1YJ9P

Crystal structure of the mutant 50s ribosomal subunit of haloarcula marismortui containing a three residue deletion in l22
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S Ribosomal RNA
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
molecule tags Ribosome
total genus 43
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2005-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1yj9P03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1yj9P01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1yj9P02
1KD1Q 2OTJP 1VQ7P 3CD6P 1M90Q 1K8AQ 1K73Q 3CC7P 1VQ6P 1NJIQ 1VQMP 1YITP 3CC2P 3CCEP 3CXCO 1Q81Q 1VQKP 3CC4P 3CMEP 1YIJP 1K9MQ 1YJWP 3G6EP 1YHQP 1W2BO 1Q82Q 1VQ5P 1QVGO 1JJ2O 3CCRP 1VQNP 3OW2O 2QA4P 3I56P 1Q7YQ 1M1KQ 1VQPP 1YJ9P 1VQ4P 3CPWO 1VQOP 3CCUP 1KC8Q 1QVFO 2QEXP 3CCSP 1YI2P 3CCMP 3I55P 1Q86Q 3G4SP 3G71P 3CCQP 1N8RQ 1KQSO 3CCLP 1S72P 3CMAP 3CCJP 1VQLP 1YJNP 2OTLP 3CCVP 1VQ8P 1VQ9P
chains in the Genus database with same CATH superfamily
2BUOA 2CNRA 2FYUD 3Q20A 5B66E 5GTHH 3GHGC 4UB8E 1KZUB 1FOSE 2G8YA 1NTMD 2PEJA 1SP4A 2GUVA 2QJYC 3C8VA 2CPBA 1DX7A 3CL3D 1HTLC 1T2KC 1FDMA 3JCUH 1VL2A 2YO3A 4U0FA 1GW3A 3GHGB 2VLQA 2A06E 3HYBA 1SQQE 3L70D 2A06G 1SQQG 1BXIA 3L74E 2N5IA 1PEUA 1KV4A 2JBGA 2ZYGA 2QJKC 1IFMA 4GT1A 3AECC 5KJ7C 1M8OB 2OYIC 3TK1A 2CGQA 3KQGA 3L37A 3G1GA 3RBXA 1RF1C 1EMVA 4W7YA 2GM4A 2EG5A 3GJNA 2Z4EA 3G71P 2QM7A 1UJZA 1OIPA 1GU4A 1CI6A 1NVOA 2QJKB 4ZKUA 2KXPB 3H1JJ 3CC7P 4PV1D 2O1KA 1NAYA 3TNUB 1SQPE 2LXBA 2ZYAA 2OYIB 1SQPG 1QVGO 4BPFA 1L0NJ 1KQLA 2XXMA 3VMYA 3U59A 1Y9BA 4DJGA 2FXOA 1KORA 1SQVJ 2J59M 1M57D 2L22A 3NY7B 2KGAA 1A02J 1MZ8A 2KK7A 1YQ4C 2OTJP 3RBZA 4WY4D 1JY2P 4Y99C 2Z44A 3WU2H 4OGQD 5CMZA 1PP9J 1LT9C 3MTUE 5KAIE 3VTPC 2H8PD 3M0DC 4H2XC 2W83C 4DG9A 2FADA 3B5IA 2K88A 1R8EA 1VDFA 4PD4E 1IFPA 2KOSA 2M3BA 4MN4C 3C1LA 4WBAA 2YKOA 1YJWP 1S5LX 1IC2A 4Y99B 3BRTB 5HGNA 1L0NK 5APXA 1LT9B 3RL0D 4YXDC 2WSSH 3QH9A 1M1JC 1SQVK 2Y9ZA 2VLNA 1LTGC 3EFGA 5APVA 1RE3A 5AW8B 1RE4C 3L71E 3G0VA 1EDJA 3L71G 2B9BA 1BGYE 3CX5H 4TT3H 2NPSC 1BGYG 2E43A 3H1ID 3Q1MA 1RHZB 2GZJA 1M1JB 1LTJA 1G1IA 2LIWA 1NO4A 2E75D 1LWUC 3H1LD 3B4SA 2YKPA 3FXDA 2QA4P 2LR2A 1HUCA 2NPSB 2B87B 3CCLP 1ZLLA 2D2CD 2E1MA 4JBZA 2IYPA 1LWUB 1FZAA 1VKUA 2M8LA 4C46A 2KZJA 3PH0A 5DJUB 2WPRA 2JKVA 1ZN5A 4WYMA 1S5LH 3TDKA 1Q7YQ 2UWJE 3L74D 2K92A 4U0AA 2WTYA 3LRYA 1L0LG 2WPVB 1GL2D 1NTMJ 3BCCJ 3OAKA 1A43A 2AFDA 2K93A 5K5GB 3DS5A 1IK9A 2JJLA 4BRYB 2WZ7A 1DIPA 3TGUG 2ZT9C 4LLHA 2K0DX 4D6TE 4WY4A 4D6TG 2O1JA 3ITKA 1GK6A 1FZFA 3G28A 3MD0A 1GMJA 4HH2A 1H88A 1KILE 2H88C 5AVTB 2HPCB 1AVYA 2KNCB 1QVFO 2P1JA 4BPGA 1BCCG 5KP6B 2QE7H 2ZT9B 4EIJA 4COCA 5GTIE 2OGUA 1YQ3C 2BEQD 1NU1E 1USEA 1AUMA 3P8MC 1E5WA 1NU1G 2VLOA 5F2OA 4N6JA 1VQ7P 4YTPC 1SFCC 4NPEA 5H2FH 3I5CA 4OWFA 1JY3P 1KFNA 1N2DC 2M3EA 5CCHD 1H0TB 3L73J 2X2BA 1USDA 3CLQA 4H13D 2JU2A 1IO4A 2M5RA 3H4EA 3CX5D 3A0BH 2IFMA 3RK2B 2MY5A 1OX3A 4GKGA 1MFZA 1X79B 3O8ZA 5KLVJ 1YHQP 3AE4C 2L4BA 3HE4B 4GOEA 3L75E 3K5BA 3P8CE 1PGPA 1YYCA 4O9BA 3IFMA 1ZR2A 5AW6B 2IBZI 2V7QH 1JCCA 2RKLA 3B5NB 4L75A 1H89A 2QM8A 1KN7A 5AW2B 1S3JA 3PP5A 2J5UA 1K9MQ 3MZWB 4CA3A 4AQRD 2PEKA 4DCKA 2IDBA 4H0LD 1K05A 3CE7A 1L4AC 1JTHB 2OYOA 3GMAA 4U7JA 2QG4A 2QRXA 3RK3C 5JPAA 3CD6P 2MKVA 3GLMA 1NJIQ 2ERHA 3V6IA 1GL2A 1NTZG 3V2RA 1HY8A 3U1CA 5KLVK 2XU6A 1MUUA 2YNYA 1L0ND 3HD7A 4HJGH 3SFDC 2FQ1A 2R3SA 1LTBC 1L4AB 2N9YB 4I7ZC 3H1LJ 1SQVD 1E0HA 1NHLA 3RK3B 1KD1Q 3EFFK 3PTZA 4N78D 1PPJG 5EJDA 3AE7C 5BS2A 2FACA 1KFMA 2W6AA 3MHVA 1FE6A 1PZQA 1PP9D 3VP9A 2N6ZA 2W27A 2XV6A 5CCGD 3D71A 1FDIA 1RO0A 2I8DA 4I7ZB 3DS1A 1N7LA 3VMAA 3MUDC 1VQMP 5F2NA 4OH8B 5KLIC 1LTSC 4IFMA 3EJEA 1LT1A 1SQQJ 5CHXA 2ONTA 3L74J 2R5DA 3G3ZA 3CCSP 2N1TD 1KILD 1AF8A 3H1HG 1ZP0C 1ZMBA 2JAZA 4PJ0E 3HE5A 3MGNA 2N50A 2H7HA 2WVRA 4JF7A 2ZVOB 1RQUA 3H1KE 2KSEA 3H1KG 5CCHA 3E1IA 1IMPA 4XROA 2N9BA 2R3CA 2YIUC 2GZIA 2OTKE 2WMMA 2VLPA 3KZIH 1T3JA 3AE2C 2GZFA 2IFNA 1DH3A 1BSNA 1SQPJ 1RQVA 3B4QA 3A2AA 2L5GB 4GR6A 1BE3E 3HUSA 1SQQK 2PEIA 1CSBA 1EIAA 4WB4A 1KYOI 3ABVC 1FZCA 2GZEA 2YIUB 2Z5IA 1ZXGA 3CWBG 4U3FG 3DS4A 4XE5B 4XA4A 5AVWB 1FZGA 3AE8C 2W8ZA 2L6EA 3HZQA 2RH0A 3TYYA 3B8EB 2H89C 3W67A 3G1IA 3IN6A 2PFXA 3H32B 2IZ0A 1SQBE 1T2KD 1SQBG 2IBZE 2L9FA 3L75D 1YJNP 2ZYDA 2OARA 3M9QA 2L91A 3S1KA 5E79E 1L2PA 2A45H 2O01N 2YXRB 4R4MA 1EZVD 3E1RA 2AXTE 1SQPK 1CI6B 4MRTC 4CPGA 2E76C 1AV1A 3BCCD 2KGEA 1VF5C 4ASVA 2JYLA 3A3YB 1FC2C 2Q3EA 1OVVA 5B66H 2AXTH 4UB8H 3D6ZA 4L73A 1M90Q 3F89A 1AYIA 1KB9E 1U7JA 3L71J 2JB0A 3CI9A 2YXQB 2KS1A 1FZEA 1BGYJ 3E2DA 2E76B 2KIKA 2GDYA 5HGOA 1VF5B 3BATA 4N3YB 2QJYB 1G1JA 3LW5J 1GDTA 1KB9H 1M56D 5KP8B 2M8PA 3FWNA 1OW8A 1HF9A 1RE3C 1W2BO 5APYA 2KGDA 1FOSF 1SVFA 2PEQA 4R4LA 1Z6MA 1LP1B 2N1TA 5F2KA 1UIIA 3HTKB 1HWTC 4KHXA 3IAOA 1VQ8P 1HJ0A 1LTJC 3P7KA 1SQXE 2P10A 3FX0A 1SQXG 1P84I 1PIXA 1IUQA 2LOLA 3SFEC 1RF1B 2PEOA 4PH1A 3VP8A 1OFCX 2E74C 3L73D 3CMAP 3RG2A 3CCJP 2P7JA 3Q5PA 1WRGA 1FBMA 1WT6A 4Y28J 1KTMA 2KG6A 2PY8A 3S4RA 3L36A 4LC1A 1N7SD 3AE1C 1FS0E 3WUTA 2MR7A 1ZRTD 5KLVD 2HG5D 1G2CA 3CXHI 2XV5A 5AW9B 1S9KD 3GHGA 3SWKA 1H8AA 2E74B 1RF0A 1KQGB 2K0YA 5TISE 1MZ9A 2YKQA 4D6TJ 3Q5RA 5KAIH 2NPSD 3DTJA 1ZR4A 3NMDA 4PV1C 3DS0A 1LNQA 2JO0A 3V2NA 5M1BA 1JM0A 1BE3D 1OMIA 1W5CE 4K3AA 1KYOE 3KXDA 2VSQA 4WWIA 4PD4H 1AQTA 3L35A 5AVVB 1NWQA 3N7NA 3G26A 2R44A 1QL1A 1EXIA 1AQ5A 2PAJA 3RK3E 4PWVB 4PV1B 2NRGA 2GDXA 3LMOA 5KP7B 1Y47A 1NU1J 1YI2P 2LKIA 4PH0A 1DEEG 2XT1A 1S72P 1GXHA 2IBZD 3NTNA 4GR2A 1RH5B 2AVAA 1K8AQ 5CBNA 3ZDMA 1GD2E 3V4WA 2MJZA 2EHTA 1HQBA 3P32A 1KC8Q 3LW5H 1DNYA 3BRVB 2FVFA 1HBWA 1YBKA 2WSEJ 1XTGB 3B71A 1VQ9P 2YMYA 2V7QJ 3JSVC 1S4XA 1KB9D 3AE9C 2XZ1C 3M9HA 4I1LA 5TJHA 3O6QB 3CPWO 2A06D 1SQQD 1LTTC 1Q86Q 3L75J 1NU1K 2BQ1E 2HFED 2ZT9D 4RKUJ 1T3UA 2RN0A 2K1AA 2M5AA 2PP6A 1L0LE 2CPSA 3H1JG 4W80A 2H43A 1NAFA 2E75C 2ZXXA 1Y8AA 1PEOA 1M6NA 1L0IA 1QRJA 3AEGC 3EJBA 2C9LY 2XKMA 2JP3A 4B86A 3TGUE 2D2CC 4ZKPA 1YTZT 4XRQA 2E75B 1N7SA 3OA7A 1SQPD 2ZVNB 2I1JA 1URQD 1T6AA 3LIDA 1PGOA 2JEEA 3RK2D 2Z45A 2ZFCA 3VRLC 2KW2A 1BCCE 2LMLA 2FQ2A 2MR8A 5AW3B 1A02F 4AYCA 3M06A 1EXJA 5KAFE 3Q5SA 2NPSA 1W2EA 2FXMA 3B5ND 4AUWA 1GL2C 1YTZI 1LWUA 3CXHE 1MFTA 3CCQP 4IL6X 1NOHA 3HD7C 2EIAA 4LGDE 3VMZA 4DOJA 5DJTB 5BS1A 4DZOA 3CXCO 4PD4D 3EWKA 5AVRB 5GTIH 4JPZB 1Q90D 1JY2N 4H2YC 2FYNC 2Z46A 3G9RA 5C39A 1OW7A 1R5LA 5EFWB 1KYOD 3H1HJ 2VRSA 3H6PA 3GF7A 3HD7B 1GK4A 2KWLA 2FY8A 1SFCB 2B88A 3H47A 3H1KJ 1VQNP 1L4AD 1ZMEC 3L71D 2WSEH 3RK3D 1VQPP 2KOPA 5AVUB 2OYHA 1BGYD 2Y0EA 2FYNB 1ACPA 2LIUA 2FFDA 2KOGA 4IL6E 4C7NB 3NTEA 2ROQA 3EJDA 2LF4A 2DW3A 1AA0A 1BE3J 2Y0CA 3EQ2A 4QKOA 5CCHC 3AEEC 4IL6H 3CWBJ 2FYUG 3SWYA 2WPQA 4U3FJ 3G29A 3AEDC 4IFFA 4NPDA 5APQA 1YITP 1NTZE 1RY3A 1NTMG 2Q1KA 4I2LC 1N73A 2WITA 1IZNB 2PGDA 2PNGA 2AEJA 5AW7B 2XZ0D 1SQBJ 4ASWA 2E42A 3HUSC 4EYYQ 2AFEA 2KODA 3SSUA 1LGHB 1H0TA 1PPJE 1FZCC 4IOIH 2KP8A 3L70E 1L0LD 3L70G 4XFYA 1JJ2O 1URQA 2J58A 1HJBA 3MP7B 1CW5A 1FZBA 2GYKA 3G21A 4RESB 5CJ0A 3USSA 2PENA 1N8RQ 1HH0A 1ZV8A 3HUSB 1F80D 3HE4A 5AVYB 1NKNA 1FJKA 1K73Q 1RNIA 3LIEA 3TGUD 2QJPC 1FZCB 3FGAD 3P05A 2K9JA 3B5NA 4D6TD 2QVAA 4IZ6A 2HYNA 4M0IA 1SQBK 4U0CA 3H1HE 4UB6E 1BCCD 2DGYA 1NYHA 1VHNA 3KPEA 2KR5A 4TLFA 2BCCE 1JTHA 4M3LA 2QJPB 1GZLA 2BCCG 3VMXA 1QEXA 5KLIB 3T97A 3I56P 3QWOC 2O3JA 2HODA 4RJTA 2FAEA 5CJ4A 1CZQA 2R5BA 4QMAA 1K30A 4PJ0H 3CXHD 1VQLP 1NU1D 2P58A 4IFDK 1BDDA 1R5SA 3CCEP 1SQXJ 2K94A 2KG8A 2LKMA 3KHUA 3MIWA 2K9YA 2AXCA 2G3AA 1Z56A 2KZIA 4U0DA 2LTEA 3UIAA 1DV5A 2OTLP 2N6YA 4HYTB 2KS1B 2N1TC 3CWBE 4U3FE 2ZAEB 2E76D 2YO2A 4EDFA 1VF5D 3II6A 4NPFX 1SS1A 1ZW0A 1J1DC 3TSIA 1IFDA 4BXLA 2K5XA 5BU8B 1FU1A 3V2QA 1M6EX 1JY3N 3CCUP 1JO5A 3D70A 1OXZA 2Q9IA 2MVUA 2GZGA 3CX5I 5L8RJ 2K0XA 3D6YA 1NQ4A 1J2JB 3P8CD 3U43A 2N1TB 3FXEA 2IYOA 3CC2P 1X3OA 1SQXK 2L0QA 1J1DB 3H1IG 5KJ7D 5E79H 1NH4A 4H44C 3H1LG 1NTKE 2IX7C 2LPKA 5B5EE 1NTKG 1IFIA 2WT7A 1RF0C 4R0MA 3JCUE 1NTZD 2PEMA 1EC5A 3H0DA 1VQ4P 1YJ9P 1GXGA 5B5EH 3AE6C 2Q7CA 5AVZB 5CCGA 2AEFA 4H44B 1G2CB 1PPJD 4KJMA 2BEZF 2E74D 3WUUA 1OVRA 1MV8A 3M0AA 4Z1MH 3L74G 1MKMA 1IK7A 1KILA 5AVXB 1KQSO 3CCVP 3CC4P 3C9IA 3N4XA 5APWA 3H25A 3FWLA 3H32A 4GOFA 1X0TA 3PJSK 1BAJA 2K37A 4L74A 5AVSB 1ZNVA 2EFJA 2CG5B 4U0BA 1LTIC 3Q2YA 2C0WA 1X9VA 1IFJA 5AW4B 3H1HD 1L0LJ 1IJDB 2XNXA 4YPCA 5AVQB 3L72E 1LTJB 1VQ5P 3L72G 2BCCD 1X22A 2N5HA 2AEMA 3H1KD 3WU2E 1PGQA 1QGKB 3GW6A 2FVAA 2YMKA 2N98A 1NKZB 2Y9YA 3TGUJ 2DNWA 1DD3A 2W90A 3GZMA 3IR9A 1FJPA 2R32A 1U57A 4OVNF 1CEIA 3BVHA 2FVEA 3VOPA 1BCCJ 5TISH 3GF3A 1A8OA 2CQ8A 2XDJA 1NGMB 2HLOA 3CWBD 2CWOA 1LP1A 2JQ4A 1L0LK 4U3FD 2Q6QA 2RMZA 3HTKA 2HR3A 2M5AB 1KYOH 3R2PA 2JO1A 4WY4C 1N7SC 5HVCA 1FDOA 4OGQC 1JNMA 4U0EA 5AW0B 3CX5E 3TNUA 5KJ7A 2IPPA 2I1KA 1SQBD 2OYIA 1J1EC 3V5BA 1D1DA 1RF1A 1Q2NA 1LJ2A 1HVVA 5APTA 2C9NY 3WBHA 5AW1B 4WY4B 3W68A 1N7SB 2M8RA 4OGQB 3RL0C 3AEAC 1J1EB 1EZVI 2JYGA 3A0HE 1NTKD 3DS2A 2Y0DA 1GW4A 3M91A 1EDKA 5EW5E 3PRJA 3AEFC 1X8YA 5BU5A 3TF5A 5HV8A 1S5LE 2Z5HA 3A0HH 3NXSA 1JMBA 5KKZC 3RL0B 3H1JE 4QNBA 1LT9A 2WSFJ 1E6JP 3F5HA 2O01J 1N86A 1L0NE 3M0DA 1KQFB 1L0NG 1M74A 2FYZA 1OZHA 2W6BA 1IFNA 3CCMP 3IF4A 1SQVE 4A7PA 1OR5A 2FYUJ 1JB0J 1SQVG 4N78E 4I6MC 1JMMA 7CEIA 1QL2A 2OYHC 5KKZB 1WMKA 1D7MA 3A7OA 1TU3F 1NTZJ 3CMEP 2FFDC 2M8NA 1P84E 1GTWA 1M1JA 1SLQA 1PP9E 3OW2O 1SQXD 3V2PA 1OW6A 1PP9G 2WSCJ 2KG9A 4HKGA 1GPJA 2KUBA 2W6JH 3HD7D 1OWAA 1HGVA 1BDCA 2KYVA 3G4SP 3RL0g 1SFCD 5CZDB 1RE4A 1P84H 1PV3A 2ITAA 4JQ0D 1T8KA 2OYHB 1S1CX 2M0BA 1VQKP 1JCDA 3L70J 2D2CB 2B87A 2ZXEB 2KOQA 3L72D 2FFDB 2E5TA 2FBWC 1JY2O 4IPYA 1HGZA 5DCKA 3A5TA 1N73C 2QNWA 4K35A 2FXPA 4YXWH 4EI2A 2JWDA 2FYUK 1DD4A 4ZMDA 5KAFH 3O6QA 1PEQA 4BWNA 1NTZK 1PL5A 1NTMK 1DEBA 3CXHH 5H2FE 1VPCA 1QX8A 1GU5A 2MD9A 1GL2B 3PLNA 1JEKA 1URQC 4BPHA 1N73B 2BHVA 3RK2C 2JDIH 1LTAC 4JYBA 2EHSA 2XZRA 2SPZA 2BCCJ 2WPSA 3A0BE 1YIJP 4BRYA 3WUVA 3R4YA 1EDLA 2E5YA 1XTCC 2C0XA 3OJAB 3B5NC 1URQB 1JOCA 2KI7B 3M9BA 4UHPB 2KORA 2HPCA 4W7ZA 2Q5UA 2KNCA 4L76A 2POHA 1EQ7A 2A45I 2B89A 2P2UA 2IZ1A 1IMQA 1K04A 3L75G 4C7RA 2K3RA 1PFIA 4WVZA 2K9JB 2FYUE 1PEMA 1S2EA 2WSFH 1EZVE 2WQYC 4HB1A 2O01H 1EZVG 3GZLA 4H13C 1NTME 3BCCE 3BCCG 2KB7P 3HE5B 1QLED 4HKZH 1T8ZA 5APUA 2OQQA 3T97B 4XFJA 2HODB 3GG2A 1UIXA 3PHLA 5AW5B 1KB9I 3H1JD 1KMIZ 2WSCH 4H13B 1Q82Q 4XFZA 3H1IJ 5CBOA 2KSJA 2JU1A 3KYQA 2P67A 1ZOYC 1SFCA 2QIWA 4H0LC 1AJYA 2WPTA 1NTKJ 3HRNA 3AEBC 4PXHB 4DT0A 1VQ6P 5HGMA 1KLPA 5KTBA 2NO8A 2KOOA 4KT0J 1P84D 1E79H 3DS3A 4GODA 1UNKA 1AVOA 4ZNCA 3U1AA 1EDIA 3WMM0 2P9XA 4C7NA 1L0HA 2AF8A 4H0LB 2CK3H 4RO0A 1M7LA 1FAVA 3E7KA 2JGPA 1EOQA 2Q3IA 3VN0A 3L73E 4GDOA 2KLUA 2LL8A 1JUNA 3L73G 4UB6H 5APSA 1RO2A 3NFQA 2PRRA 5HGLA 2WWWA 1NTKK 2FKWB 5BVZA 3KZIE 1FR2A 5CCGC 3BASA 3L4FA 1ZRTE 5KLVE 5I4TG 2MVVA 5KLVG 1L4AA 2GDWA 1S9KE 4F37A 2WT7B 2QEXP 2ZJSE 1JY3O 2FHSC 3S9OA 1AFOA 2GA1A 2KLVA 4EOTA 1KILC 4XFXA 2KGCA 4PD4I 3SWFA 1Q81Q 2BASA 3L72J 3Q3DA 1OVUA 3G6EP 1U7MA 2FQ0A 3M1MA 4NEOA 1BE3G 2JWAA 4GIFA 3AE5C 3VYIA 4H44D 3I55P 3RGUA 3JC22 4JYCA 3KDPB 2MF4A 4COPA 1KILB 4H2WC 3RG6C 2JR8A 3GKLC 3AE3C 5GTHE 2GUSA 3CCRP 3MGEA 2A45G 3H1IE 2QSIA 3DPHA 2K2QA 1M1KQ 1VQOP 1BSHA 2V4HA 2XNDH 3V4QA 2LXCB 2IBZG 2NZ2A 3MUDA 1PGJA 3H1LE
chains in the Genus database with same CATH topology
3G29A 2BUOA 4GR2A 1KD1Q 2OTJP 2E1MA 3Q20A 1VQ7P 1K8AQ 3DS4A 2CWOA 1YITP 5BS2A 3CCEP 2M8LA 3CMEP 2L6EA 2M8NA 2Z44A 3HZQA 3OW2O 4WYMA 1IUQA 2PEJA 1EOQA 1Q7YQ 3G1IA 1KC8Q 2PEOA 4PH1A 4U0DA 4U0EA 3G4SP 3CCQP 1RO2A 1KQSO 2KODA 3CMAP 3CCJP 2OTLP 1YJNP 3B5IA 2XV6A 1PEMA 4U0AA 2OARA 2EIAA 5HGLA 3CCVP 1VQ9P 3CC4P 1RO0A 1D1DA 3H4EA 3DS1A 3LRYA 5BS1A 1VQMP 5F2NA 3CXCO 4U0FA 1VQKP 2PY8A 1YJWP 1YHQP 1A43A 5I4TG 4XFYA 1JJ2O 3HYBA 3WBHA 1BAJA 5HGNA 2EFJA 2ONTA 4IPYA 1M6EX 2JYLA 4U0BA 5DCKA 3CPWO 3CCUP 1PEUA 2QEXP 3G21A 3CCSP 1Q86Q 2Z46A 3DS5A 2BQ1E 2PENA 1N8RQ 1ZMBA 1M90Q 4XFXA 2JYGA 1K73Q 1RNIA 3DS2A 3CC2P 1PEQA 1PEOA 1Q81Q 1K9MQ 3DTJA 3P05A 3G6EP 3G0VA 3G28A 3G1GA 4XFZA 1VQ5P 3H47A 1M6NA 1Q82Q 3DS0A 1VQNP 3M1MA 2JO0A 2PEKA 3E2DA 1QRJA 1VQPP 4M0IA 5HGOA 2EG5A 4XROA 1QVFO 3I55P 3G71P 4U0CA 2BHVA 2DGYA 5JPAA 3CD6P 4QNBA 3CC7P 3G26A 1VQ6P 4COPA 1NJIQ 2M8PA 5HGMA 1E6JP 3RG6C 1YIJP 4XRQA 1W2BO 1QVGO 3NTEA 3CCRP 2LF4A 3MGEA 2XXMA 2PEMA 4GR6A 2QA4P 3I56P 3H0DA 3DS3A 1M74A 2PEIA 2PEQA 3DPHA 4COCA 1M1KQ 1VQ4P 1YJ9P 1VQOP 1EIAA 2Z45A 1YI2P 3CCMP 4PH0A 1AUMA 3VRLC 1K30A 2P9XA 3CCLP 2XT1A 5F2KA 1S72P 5F2OA 1VQLP 1A8OA 1VQ8P
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KD1 Q;  2OTJ P;  1VQ7 P;  3CD6 P;  1M90 Q;  1K8A Q;  1K73 Q;  3CC7 P;  1VQ6 P;  1NJI Q;  1VQM P;  1YIT P;  3CC2 P;  3CCE P;  3CXC O;  1Q81 Q;  1VQK P;  3CC4 P;  3CME P;  1YIJ P;  1K9M Q;  1YJW P;  3G6E P;  1YHQ P;  1W2B O;  1Q82 Q;  1VQ5 P;  1QVG O;  1JJ2 O;  3CCR P;  1VQN P;  3OW2 O;  2QA4 P;  3I56 P;  1Q7Y Q;  1M1K Q;  1VQP P;  1YJ9 P;  1VQ4 P;  3CPW O;  1VQO P;  3CCU P;  1KC8 Q;  1QVF O;  2QEX P;  3CCS P;  1YI2 P;  3CCM P;  3I55 P;  1Q86 Q;  3G4S P;  3G71 P;  3CCQ P;  1N8R Q;  1KQS O;  3CCL P;  1S72 P;  3CMA P;  3CCJ P;  1VQL P;  1YJN P;  2OTL P;  3CCV P;  1VQ8 P;  1VQ9 P; 
#chains in the Genus database with same CATH topology
 2BUO A;  2CNR A;  2FYU D;  3Q20 A;  5B66 E;  5GTH H;  3GHG C;  4UB8 E;  1KZU B;  1FOS E;  2G8Y A;  1NTM D;  2PEJ A;  1SP4 A;  2GUV A;  2QJY C;  3C8V A;  2CPB A;  1DX7 A;  3CL3 D;  1HTL C;  1T2K C;  1FDM A;  3JCU H;  1VL2 A;  2YO3 A;  4U0F A;  1GW3 A;  3GHG B;  2VLQ A;  2A06 E;  3HYB A;  1SQQ E;  3L70 D;  2A06 G;  1SQQ G;  1BXI A;  3L74 E;  2N5I A;  1PEU A;  1KV4 A;  2JBG A;  2ZYG A;  2QJK C;  1IFM A;  4GT1 A;  3AEC C;  5KJ7 C;  1M8O B;  2OYI C;  3TK1 A;  2CGQ A;  3KQG A;  3L37 A;  3G1G A;  3RBX A;  1RF1 C;  1EMV A;  4W7Y A;  2GM4 A;  2EG5 A;  3GJN A;  2Z4E A;  3G71 P;  2QM7 A;  1UJZ A;  1OIP A;  1GU4 A;  1CI6 A;  1NVO A;  2QJK B;  4ZKU A;  2KXP B;  3H1J J;  3CC7 P;  4PV1 D;  2O1K A;  1NAY A;  3TNU B;  1SQP E;  2LXB A;  2ZYA A;  2OYI B;  1SQP G;  1QVG O;  4BPF A;  1L0N J;  1KQL A;  2XXM A;  3VMY A;  3U59 A;  1Y9B A;  4DJG A;  2FXO A;  1KOR A;  1SQV J;  2J59 M;  1M57 D;  2L22 A;  3NY7 B;  2KGA A;  1A02 J;  1MZ8 A;  2KK7 A;  1YQ4 C;  2OTJ P;  3RBZ A;  4WY4 D;  1JY2 P;  4Y99 C;  2Z44 A;  3WU2 H;  4OGQ D;  5CMZ A;  1PP9 J;  1LT9 C;  3MTU E;  5KAI E;  3VTP C;  2H8P D;  3M0D C;  4H2X C;  2W83 C;  4DG9 A;  2FAD A;  3B5I A;  2K88 A;  1R8E A;  1VDF A;  4PD4 E;  1IFP A;  2KOS A;  2M3B A;  4MN4 C;  3C1L A;  4WBA A;  2YKO A;  1YJW P;  1S5L X;  1IC2 A;  4Y99 B;  3BRT B;  5HGN A;  1L0N K;  5APX A;  1LT9 B;  3RL0 D;  4YXD C;  2WSS H;  3QH9 A;  1M1J C;  1SQV K;  2Y9Z A;  2VLN A;  1LTG C;  3EFG A;  5APV A;  1RE3 A;  5AW8 B;  1RE4 C;  3L71 E;  3G0V A;  1EDJ A;  3L71 G;  2B9B A;  1BGY E;  3CX5 H;  4TT3 H;  2NPS C;  1BGY G;  2E43 A;  3H1I D;  3Q1M A;  1RHZ B;  2GZJ A;  1M1J B;  1LTJ A;  1G1I A;  2LIW A;  1NO4 A;  2E75 D;  1LWU C;  3H1L D;  3B4S A;  2YKP A;  3FXD A;  2QA4 P;  2LR2 A;  1HUC A;  2NPS B;  2B87 B;  3CCL P;  1ZLL A;  2D2C D;  2E1M A;  4JBZ A;  2IYP A;  1LWU B;  1FZA A;  1VKU A;  2M8L A;  4C46 A;  2KZJ A;  3PH0 A;  5DJU B;  2WPR A;  2JKV A;  1ZN5 A;  4WYM A;  1S5L H;  3TDK A;  1Q7Y Q;  2UWJ E;  3L74 D;  2K92 A;  4U0A A;  2WTY A;  3LRY A;  1L0L G;  2WPV B;  1GL2 D;  1NTM J;  3BCC J;  3OAK A;  1A43 A;  2AFD A;  2K93 A;  5K5G B;  3DS5 A;  1IK9 A;  2JJL A;  4BRY B;  2WZ7 A;  1DIP A;  3TGU G;  2ZT9 C;  4LLH A;  2K0D X;  4D6T E;  4WY4 A;  4D6T G;  2O1J A;  3ITK A;  1GK6 A;  1FZF A;  3G28 A;  3MD0 A;  1GMJ A;  4HH2 A;  1H88 A;  1KIL E;  2H88 C;  5AVT B;  2HPC B;  1AVY A;  2KNC B;  1QVF O;  2P1J A;  4BPG A;  1BCC G;  5KP6 B;  2QE7 H;  2ZT9 B;  4EIJ A;  4COC A;  5GTI E;  2OGU A;  1YQ3 C;  2BEQ D;  1NU1 E;  1USE A;  1AUM A;  3P8M C;  1E5W A;  1NU1 G;  2VLO A;  5F2O A;  4N6J A;  1VQ7 P;  4YTP C;  1SFC C;  4NPE A;  5H2F H;  3I5C A;  4OWF A;  1JY3 P;  1KFN A;  1N2D C;  2M3E A;  5CCH D;  1H0T B;  3L73 J;  2X2B A;  1USD A;  3CLQ A;  4H13 D;  2JU2 A;  1IO4 A;  2M5R A;  3H4E A;  3CX5 D;  3A0B H;  2IFM A;  3RK2 B;  2MY5 A;  1OX3 A;  4GKG A;  1MFZ A;  1X79 B;  3O8Z A;  5KLV J;  1YHQ P;  3AE4 C;  2L4B A;  3HE4 B;  4GOE A;  3L75 E;  3K5B A;  3P8C E;  1PGP A;  1YYC A;  4O9B A;  3IFM A;  1ZR2 A;  5AW6 B;  2IBZ I;  2V7Q H;  1JCC A;  2RKL A;  3B5N B;  4L75 A;  1H89 A;  2QM8 A;  1KN7 A;  5AW2 B;  1S3J A;  3PP5 A;  2J5U A;  1K9M Q;  3MZW B;  4CA3 A;  4AQR D;  2PEK A;  4DCK A;  2IDB A;  4H0L D;  1K05 A;  3CE7 A;  1L4A C;  1JTH B;  2OYO A;  3GMA A;  4U7J A;  2QG4 A;  2QRX A;  3RK3 C;  5JPA A;  3CD6 P;  2MKV A;  3GLM A;  1NJI Q;  2ERH A;  3V6I A;  1GL2 A;  1NTZ G;  3V2R A;  1HY8 A;  3U1C A;  5KLV K;  2XU6 A;  1MUU A;  2YNY A;  1L0N D;  3HD7 A;  4HJG H;  3SFD C;  2FQ1 A;  2R3S A;  1LTB C;  1L4A B;  2N9Y B;  4I7Z C;  3H1L J;  1SQV D;  1E0H A;  1NHL A;  3RK3 B;  1KD1 Q;  3EFF K;  3PTZ A;  4N78 D;  1PPJ G;  5EJD A;  3AE7 C;  5BS2 A;  2FAC A;  1KFM A;  2W6A A;  3MHV A;  1FE6 A;  1PZQ A;  1PP9 D;  3VP9 A;  2N6Z A;  2W27 A;  2XV6 A;  5CCG D;  3D71 A;  1FDI A;  1RO0 A;  2I8D A;  4I7Z B;  3DS1 A;  1N7L A;  3VMA A;  3MUD C;  1VQM P;  5F2N A;  4OH8 B;  5KLI C;  1LTS C;  4IFM A;  3EJE A;  1LT1 A;  1SQQ J;  5CHX A;  2ONT A;  3L74 J;  2R5D A;  3G3Z A;  3CCS P;  2N1T D;  1KIL D;  1AF8 A;  3H1H G;  1ZP0 C;  1ZMB A;  2JAZ A;  4PJ0 E;  3HE5 A;  3MGN A;  2N50 A;  2H7H A;  2WVR A;  4JF7 A;  2ZVO B;  1RQU A;  3H1K E;  2KSE A;  3H1K G;  5CCH A;  3E1I A;  1IMP A;  4XRO A;  2N9B A;  2R3C A;  2YIU C;  2GZI A;  2OTK E;  2WMM A;  2VLP A;  3KZI H;  1T3J A;  3AE2 C;  2GZF A;  2IFN A;  1DH3 A;  1BSN A;  1SQP J;  1RQV A;  3B4Q A;  3A2A A;  2L5G B;  4GR6 A;  1BE3 E;  3HUS A;  1SQQ K;  2PEI A;  1CSB A;  1EIA A;  4WB4 A;  1KYO I;  3ABV C;  1FZC A;  2GZE A;  2YIU B;  2Z5I A;  1ZXG A;  3CWB G;  4U3F G;  3DS4 A;  4XE5 B;  4XA4 A;  5AVW B;  1FZG A;  3AE8 C;  2W8Z A;  2L6E A;  3HZQ A;  2RH0 A;  3TYY A;  3B8E B;  2H89 C;  3W67 A;  3G1I A;  3IN6 A;  2PFX A;  3H32 B;  2IZ0 A;  1SQB E;  1T2K D;  1SQB G;  2IBZ E;  2L9F A;  3L75 D;  1YJN P;  2ZYD A;  2OAR A;  3M9Q A;  2L91 A;  3S1K A;  5E79 E;  1L2P A;  2A45 H;  2O01 N;  2YXR B;  4R4M A;  1EZV D;  3E1R A;  2AXT E;  1SQP K;  1CI6 B;  4MRT C;  4CPG A;  2E76 C;  1AV1 A;  3BCC D;  2KGE A;  1VF5 C;  4ASV A;  2JYL A;  3A3Y B;  1FC2 C;  2Q3E A;  1OVV A;  5B66 H;  2AXT H;  4UB8 H;  3D6Z A;  4L73 A;  1M90 Q;  3F89 A;  1AYI A;  1KB9 E;  1U7J A;  3L71 J;  2JB0 A;  3CI9 A;  2YXQ B;  2KS1 A;  1FZE A;  1BGY J;  3E2D A;  2E76 B;  2KIK A;  2GDY A;  5HGO A;  1VF5 B;  3BAT A;  4N3Y B;  2QJY B;  1G1J A;  3LW5 J;  1GDT A;  1KB9 H;  1M56 D;  5KP8 B;  2M8P A;  3FWN A;  1OW8 A;  1HF9 A;  1RE3 C;  1W2B O;  5APY A;  2KGD A;  1FOS F;  1SVF A;  2PEQ A;  4R4L A;  1Z6M A;  1LP1 B;  2N1T A;  5F2K A;  1UII A;  3HTK B;  1HWT C;  4KHX A;  3IAO A;  1VQ8 P;  1HJ0 A;  1LTJ C;  3P7K A;  1SQX E;  2P10 A;  3FX0 A;  1SQX G;  1P84 I;  1PIX A;  1IUQ A;  2LOL A;  3SFE C;  1RF1 B;  2PEO A;  4PH1 A;  3VP8 A;  1OFC X;  2E74 C;  3L73 D;  3CMA P;  3RG2 A;  3CCJ P;  2P7J A;  3Q5P A;  1WRG A;  1FBM A;  1WT6 A;  4Y28 J;  1KTM A;  2KG6 A;  2PY8 A;  3S4R A;  3L36 A;  4LC1 A;  1N7S D;  3AE1 C;  1FS0 E;  3WUT A;  2MR7 A;  1ZRT D;  5KLV D;  2HG5 D;  1G2C A;  3CXH I;  2XV5 A;  5AW9 B;  1S9K D;  3GHG A;  3SWK A;  1H8A A;  2E74 B;  1RF0 A;  1KQG B;  2K0Y A;  5TIS E;  1MZ9 A;  2YKQ A;  4D6T J;  3Q5R A;  5KAI H;  2NPS D;  3DTJ A;  1ZR4 A;  3NMD A;  4PV1 C;  3DS0 A;  1LNQ A;  2JO0 A;  3V2N A;  5M1B A;  1JM0 A;  1BE3 D;  1OMI A;  1W5C E;  4K3A A;  1KYO E;  3KXD A;  2VSQ A;  4WWI A;  4PD4 H;  1AQT A;  3L35 A;  5AVV B;  1NWQ A;  3N7N A;  3G26 A;  2R44 A;  1QL1 A;  1EXI A;  1AQ5 A;  2PAJ A;  3RK3 E;  4PWV B;  4PV1 B;  2NRG A;  2GDX A;  3LMO A;  5KP7 B;  1Y47 A;  1NU1 J;  1YI2 P;  2LKI A;  4PH0 A;  1DEE G;  2XT1 A;  1S72 P;  1GXH A;  2IBZ D;  3NTN A;  4GR2 A;  1RH5 B;  2AVA A;  1K8A Q;  5CBN A;  3ZDM A;  1GD2 E;  3V4W A;  2MJZ A;  2EHT A;  1HQB A;  3P32 A;  1KC8 Q;  3LW5 H;  1DNY A;  3BRV B;  2FVF A;  1HBW A;  1YBK A;  2WSE J;  1XTG B;  3B71 A;  1VQ9 P;  2YMY A;  2V7Q J;  3JSV C;  1S4X A;  1KB9 D;  3AE9 C;  2XZ1 C;  3M9H A;  4I1L A;  5TJH A;  3O6Q B;  3CPW O;  2A06 D;  1SQQ D;  1LTT C;  1Q86 Q;  3L75 J;  1NU1 K;  2BQ1 E;  2HFE D;  2ZT9 D;  4RKU J;  1T3U A;  2RN0 A;  2K1A A;  2M5A A;  2PP6 A;  1L0L E;  2CPS A;  3H1J G;  4W80 A;  2H43 A;  1NAF A;  2E75 C;  2ZXX A;  1Y8A A;  1PEO A;  1M6N A;  1L0I A;  1QRJ A;  3AEG C;  3EJB A;  2C9L Y;  2XKM A;  2JP3 A;  4B86 A;  3TGU E;  2D2C C;  4ZKP A;  1YTZ T;  4XRQ A;  2E75 B;  1N7S A;  3OA7 A;  1SQP D;  2ZVN B;  2I1J A;  1URQ D;  1T6A A;  3LID A;  1PGO A;  2JEE A;  3RK2 D;  2Z45 A;  2ZFC A;  3VRL C;  2KW2 A;  1BCC E;  2LML A;  2FQ2 A;  2MR8 A;  5AW3 B;  1A02 F;  4AYC A;  3M06 A;  1EXJ A;  5KAF E;  3Q5S A;  2NPS A;  1W2E A;  2FXM A;  3B5N D;  4AUW A;  1GL2 C;  1YTZ I;  1LWU A;  3CXH E;  1MFT A;  3CCQ P;  4IL6 X;  1NOH A;  3HD7 C;  2EIA A;  4LGD E;  3VMZ A;  4DOJ A;  5DJT B;  5BS1 A;  4DZO A;  3CXC O;  4PD4 D;  3EWK A;  5AVR B;  5GTI H;  4JPZ B;  1Q90 D;  1JY2 N;  4H2Y C;  2FYN C;  2Z46 A;  3G9R A;  5C39 A;  1OW7 A;  1R5L A;  5EFW B;  1KYO D;  3H1H J;  2VRS A;  3H6P A;  3GF7 A;  3HD7 B;  1GK4 A;  2KWL A;  2FY8 A;  1SFC B;  2B88 A;  3H47 A;  3H1K J;  1VQN P;  1L4A D;  1ZME C;  3L71 D;  2WSE H;  3RK3 D;  1VQP P;  2KOP A;  5AVU B;  2OYH A;  1BGY D;  2Y0E A;  2FYN B;  1ACP A;  2LIU A;  2FFD A;  2KOG A;  4IL6 E;  4C7N B;  3NTE A;  2ROQ A;  3EJD A;  2LF4 A;  2DW3 A;  1AA0 A;  1BE3 J;  2Y0C A;  3EQ2 A;  4QKO A;  5CCH C;  3AEE C;  4IL6 H;  3CWB J;  2FYU G;  3SWY A;  2WPQ A;  4U3F J;  3G29 A;  3AED C;  4IFF A;  4NPD A;  5APQ A;  1YIT P;  1NTZ E;  1RY3 A;  1NTM G;  2Q1K A;  4I2L C;  1N73 A;  2WIT A;  1IZN B;  2PGD A;  2PNG A;  2AEJ A;  5AW7 B;  2XZ0 D;  1SQB J;  4ASW A;  2E42 A;  3HUS C;  4EYY Q;  2AFE A;  2KOD A;  3SSU A;  1LGH B;  1H0T A;  1PPJ E;  1FZC C;  4IOI H;  2KP8 A;  3L70 E;  1L0L D;  3L70 G;  4XFY A;  1JJ2 O;  1URQ A;  2J58 A;  1HJB A;  3MP7 B;  1CW5 A;  1FZB A;  2GYK A;  3G21 A;  4RES B;  5CJ0 A;  3USS A;  2PEN A;  1N8R Q;  1HH0 A;  1ZV8 A;  3HUS B;  1F80 D;  3HE4 A;  5AVY B;  1NKN A;  1FJK A;  1K73 Q;  1RNI A;  3LIE A;  3TGU D;  2QJP C;  1FZC B;  3FGA D;  3P05 A;  2K9J A;  3B5N A;  4D6T D;  2QVA A;  4IZ6 A;  2HYN A;  4M0I A;  1SQB K;  4U0C A;  3H1H E;  4UB6 E;  1BCC D;  2DGY A;  1NYH A;  1VHN A;  3KPE A;  2KR5 A;  4TLF A;  2BCC E;  1JTH A;  4M3L A;  2QJP B;  1GZL A;  2BCC G;  3VMX A;  1QEX A;  5KLI B;  3T97 A;  3I56 P;  3QWO C;  2O3J A;  2HOD A;  4RJT A;  2FAE A;  5CJ4 A;  1CZQ A;  2R5B A;  4QMA A;  1K30 A;  4PJ0 H;  3CXH D;  1VQL P;  1NU1 D;  2P58 A;  4IFD K;  1BDD A;  1R5S A;  3CCE P;  1SQX J;  2K94 A;  2KG8 A;  2LKM A;  3KHU A;  3MIW A;  2K9Y A;  2AXC A;  2G3A A;  1Z56 A;  2KZI A;  4U0D A;  2LTE A;  3UIA A;  1DV5 A;  2OTL P;  2N6Y A;  4HYT B;  2KS1 B;  2N1T C;  3CWB E;  4U3F E;  2ZAE B;  2E76 D;  2YO2 A;  4EDF A;  1VF5 D;  3II6 A;  4NPF X;  1SS1 A;  1ZW0 A;  1J1D C;  3TSI A;  1IFD A;  4BXL A;  2K5X A;  5BU8 B;  1FU1 A;  3V2Q A;  1M6E X;  1JY3 N;  3CCU P;  1JO5 A;  3D70 A;  1OXZ A;  2Q9I A;  2MVU A;  2GZG A;  3CX5 I;  5L8R J;  2K0X A;  3D6Y A;  1NQ4 A;  1J2J B;  3P8C D;  3U43 A;  2N1T B;  3FXE A;  2IYO A;  3CC2 P;  1X3O A;  1SQX K;  2L0Q A;  1J1D B;  3H1I G;  5KJ7 D;  5E79 H;  1NH4 A;  4H44 C;  3H1L G;  1NTK E;  2IX7 C;  2LPK A;  5B5E E;  1NTK G;  1IFI A;  2WT7 A;  1RF0 C;  4R0M A;  3JCU E;  1NTZ D;  2PEM A;  1EC5 A;  3H0D A;  1VQ4 P;  1YJ9 P;  1GXG A;  5B5E H;  3AE6 C;  2Q7C A;  5AVZ B;  5CCG A;  2AEF A;  4H44 B;  1G2C B;  1PPJ D;  4KJM A;  2BEZ F;  2E74 D;  3WUU A;  1OVR A;  1MV8 A;  3M0A A;  4Z1M H;  3L74 G;  1MKM A;  1IK7 A;  1KIL A;  5AVX B;  1KQS O;  3CCV P;  3CC4 P;  3C9I A;  3N4X A;  5APW A;  3H25 A;  3FWL A;  3H32 A;  4GOF A;  1X0T A;  3PJS K;  1BAJ A;  2K37 A;  4L74 A;  5AVS B;  1ZNV A;  2EFJ A;  2CG5 B;  4U0B A;  1LTI C;  3Q2Y A;  2C0W A;  1X9V A;  1IFJ A;  5AW4 B;  3H1H D;  1L0L J;  1IJD B;  2XNX A;  4YPC A;  5AVQ B;  3L72 E;  1LTJ B;  1VQ5 P;  3L72 G;  2BCC D;  1X22 A;  2N5H A;  2AEM A;  3H1K D;  3WU2 E;  1PGQ A;  1QGK B;  3GW6 A;  2FVA A;  2YMK A;  2N98 A;  1NKZ B;  2Y9Y A;  3TGU J;  2DNW A;  1DD3 A;  2W90 A;  3GZM A;  3IR9 A;  1FJP A;  2R32 A;  1U57 A;  4OVN F;  1CEI A;  3BVH A;  2FVE A;  3VOP A;  1BCC J;  5TIS H;  3GF3 A;  1A8O A;  2CQ8 A;  2XDJ A;  1NGM B;  2HLO A;  3CWB D;  2CWO A;  1LP1 A;  2JQ4 A;  1L0L K;  4U3F D;  2Q6Q A;  2RMZ A;  3HTK A;  2HR3 A;  2M5A B;  1KYO H;  3R2P A;  2JO1 A;  4WY4 C;  1N7S C;  5HVC A;  1FDO A;  4OGQ C;  1JNM A;  4U0E A;  5AW0 B;  3CX5 E;  3TNU A;  5KJ7 A;  2IPP A;  2I1K A;  1SQB D;  2OYI A;  1J1E C;  3V5B A;  1D1D A;  1RF1 A;  1Q2N A;  1LJ2 A;  1HVV A;  5APT A;  2C9N Y;  3WBH A;  5AW1 B;  4WY4 B;  3W68 A;  1N7S B;  2M8R A;  4OGQ B;  3RL0 C;  3AEA C;  1J1E B;  1EZV I;  2JYG A;  3A0H E;  1NTK D;  3DS2 A;  2Y0D A;  1GW4 A;  3M91 A;  1EDK A;  5EW5 E;  3PRJ A;  3AEF C;  1X8Y A;  5BU5 A;  3TF5 A;  5HV8 A;  1S5L E;  2Z5H A;  3A0H H;  3NXS A;  1JMB A;  5KKZ C;  3RL0 B;  3H1J E;  4QNB A;  1LT9 A;  2WSF J;  1E6J P;  3F5H A;  2O01 J;  1N86 A;  1L0N E;  3M0D A;  1KQF B;  1L0N G;  1M74 A;  2FYZ A;  1OZH A;  2W6B A;  1IFN A;  3CCM P;  3IF4 A;  1SQV E;  4A7P A;  1OR5 A;  2FYU J;  1JB0 J;  1SQV G;  4N78 E;  4I6M C;  1JMM A;  7CEI A;  1QL2 A;  2OYH C;  5KKZ B;  1WMK A;  1D7M A;  3A7O A;  1TU3 F;  1NTZ J;  3CME P;  2FFD C;  2M8N A;  1P84 E;  1GTW A;  1M1J A;  1SLQ A;  1PP9 E;  3OW2 O;  1SQX D;  3V2P A;  1OW6 A;  1PP9 G;  2WSC J;  2KG9 A;  4HKG A;  1GPJ A;  2KUB A;  2W6J H;  3HD7 D;  1OWA A;  1HGV A;  1BDC A;  2KYV A;  3G4S P;  3RL0 g;  1SFC D;  5CZD B;  1RE4 A;  1P84 H;  1PV3 A;  2ITA A;  4JQ0 D;  1T8K A;  2OYH B;  1S1C X;  2M0B A;  1VQK P;  1JCD A;  3L70 J;  2D2C B;  2B87 A;  2ZXE B;  2KOQ A;  3L72 D;  2FFD B;  2E5T A;  2FBW C;  1JY2 O;  4IPY A;  1HGZ A;  5DCK A;  3A5T A;  1N73 C;  2QNW A;  4K35 A;  2FXP A;  4YXW H;  4EI2 A;  2JWD A;  2FYU K;  1DD4 A;  4ZMD A;  5KAF H;  3O6Q A;  1PEQ A;  4BWN A;  1NTZ K;  1PL5 A;  1NTM K;  1DEB A;  3CXH H;  5H2F E;  1VPC A;  1QX8 A;  1GU5 A;  2MD9 A;  1GL2 B;  3PLN A;  1JEK A;  1URQ C;  4BPH A;  1N73 B;  2BHV A;  3RK2 C;  2JDI H;  1LTA C;  4JYB A;  2EHS A;  2XZR A;  2SPZ A;  2BCC J;  2WPS A;  3A0B E;  1YIJ P;  4BRY A;  3WUV A;  3R4Y A;  1EDL A;  2E5Y A;  1XTC C;  2C0X A;  3OJA B;  3B5N C;  1URQ B;  1JOC A;  2KI7 B;  3M9B A;  4UHP B;  2KOR A;  2HPC A;  4W7Z A;  2Q5U A;  2KNC A;  4L76 A;  2POH A;  1EQ7 A;  2A45 I;  2B89 A;  2P2U A;  2IZ1 A;  1IMQ A;  1K04 A;  3L75 G;  4C7R A;  2K3R A;  1PFI A;  4WVZ A;  2K9J B;  2FYU E;  1PEM A;  1S2E A;  2WSF H;  1EZV E;  2WQY C;  4HB1 A;  2O01 H;  1EZV G;  3GZL A;  4H13 C;  1NTM E;  3BCC E;  3BCC G;  2KB7 P;  3HE5 B;  1QLE D;  4HKZ H;  1T8Z A;  5APU A;  2OQQ A;  3T97 B;  4XFJ A;  2HOD B;  3GG2 A;  1UIX A;  3PHL A;  5AW5 B;  1KB9 I;  3H1J D;  1KMI Z;  2WSC H;  4H13 B;  1Q82 Q;  4XFZ A;  3H1I J;  5CBO A;  2KSJ A;  2JU1 A;  3KYQ A;  2P67 A;  1ZOY C;  1SFC A;  2QIW A;  4H0L C;  1AJY A;  2WPT A;  1NTK J;  3HRN A;  3AEB C;  4PXH B;  4DT0 A;  1VQ6 P;  5HGM A;  1KLP A;  5KTB A;  2NO8 A;  2KOO A;  4KT0 J;  1P84 D;  1E79 H;  3DS3 A;  4GOD A;  1UNK A;  1AVO A;  4ZNC A;  3U1A A;  1EDI A;  3WMM 0;  2P9X A;  4C7N A;  1L0H A;  2AF8 A;  4H0L B;  2CK3 H;  4RO0 A;  1M7L A;  1FAV A;  3E7K A;  2JGP A;  1EOQ A;  2Q3I A;  3VN0 A;  3L73 E;  4GDO A;  2KLU A;  2LL8 A;  1JUN A;  3L73 G;  4UB6 H;  5APS A;  1RO2 A;  3NFQ A;  2PRR A;  5HGL A;  2WWW A;  1NTK K;  2FKW B;  5BVZ A;  3KZI E;  1FR2 A;  5CCG C;  3BAS A;  3L4F A;  1ZRT E;  5KLV E;  5I4T G;  2MVV A;  5KLV G;  1L4A A;  2GDW A;  1S9K E;  4F37 A;  2WT7 B;  2QEX P;  2ZJS E;  1JY3 O;  2FHS C;  3S9O A;  1AFO A;  2GA1 A;  2KLV A;  4EOT A;  1KIL C;  4XFX A;  2KGC A;  4PD4 I;  3SWF A;  1Q81 Q;  2BAS A;  3L72 J;  3Q3D A;  1OVU A;  3G6E P;  1U7M A;  2FQ0 A;  3M1M A;  4NEO A;  1BE3 G;  2JWA A;  4GIF A;  3AE5 C;  3VYI A;  4H44 D;  3I55 P;  3RGU A;  3JC2 2;  4JYC A;  3KDP B;  2MF4 A;  4COP A;  1KIL B;  4H2W C;  3RG6 C;  2JR8 A;  3GKL C;  3AE3 C;  5GTH E;  2GUS A;  3CCR P;  3MGE A;  2A45 G;  3H1I E;  2QSI A;  3DPH A;  2K2Q A;  1M1K Q;  1VQO P;  1BSH A;  2V4H A;  2XND H;  3V4Q A;  2LXC B;  2IBZ G;  2NZ2 A;  3MUD A;  1PGJ A;  3H1L E; 
#chains in the Genus database with same CATH homology
 3G29 A;  2BUO A;  4GR2 A;  1KD1 Q;  2OTJ P;  2E1M A;  3Q20 A;  1VQ7 P;  1K8A Q;  3DS4 A;  2CWO A;  1YIT P;  5BS2 A;  3CCE P;  2M8L A;  3CME P;  2L6E A;  2M8N A;  2Z44 A;  3HZQ A;  3OW2 O;  4WYM A;  1IUQ A;  2PEJ A;  1EOQ A;  1Q7Y Q;  3G1I A;  1KC8 Q;  2PEO A;  4PH1 A;  4U0D A;  4U0E A;  3G4S P;  3CCQ P;  1RO2 A;  1KQS O;  2KOD A;  3CMA P;  3CCJ P;  2OTL P;  1YJN P;  3B5I A;  2XV6 A;  1PEM A;  4U0A A;  2OAR A;  2EIA A;  5HGL A;  3CCV P;  1VQ9 P;  3CC4 P;  1RO0 A;  1D1D A;  3H4E A;  3DS1 A;  3LRY A;  5BS1 A;  1VQM P;  5F2N A;  3CXC O;  4U0F A;  1VQK P;  2PY8 A;  1YJW P;  1YHQ P;  1A43 A;  5I4T G;  4XFY A;  1JJ2 O;  3HYB A;  3WBH A;  1BAJ A;  5HGN A;  2EFJ A;  2ONT A;  4IPY A;  1M6E X;  2JYL A;  4U0B A;  5DCK A;  3CPW O;  3CCU P;  1PEU A;  2QEX P;  3G21 A;  3CCS P;  1Q86 Q;  2Z46 A;  3DS5 A;  2BQ1 E;  2PEN A;  1N8R Q;  1ZMB A;  1M90 Q;  4XFX A;  2JYG A;  1K73 Q;  1RNI A;  3DS2 A;  3CC2 P;  1PEQ A;  1PEO A;  1Q81 Q;  1K9M Q;  3DTJ A;  3P05 A;  3G6E P;  3G0V A;  3G28 A;  3G1G A;  4XFZ A;  1VQ5 P;  3H47 A;  1M6N A;  1Q82 Q;  3DS0 A;  1VQN P;  3M1M A;  2JO0 A;  2PEK A;  3E2D A;  1QRJ A;  1VQP P;  4M0I A;  5HGO A;  2EG5 A;  4XRO A;  1QVF O;  3I55 P;  3G71 P;  4U0C A;  2BHV A;  2DGY A;  5JPA A;  3CD6 P;  4QNB A;  3CC7 P;  3G26 A;  1VQ6 P;  4COP A;  1NJI Q;  2M8P A;  5HGM A;  1E6J P;  3RG6 C;  1YIJ P;  4XRQ A;  1W2B O;  1QVG O;  3NTE A;  3CCR P;  2LF4 A;  3MGE A;  2XXM A;  2PEM A;  4GR6 A;  2QA4 P;  3I56 P;  3H0D A;  3DS3 A;  1M74 A;  2PEI A;  2PEQ A;  3DPH A;  4COC A;  1M1K Q;  1VQ4 P;  1YJ9 P;  1VQO P;  1EIA A;  2Z45 A;  1YI2 P;  3CCM P;  4PH0 A;  1AUM A;  3VRL C;  1K30 A;  2P9X A;  3CCL P;  2XT1 A;  5F2K A;  1S72 P;  5F2O A;  1VQL P;  1A8O A;  1VQ8 P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...