2KR5 A;  1W5C E;  2M3E A;  2GDX A;  3IAO A;  2JEE A;  4GOF A;  5AVT B;  4WB4 A;  1KB9 E;  4BXL A;  3L70 D;  4OGQ B;  2H43 A;  5KKZ B;  1FBM A;  3VOP A;  1EZV D;  1ZLL A;  2ZT9 B;  1VF5 D;  5AW6 B;  3CCR P;  4LC1 A;  1S2E A;  2KNC A;  3A0H H;  4YPC A;  1EXJ A;  1SQB G;  4L76 A;  1T2K C;  3KYQ A;  1KB9 D;  3V6I A;  1HF9 A;  1GW3 A;  2P10 A;  2M3B A;  4IFM A;  3F89 A;  3HD7 D;  2WPS A;  2K0X A;  1X79 B;  1ACP A;  2KI7 B;  1FAV A;  1SFC A;  2FYU E;  1IMQ A;  1HJ0 A;  2LXC B;  1JY2 N;  3SFD C;  1SQQ G;  1W2B O;  2NPS A;  5EW5 E;  4C7N B;  2E75 C;  4PJ0 E;  4LGD E;  3M06 A;  3CCU P;  3V2R A;  2J59 M;  2MKV A;  1T2K D;  3CL3 D;  1L0I A;  1URQ B;  1JY3 N;  2WPV B;  3B5N A;  5KLI B;  4ASW A;  2OGU A;  4JYB A;  5CCG C;  3CCS P;  1U7M A;  1M7L A;  2FYU D;  2C0X A;  2WSS H;  4JF7 A;  4PV1 D;  5H2F E;  2ZT9 D;  3WMM 0;  4UB6 H;  2OYH A;  2IYO A;  5AW9 B;  4U3F J;  1KIL C;  2WT7 B;  2KLU A;  1AQ5 A;  2B87 B;  2OYO A;  3TNU B;  1LTJ A;  1ZXG A;  1KFN A;  3CME P;  1M8O B;  1EDK A;  3AEF C;  3LIE A;  3CX5 E;  2W6B A;  1KN7 A;  1RF1 A;  3CC4 P;  3GHG C;  2P7J A;  1FJK A;  1AVO A;  2J5U A;  5AW3 B;  3H0D A;  2FXP A;  1RY3 A;  5KJ7 A;  4O9B A;  5TIS H;  3OW2 O;  1Z6M A;  1G2C B;  3II6 A;  1QL2 A;  4WY4 A;  3I55 P;  1IZN B;  1BDD A;  2K5X A;  4H13 B;  3CX5 D;  4NPE A;  1URQ D;  3HE5 A;  2Q9I A;  2KOG A;  4PWV B;  2YO2 A;  3CMA P;  1FDI A;  1MV8 A;  1LTG C;  1NU1 G;  2N9Y B;  3AEB C;  3L4F A;  2ZYG A;  3VMX A;  1CZQ A;  5AVU B;  3Q5R A;  2GZI A;  1IMP A;  2POH A;  2O1K A;  1GDT A;  1HQB A;  2FXM A;  3N4X A;  3A5T A;  3L75 G;  2YIU C;  4W7Z A;  2YKQ A;  2NO8 A;  3LW5 J;  3MHV A;  2QJP C;  1L0N J;  2OTL P;  3FXE A;  1FZC B;  1JTH A;  1KB9 H;  1LTT C;  5APT A;  1EZV I;  5AVV B;  1GD2 E;  4PD4 E;  1J1E B;  3CE7 A;  4COP A;  3IFM A;  3NMD A;  3H47 A;  2FVF A;  4H2W C;  4H44 D;  2E5Y A;  1MFT A;  5CZD B;  1RF0 C;  1BE3 J;  3H1I J;  3KXD A;  4JBZ A;  4GKG A;  2K0D X;  4H13 D;  3B5N C;  3B5I A;  4U0D A;  4TLF A;  1FDO A;  2A45 I;  4IFD K;  1JB0 J;  1VKU A;  2ZXX A;  2WPQ A;  3Q5P A;  2MVV A;  3E1I A;  1SQP K;  2KLV A;  4U7J A;  2OYI C;  4PD4 D;  3CXH E;  4IFF A;  1RHZ B;  1MZ9 A;  1JCC A;  3SWK A;  1LTJ C;  1CW5 A;  3AE7 C;  3MGN A;  1SS1 A;  4M3L A;  4U0E A;  3GF3 A;  2PFX A;  1DX7 A;  1RF1 C;  5CHX A;  5CCH A;  4PJ0 H;  2Z44 A;  4JQ0 D;  1VQP P;  1N73 C;  1OFC X;  1L4A D;  3CWB G;  3JSV C;  3OJA B;  3H1K G;  5KLV E;  5CBO A;  1M6N A;  1SLQ A;  3VMA A;  4C46 A;  3M9H A;  3CXH D;  1JY2 P;  3CWB J;  4H2Y C;  5AVQ B;  5HGO A;  2KZJ A;  3L71 G;  5H2F H;  2K2Q A;  2M5R A;  1OIP A;  3KZI E;  2G8Y A;  3MD0 A;  5I4T G;  1K05 A;  3L72 E;  1AYI A;  1KQG B;  2KOQ A;  2C9L Y;  2GM4 A;  3UIA A;  2K0Y A;  5AW1 B;  3PJS K;  4I7Z B;  2ROQ A;  1FOS E;  3Q1M A;  1CEI A;  5KLV D;  1Q82 Q;  4M0I A;  1M74 A;  2YXR B;  2WSE H;  1NKN A;  2N1T A;  2ZYA A;  1PPJ G;  4EIJ A;  3L72 D;  3QH9 A;  1M1J B;  2FKW B;  2JB0 A;  3HUS C;  4W80 A;  3TGU E;  1AA0 A;  3L36 A;  3BCC G;  3GMA A;  5AW7 B;  4D6T G;  3TYY A;  1JO5 A;  3L73 J;  1XTG B;  3H1H E;  2B88 A;  3RG6 C;  3M0D A;  3BCC J;  5B5E E;  1FU1 A;  1RE4 A;  4L75 A;  1GL2 B;  3L70 G;  2ZJS E;  2KOO A;  2OAR A;  4ZKP A;  2AVA A;  3AEG C;  1EZV G;  3LMO A;  1D7M A;  1NO4 A;  1H0T A;  2MR7 A;  2KWL A;  1ZW0 A;  3TGU D;  3B4Q A;  5EJD A;  1EDI A;  2QJK C;  2FFD A;  5DJT B;  2HPC A;  2QA4 P;  3H1H D;  1NQ4 A;  2BEQ D;  3U59 A;  3CD6 P;  1HGV A;  3WUV A;  4AQR D;  1EXI A;  2L5G B;  3H1L E;  1H89 A;  2L6E A;  5KP8 B;  2N50 A;  4PD4 H;  1JMB A;  4HB1 A;  5CCH C;  3Q2Y A;  1AV1 A;  4JPZ B;  2LPK A;  5CJ4 A;  2M5A B;  1AF8 A;  3PLN A;  1K30 A;  2E1M A;  4IPY A;  2ZAE B;  1S1C X;  2M8P A;  5GTH E;  1YIJ P;  2A06 E;  3E7K A;  1DD4 A;  1DH3 A;  1KTM A;  5AW5 B;  1NTK J;  2KP8 A;  1ZP0 C;  1VQ7 P;  2YKO A;  4TT3 H;  1IC2 A;  2FXO A;  3H1L D;  1GL2 D;  1QGK B;  3CXH H;  2H89 C;  2FYU G;  2NZ2 A;  2AEM A;  2GZF A;  2W8Z A;  1PEO A;  1S3J A;  3CI9 A;  3L74 E;  1M57 D;  2FYU J;  1GW4 A;  2A06 D;  3LID A;  3DS1 A;  1K04 A;  1SQV J;  2E76 B;  2KZI A;  2I8D A;  2BHV A;  1OVU A;  2ZYD A;  2K37 A;  3HE4 B;  4XRO A;  1DEE G;  1KOR A;  1NYH A;  4QKO A;  3A0B E;  3JC2 2;  4DT0 A;  1M90 Q;  3S4R A;  1IK9 A;  3KZI H;  1F80 D;  1R5L A;  4NPF X;  3L74 D;  2LTE A;  1RE3 C;  2HOD B;  1HUC A;  1Q90 D;  2JBG A;  1E6J P;  3RK2 D;  2EIA A;  1X8Y A;  2L22 A;  3KDP B;  1FJP A;  3TDK A;  1JNM A;  1BGY E;  4XRQ A;  2WSC H;  1FS0 E;  2M8R A;  2Q5U A;  1NTZ J;  2WZ7 A;  3CCM P;  1PV3 A;  1SQP E;  1LT9 C;  2MD9 A;  3AE5 C;  3P7K A;  3CCJ P;  3AEC C;  4CPG A;  4DG9 A;  2CNR A;  5HGM A;  3VYI A;  4BRY B;  3OA7 A;  1BGY D;  4K3A A;  2PY8 A;  2JDI H;  1PL5 A;  3G26 A;  2XNX A;  1AJY A;  2I1K A;  2KS1 B;  3MP7 B;  4R4M A;  5B5E H;  1YTZ T;  2XDJ A;  1NTM K;  4BPG A;  3T97 B;  2RMZ A;  1WT6 A;  1SQP D;  1T6A A;  4OVN F;  2E74 C;  1VQ6 P;  3L35 A;  1BSN A;  2FBW C;  2KXP B;  3HD7 B;  1N7L A;  3C1L A;  1ZMB A;  2D2C D;  2CG5 B;  1DIP A;  3G9R A;  2GZE A;  3SWF A;  1PFI A;  1EZV E;  4WYM A;  1T8K A;  4OWF A;  2LF4 A;  1OW8 A;  3GZL A;  1DEB A;  5APY A;  1LNQ A;  1T8Z A;  4C7N A;  1CI6 B;  1L0L E;  3PP5 A;  1N7S C;  1S5L E;  5KLV K;  1URQ A;  3FGA D;  2GDY A;  2MY5 A;  1VQ8 P;  1W2E A;  2G3A A;  5GTH H;  2ZFC A;  1EDL A;  4GDO A;  3RL0 C;  1J1D B;  4PV1 B;  1GXG A;  2K9J B;  1PGJ A;  2E75 B;  4L74 A;  3B8E B;  1BCC E;  1FDM A;  2Y9Y A;  2B87 A;  5HGN A;  3TNU A;  4C7R A;  1L0L D;  1S5L X;  1E0H A;  3FWL A;  3HYB A;  1G1I A;  3GF7 A;  5AW2 B;  2JJL A;  4CA3 A;  1Q2N A;  1PGO A;  3P8M C;  1VQ5 P;  1NHL A;  3JCU E;  1HVV A;  4I1L A;  1SQB J;  2Z5H A;  2IFN A;  3TK1 A;  2VRS A;  1HJB A;  3A3Y B;  5APS A;  1G2C A;  2EG5 A;  2PEO A;  1KIL B;  1VHN A;  5KLV G;  1BCC D;  3A0B H;  1R8E A;  2QEX P;  1VPC A;  1SQQ J;  1BAJ A;  4DJG A;  4OGQ C;  1N2D C;  3GHG B;  2Y0E A;  3CPW O;  3BAT A;  5KKZ C;  3L72 G;  3EFF K;  1E5W A;  2MVU A;  1ZNV A;  2SPZ A;  2BCC E;  2E75 D;  1KIL E;  2O1J A;  2FVA A;  1K73 Q;  3V4W A;  1WRG A;  3PRJ A;  3DTJ A;  5KTB A;  1CSB A;  4IL6 E;  4GT1 A;  1HTL C;  3S1K A;  3O8Z A;  1N86 A;  3N7N A;  4WBA A;  2FQ1 A;  2C9N Y;  1FZC A;  1USD A;  2Q3E A;  4R0M A;  1VQ9 P;  5CCG D;  3TGU G;  2N6Y A;  2FAC A;  2W27 A;  1A43 A;  5F2N A;  3G1G A;  2AEF A;  3H1H G;  2BCC D;  1M56 D;  1KIL D;  4H44 B;  1L0N K;  4IL6 X;  4XA4 A;  2Q7C A;  2P1J A;  2O3J A;  1K8A Q;  3I5C A;  4N6J A;  3TF5 A;  1FE6 A;  3P32 A;  4KHX A;  5F2O A;  1SQX K;  3GW6 A;  2VLQ A;  1E79 H;  4XFY A;  1NU1 J;  4A7P A;  3H1J E;  2HG5 D;  4ASV A;  1L2P A;  4XE5 B;  2FAD A;  1K9M Q;  3A7O A;  4L73 A;  2JYG A;  2O01 J;  1M1K Q;  3H1L G;  1KZU B;  1ZR2 A;  1S5L H;  1YI2 P;  2LOL A;  3M1M A;  1L4A B;  1OVR A;  1SFC C;  2K94 A;  1RNI A;  2RKL A;  3VP8 A;  2WSF H;  3H6P A;  3L75 J;  2OYI B;  1S4X A;  2OTK E;  2AXT E;  2NPS C;  2XZ0 D;  3VRL C;  2A06 G;  2A45 H;  4XFJ A;  4B86 A;  3H1J D;  2J58 A;  1KYO I;  1RQU A;  2Y0D A;  2GZG A;  2FQ2 A;  1QL1 A;  3EQ2 A;  2HLO A;  3G29 A;  2FYN C;  1Q86 Q;  1N73 B;  3E1R A;  2V4H A;  3Q5S A;  1NTM E;  1FZG A;  1IFI A;  3DS4 A;  2V7Q H;  1JM0 A;  2XZ1 C;  1OWA A;  3L74 G;  2YXQ B;  4K35 A;  2N5I A;  2IX7 C;  2K88 A;  2OYH C;  3JCU H;  2WVR A;  1JEK A;  3L74 J;  5K5G B;  2X2B A;  1M1J A;  5AW8 B;  2JQ4 A;  1JY3 O;  2K9Y A;  3B5N D;  2L0Q A;  3PH0 A;  1FZF A;  1NTM D;  3MGE A;  5APQ A;  2KGE A;  4BWN A;  5L8R J;  5KJ7 C;  2CPS A;  2CGQ A;  2N5H A;  4GOD A;  3V2P A;  5HGL A;  4JYC A;  4WY4 C;  3FXD A;  1PEQ A;  1GL2 A;  1VDF A;  3AE1 C;  3WUU A;  1BGY G;  2Q3I A;  1KQL A;  4U0F A;  1GU4 A;  3H1K J;  2M8N A;  3HUS B;  1QRJ A;  2L9F A;  4PH1 A;  4IL6 H;  3L71 J;  2K93 A;  4H0L C;  2IBZ I;  3CC2 P;  3I56 P;  3CX5 H;  1SQP G;  2FY8 A;  2FAE A;  5AVX B;  3RL0 g;  3GZM A;  1L0L K;  4GOE A;  1YYC A;  3L37 A;  3VMZ A;  2ZVO B;  3NFQ A;  4U0A A;  1YJW P;  4U3F E;  3OAK A;  2M5A A;  2R3S A;  2KIK A;  2EHS A;  1P84 I;  2QJK B;  3MUD A;  2KOR A;  2QVA A;  2W90 A;  1VQ4 P;  5BS2 A;  3RK3 C;  3RGU A;  2KUB A;  3AE2 C;  3EWK A;  2FQ0 A;  2IPP A;  2I1J A;  2KOP A;  2PP6 A;  3KHU A;  1RO2 A;  3G6E P;  1X9V A;  4D6T J;  1UII A;  3M9B A;  4I6M C;  4U3F D;  1NVO A;  1LWU B;  2PGD A;  1YIT P;  2OQQ A;  1QEX A;  3SWY A;  1NTK K;  1PIX A;  1GK4 A;  3MTU E;  3M91 A;  3L70 J;  4I7Z C;  5APW A;  1IUQ A;  1UNK A;  1N8R Q;  2JU2 A;  3EJD A;  4RES B;  2IZ0 A;  1L0L G;  2B89 A;  4AUW A;  2MJZ A;  3HE4 A;  2QM7 A;  2AXT H;  1VQN P;  1ZOY C;  1NJI Q;  1M1J C;  4KT0 J;  4R4L A;  2A45 G;  5BU8 B;  2Z4E A;  1SQV K;  3BRT B;  5GTI E;  4IZ6 A;  2XT1 A;  2WSF J;  2N98 A;  3A2A A;  2HOD A;  1U57 A;  4ZKU A;  1BCC G;  2AXC A;  3RK2 B;  1UIX A;  1L0N E;  4U0C A;  4YTP C;  1GK6 A;  1BCC J;  3RBZ A;  2PEJ A;  3HTK B;  5CCH D;  1QX8 A;  3MZW B;  1BE3 E;  2WMM A;  4Y99 C;  4EI2 A;  2PEN A;  1SQX E;  5EFW B;  3Q3D A;  5HVC A;  2WTY A;  1J2J B;  2ITA A;  2QSI A;  1L0N D;  3CLQ A;  4BRY A;  3IN6 A;  4COC A;  2XXM A;  1KQF B;  4HYT B;  2LKI A;  1VL2 A;  2L91 A;  3C9I A;  3QWO C;  4HH2 A;  3IR9 A;  1KQS O;  1LGH B;  2N1T C;  3U1A A;  3V5B A;  3FX0 A;  1DV5 A;  1LP1 B;  1YJ9 P;  3T97 A;  2KGD A;  1FC2 C;  1LT9 B;  1BE3 D;  1Z56 A;  3BAS A;  3H1I D;  1SQX D;  2K3R A;  2VLN A;  2XZR A;  2LIU A;  3AE9 C;  2BCC G;  4PH0 A;  1OX3 A;  3M0D C;  3HD7 A;  2JP3 A;  2D2C B;  1RE4 C;  1USE A;  3H4E A;  2QM8 A;  2WPR A;  3S9O A;  2Z5I A;  5DCK A;  1DNY A;  1JMM A;  3E2D A;  3W67 A;  1GU5 A;  2E74 B;  1EQ7 A;  2FFD C;  1D1D A;  2R3C A;  4DZO A;  5C39 A;  2AFE A;  2E76 C;  2KG8 A;  2W6J H;  2WSE J;  2JO0 A;  1YJN P;  1OW7 A;  1EDJ A;  3D6Y A;  2JU1 A;  3EJE A;  2H88 C;  5AVZ B;  3RBX A;  1M6E X;  3DS2 A;  2GA1 A;  3GJN A;  1G1J A;  4ZNC A;  1LT1 A;  2R5D A;  1N7S B;  1FZA A;  5AVS B;  3CCL P;  3H1J G;  2O01 N;  2DW3 A;  5BVZ A;  4DCK A;  3AED C;  3AE6 C;  5CCG A;  3F5H A;  2IYP A;  3O6Q B;  3L73 E;  1WMK A;  4WVZ A;  1NH4 A;  3RL0 B;  2CQ8 A;  2XV5 A;  2RN0 A;  1KIL A;  3G28 A;  2HYN A;  5E79 E;  3AE8 C;  3D6Z A;  2YO3 A;  2C0W A;  5AVR B;  3KQG A;  2E74 D;  1KYO E;  3M9Q A;  1VQK P;  5GTI H;  3GHG A;  3L73 D;  2AEJ A;  1VF5 C; 
#chains in the Genus database with same CATH homology
 2BUO A;  5HGM A;  2M8P A;  3H4E A;  1YIJ P;  1KC8 Q;  1VQ5 P;  1Q81 Q;  2DGY A;  2PEK A;  5HGL A;  5F2O A;  2OTL P;  2PY8 A;  5DCK A;  2JYL A;  1VQN P;  1PEQ A;  1NJI Q;  3G26 A;  4U0B A;  3E2D A;  1VQM P;  4XFY A;  1VQ7 P;  3Q20 A;  1EOQ A;  3CCS P;  3G0V A;  1Q82 Q;  2EG5 A;  4M0I A;  2PEO A;  4U0F A;  3CCV P;  1VQL P;  2OTJ P;  2M8N A;  1S72 P;  1D1D A;  1M74 A;  2XT1 A;  1K9M Q;  4COP A;  2KOD A;  2JYG A;  4QNB A;  3HZQ A;  1QRJ A;  3H47 A;  2QEX P;  1M1K Q;  4PH1 A;  1BAJ A;  1PEO A;  5JPA A;  3CC2 P;  1PEM A;  3I56 P;  1PEU A;  3G71 P;  1VQ6 P;  1YI2 P;  3P05 A;  1EIA A;  2JO0 A;  3DS5 A;  3G4S P;  3DS3 A;  3M1M A;  3CPW O;  4GR2 A;  4U0C A;  3CME P;  3B5I A;  4U0D A;  1RNI A;  4GR6 A;  3CXC O;  1YJN P;  1QVG O;  3DS1 A;  1YHQ P;  3CC4 P;  1ZMB A;  2PEQ A;  3VRL C;  3DS0 A;  1A8O A;  2PEM A;  3RG6 C;  1M6E X;  1VQO P;  3DS2 A;  2PEJ A;  2BHV A;  4U0A A;  4WYM A;  2PEI A;  4XRO A;  3H0D A;  1YJW P;  2LF4 A;  3CCE P;  1K73 Q;  3CCL P;  2PEN A;  3DTJ A;  2Z46 A;  3OW2 O;  2OAR A;  4XFZ A;  1AUM A;  1M90 Q;  1QVF O;  1Q7Y Q;  3G29 A;  3I55 P;  1Q86 Q;  1VQ4 P;  2CWO A;  2M8L A;  1RO0 A;  5BS2 A;  4U0E A;  3DPH A;  3DS4 A;  3CCR P;  2Z44 A;  1VQ8 P;  1E6J P;  2XXM A;  2P9X A;  4COC A;  1VQ9 P;  1KD1 Q;  2EIA A;  1VQP P;  1RO2 A;  3WBH A;  1A43 A;  3G6E P;  3CCQ P;  3NTE A;  5F2N A;  4XRQ A;  2QA4 P;  3G1G A;  1KQS O;  3CMA P;  3CD6 P;  3G28 A;  2BQ1 E;  4XFX A;  3CC7 P;  2ONT A;  2EFJ A;  1YJ9 P;  1M6N A;  1YIT P;  2L6E A;  1JJ2 O;  1VQK P;  2Z45 A;  5F2K A;  3G21 A;  5BS1 A;  4PH0 A;  5HGO A;  3CCM P;  5HGN A;  1W2B O;  1IUQ A;  1N8R Q;  3LRY A;  1K30 A;  5I4T G;  3HYB A;  3G1I A;  3MGE A;  2E1M A;  1K8A Q;  3CCJ P;  2XV6 A;  3CCU P;  4IPY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...