1YJ9P

Crystal structure of the mutant 50s ribosomal subunit of haloarcula marismortui containing a three residue deletion in l22
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S Ribosomal RNA
total genus 43
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2005-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1yj9P03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1yj9P01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1yj9P02
3CCLP 1QVGO 1K73Q 1M90Q 3OW2O 1K8AQ 1QVFO 3CCMP 1Q81Q 1YI2P 1YITP 1VQ6P 1VQ5P 1YIJP 3CCJP 3CCUP 1VQMP 1KQSO 1VQ9P 1VQPP 1VQ4P 1N8RQ 3CMAP 1VQOP 3CXCO 1YJWP 1Q86Q 3G6EP 1VQNP 2QA4P 1JJ2O 3G4SP 1Q82Q 1NJIQ 2QEXP 1W2BO 1KD1Q 1YJNP 1KC8Q 1S72P 3CPWO 3CCVP 3G71P 1K9MQ 1M1KQ 3I55P 3CC4P 3CD6P 1YHQP 2OTLP 1Q7YQ 3CCRP 3CCEP 1YJ9P 3CC2P 3CCQP 3CMEP 2OTJP 3CCSP 3CC7P 3I56P 1VQ8P 1VQ7P 1VQKP 1VQLP
chains in the Genus database with same CATH superfamily
1QVGO 4BRYA 1VHNA 1YITP 1MZ9A 2WT7B 3DS5A 4IPYA 4JF7A 3H32A 1YQ3C 1FZCB 4PD4E 2VLQA 1AQTA 2W8ZA 2FFDC 4N78E 2I1KA 3GF7A 1P84E 3B5NA 1J1EC 1USEA 2JU2A 2J59M 2KGDA 3AE5C 2XZRA 2E1MA 3L75D 2P58A 2QA4P 2VSQA 1PEUA 4L75A 4Z1MH 2KR5A 4U0BA 2H89C 2WPRA 5HVCA 5TISH 2XT1A 3CWBJ 5APSA 2NRGA 5APTA 4U0EA 1GD2E 3Q2YA 2K5XA 3L71E 5L8RJ 1VQNP 4LC1A 3WUUA 1YJNP 4H0LC 2HODB 5TISE 1K9MQ 2KOGA 3I55P 3L72E 4U3FD 4UB8E 3Q20A 1SQXD 5AW6B 3HTKB 3B4QA 5AW2B 3NFQA 3AEDC 3HUSB 1IMQA 1YI2P 1PPJG 2ERHA 2O01N 1ZOYC 1AQ5A 2N50A 2LKIA 2YMYA 2FYZA 3KQGA 5CJ0A 4D6TE 2OTKE 3R4YA 3Q5RA 1L0NG 1UJZA 1RHZB 1SQQJ 3M0DC 2K3RA 1VQ8P 2KOOA 1TU3F 1FE6A 2BHVA 2M8RA 3GW6A 2JP3A 2QIWA 1VQ5P 1AF8A 4UB8H 3H1JE 1JTHA 5M1BA 2P2UA 2IX7C 1XTCC 3EJEA 3CCQP 4PD4H 1KFMA 3H1ID 1IK7A 1HJBA 1E79H 2ZYAA 3M0AA 1USDA 3A5TA 2W6BA 3CWBE 3C9IA 3FXDA 3V4WA 1HWTC 3RL0g 1N8RQ 5DJUB 1ZRTE 1PP9J 2LXBA 2HODA 4LGDE 1VF5C 1BGYE 3MIWA 3G28A 1JTHB 3M06A 1YQ4C 2K93A 2OYOA 1VF5B 2YO3A 3KZIH 5DCKA 4GDOA 1L0LJ 1HQBA 1KYOI 1MFTA 1OMIA 4IOIH 3G6EP 3GHGC 2RN0A 1PEMA 1N73C 2ZXXA 3CD6P 3L73J 3P8CD 2C9NY 1JMBA 3GHGB 1JCDA 1L0NJ 1NH4A 1JCCA 1VQKP 2VLPA 1GL2C 4WBAA 3SWFA 1Q2NA 5CCHD 2ONTA 4GR2A 1BCCJ 2Z5HA 2K2QA 1EZVE 5BS2A 2WPSA 1GPJA 1NU1K 1UIIA 5CMZA 3L72G 3H1LD 2IFNA 2O01H 4U0CA 1FZFA 3TNUB 2K88A 2KS1B 1SS1A 4XA4A 4R0MA 3H1IG 1RY3A 1RH5B 3M1MA 5GTIH 2AXTE 2FYUJ 1WMKA 5B66E 1FOSE 4XE5B 3OA7A 2N9BA 4D6TG 5AVUB 2EHSA 1EDLA 2A45H 4CPGA 1LP1B 2QM8A 3FWNA 3MZWB 1NAYA 1EQ7A 3E7KA 1BSNA 1EDIA 3BCCJ 1OVVA 4R4LA 3U59A 3VMYA 1ZR4A 2ZAEB 1RE4A 2FY8A 4W80A 1U57A 3CL3D 3Q5SA 2K0DX 1Q90D 5H2FH 2RH0A 4PV1B 3H32B 1L0LK 4GODA 2SPZA 3N7NA 4OGQD 2IZ0A 3RL0B 2WSSH 4U3FJ 1ZR2A 1YTZT 3HE5B 5KLVG 5KJ7D 1EMVA 1BCCE 3CX5E 1L2PA 1LNQA 4QNBA 2QEXP 2KNCB 2GUVA 3TF5A 4DJGA 1HH0A 4XFYA 2WSFH 1G1IA 1RE4C 2KYVA 3CX5I 4EIJA 2E75C 2C9LY 2HLOA 1K73Q 1AYIA 2QE7H 2FXOA 2E75B 4PJ0E 2KODA 5BS1A 1NTKK 1CSBA 4UB6E 4JBZA 2GZIA 1FZEA 5KJ7A 1NTMK 3IAOA 3CC7P 3H25A 2E5TA 1GXHA 1URQA 4WY4B 1EOQA 1YBKA 1T2KD 2KS1A 2KSEA 3FXEA 1UIXA 2YNYA 4WY4C 5AW4B 2KG6A 5CCGC 1SQQK 1LWUB 1SFCA 4K3AA 1OVRA 3A3YB 3NY7B 3WU2E 3WBHA 4HB1A 5KAIH 2QJYB 4PH1A 2QG4A 2IBZE 4BRYB 2DW3A 1GK6A 2KOQA 1DEBA 2BCCE 2I8DA 3CXHD 3H47A 1VDFA 2R3CA 1NTZD 3BRTB 3TGUJ 3RK2C 2L22A 1KYOD 1KFNA 1PEQA 3KYQA 5CJ4A 3TGUE 4Y99C 1S1CX 1MFZA 2WMMA 2LIUA 1JY2P 2ZFCA 4HKZH 1X8YA 4Y99B 4W7ZA 3T97A 2WSCJ 3CCVP 1AV1A 3CC4P 4U7JA 3FWLA 3HD7A 1S9KD 1BSHA 1PP9G 5KTBA 3H1LE 2KZJA 1KILB 1OX3A 4H0LD 2M0BA 5JPAA 1FBMA 2WITA 1D7MA 1NTMG 1X0TA 3MUDC 2NPSA 4L76A 2JU1A 4XROA 1FJKA 3L74J 1SQPE 1KQGB 3CMEP 4K35A 2AVAA 2CPBA 3AE1C 1CW5A 4NEOA 2R32A 5APXA 2MD9A 2YKOA 2Z4EA 3Q3DA 1N86A 2GZJA 1EZVI 3W68A 2XXMA 2ITAA 3EFFK 3G3ZA 3VP9A 5KP7B 2YMKA 2IBZI 1E0HA 5KLVK 4YXWH 1J1EB 3FGAD 2GZFA 3O6QB 1L4AD 2G3AA 2AEJA 1OXZA 2M5AB 2D2CB 3RK3B 1G2CA 1NVOA 2QM7A 3AE3C 4AQRD 1NKZB 2KOSA 1M1JB 2EHTA 2HG5D 2KZIA 3S9OA 1JOCA 1DX7A 2IZ1A 4H44C 1NGMB 3AE6C 1JO5A 2AXCA 2R3SA 3H1IE 2L9FA 2CK3H 1M8OB 2P7JA 2N98A 1L4AA 3TK1A 2P10A 1ZRTD 1S2EA 1UNKA 2PFXA 5CHXA 2WWWA 1QRJA 4M0IA 1L0LE 2NO8A 1OFCX 2IFMA 2WZ7A 4GOFA 4EDFA 2LKMA 1K04A 2Q1KA 2N1TD 3PLNA 3Q1MA 3N4XA 2XNXA 3RK3D 5CCGD 5F2OA 2GM4A 1ZW0A 2PEJA 2Q6QA 5AW5B 2MKVA 3IFMA 1PP9E 3TDKA 1JUNA 1RF0A 4RESB 2L4BA 3RG6C 3SSUA 1BGYJ 1R5SA 3AEEC 1IK9A 2E74D 2AFEA 2A45G 2FYUK 5E79E 1L0HA 1GZLA 2MVVA 1URQC 4EYYQ 2OARA 4IL6X 3V2PA 2B87B 2Z45A 3EJBA 2CWOA 3EJDA 1R8EA 1LGHB 1HGVA 1L0NE 3JCUH 1PGOA 2Q3EA 1KB9D 1PPJD 1KYOE 3AE8C 4C7RA 2Q5UA 1EC5A 3CWBG 1BDCA 4COCA 2YKPA 2IBZG 1SQQE 1HF9A 1Q82Q 3A0BE 1SQBJ 1ZP0C 1BXIA 3SWKA 2OYHC 2GZGA 4I1LA 2OYIC 1RE3C 2Y0DA 3H1JG 3HE4A 2V7QJ 3VN0A 4H0LB 3BCCE 3RBXA 3B5NB 2C0XA 2OYIB 4PWVB 5CBOA 3B4SA 2KK7A 3NTEA 1OR5A 2KWLA 1NU1D 4IFDK 4LLHA 3HD7B 1NTKE 1FJPA 1GTWA 2LMLA 3U43A 3AE7C 2YO2A 1SQBK 3BASA 3OJAB 2G8YA 1GL2A 1K30A 2Q7CA 2GYKA 3BRVB 3TYYA 3LMOA 3KXDA 4KT0J 2Q9IA 3L70E 2RMZA 1LT9A 1ZMEC 3T97B 3WUTA 1NAFA 3M9QA 2P9XA 1PIXA 2JJLA 2W6AA 1M90Q 3M91A 3G26A 1LT9B 3S1KA 2KGEA 3NXSA 5TJHA 2M8LA 2FXMA 1T2KC 4H2YC 4O9BA 2DNWA 4WY4D 1NQ4A 1KV4A 2XV5A 1FDOA 1F80D 1FC2C 2FQ1A 1J2JB 3I5CA 1J1DB 1K8AQ 1KLPA 1SQVD 3MUDA 1SQPG 3TSIA 1J1DC 1DD3A 2OTLP 2E75D 5EFWB 3CC2P 4JPZB 2JO1A 2POHA 2WSFJ 1N73B 1NYHA 1ZXGA 3PP5A 3L75J 2JEEA 1N7SB 3H1LJ 2PEQA 1VF5D 1KILD 3G1IA 2XZ0D 3CXHI 1H0TB 2K0XA 4ASWA 2FXPA 2LF4A 1IFNA 4HKGA 2KGCA 1H88A 2FACA 3HRNA 4HH2A 5KLVD 3L74G 3V4QA 2FVFA 3CXHE 3RGUA 2D2CD 1NTZE 2FHSC 4AUWA 1IJDB 3MGEA 3CCMP 1ZNVA 2JYGA 3TGUD 3BATA 2QRXA 3AE2C 2CPSA 3KZIE 2Y9ZA 1SFCC 1PGPA 3GJNA 4GT1A 4YXDC 2R44A 1SVFA 2KLUA 3VTPC 5KLIC 2PEMA 2BCCJ 1LTJC 2ZXEB 1S9KE 2UWJE 4W7YA 1KZUB 2ZYDA 2HR3A 2CQ8A 1NO4A 2J58A 1M74A 3MGNA 2M3EA 2KW2A 2JYLA 4GIFA 2R5DA 1KORA 3G21A 4NPDA 3P05A 1U7JA 3L35A 3G29A 1A8OA 4PV1C 4PV1D 2ZYGA 2XZ1C 2GZEA 2MF4A 3RK2B 1N7LA 5AVWB 2M8NA 4U3FG 4Y28J 1GW3A 1ZLLA 2WSEH 3CCEP 3ITKA 1KYOH 3AEBC 3V6IA 3L73D 2LL8A 2E76D 1DH3A 1SQVK 1KQSO 1A02F 1Q86Q 2FQ2A 5AW3B 1SQPK 1G2CB 2XDJA 4DZOA 3UIAA 3A7OA 2M8PA 3AEAC 3H1KD 4HJGH 3H1LG 4I2LC 1LTIC 2B89A 1HTLC 3WMM0 2FBWC 1Q81Q 3GMAA 4TLFA 1CI6A 2JBGA 5AVZB 2K94A 3U1CA 1Q7YQ 3KDPB 2KXPB 3CLQA 1VKUA 3HUSC 3L70G 1JNMA 2Y0EA 3PHLA 4NPFX 3CX5D 1SQXJ 3PRJA 2QJYC 2E74C 1LTTC 1NTKG 2B88A 2OTJP 1R5LA 3GG2A 3D71A 2D2CC 2KOPA 3RK3C 1PGQA 4IL6E 3M0DA 2YKQA 1X22A 3CCUP 3D70A 3GF3A 1T8KA 4L73A 3CXCO 1BGYD 5H2FE 1SFCD 2GUSA 5KAIE 3CPWO 2YIUC 1FDMA 1CZQA 2RKLA 5BU8B 1HVVA 3AE4C 2BUOA 1RF1C 3D6YA 1E5WA 4N6JA 4CA3A 3II6A 3SFDC 1T8ZA 1GW4A 2JR8A 5AVYB 5F2KA 1RF1B 2FVEA 1L4AC 3WUVA 1FZAA 3VOPA 1ZV8A 4ZMDA 2WPTA 2Z46A 3A0BH 4RKUJ 2K0YA 1T3JA 2PGDA 3CCSP 1GU4A 1RQUA 2PRRA 3DTJA 1JMMA 1JY2O 2Q3IA 2PNGA 2MR8A 4YTPC 1AUMA 2BCCD 1BGYG 1YJWP 3LIEA 5CCGA 2L0QA 4C7NB 1SQBG 2LTEA 4GR6A 2AEMA 3L37A 5CCHA 4BPGA 2LOLA 2W83C 5B5EH 1S5LH 1RF0C 4RO0A 1JY3O 1M7LA 2XU6A 3MHVA 4HYTB 1URQB 3USSA 2ROQA 2H43A 2FFDB 3RL0D 3A0HH 4IFMA 4MN4C 4OWFA 5AVSB 3LIDA 1NU1G 2E76B 3B5ND 2KNCA 1BDDA 4PD4D 1QGKB 2N1TB 3L70D 3PJSK 5APUA 2JB0A 2ZVNB 3GKLC 1D1DA 1JY2N 2H8PD 2BCCG 1FU1A 2PEIA 4I6MC 5DJTB 5AW8B 4JYBA 1M56D 2KSJA 1RO2A 4OVNF 4MRTC 1BE3J 3LRYA 3P7KA 1IFMA 1RE3A 2ZVOB 3GZLA 3B5NC 1MUUA 4WB4A 1L0NK 1S3JA 3I56P 1SQBE 1JB0J 3AECC 5E79H 2OYIA 2EFJA 3H1HJ 3OAKA 1G1JA 2P1JA 1NTZJ 3H1KJ 1LTSC 3SFEC 1AJYA 3L71D 2N5IA 2QJKC 3CI9A 3KHUA 1Y9BA 2CGQA 4GOEA 4EI2A 2JWDA 1SP4A 2JKVA 4XFXA 1AVYA 5HGOA 1N7SA 4U0FA 5C39A 1RQVA 2A06D 2PEOA 3H1HG 1M1KQ 1KILE 1YJ9P 2FKWB 2PY8A 1LT9C 5KLVE 1BAJA 3HE5A 4B86A 3OW2O 3V5BA 1QLED 5KLVJ 3FX0A 3L4FA 1URQD 1AFOA 1JJ2O 1PL5A 3L73G 1L0LD 5APWA 3QWOC 1PFIA 3L75G 3NTNA 5KJ7C 2ZJSE 2FQ0A 4OH8B 1QL1A 2K92A 3CCJP 2KGAA 4ZKPA 4PH0A 1LP1A 5AVRB 3WU2H 1RO0A 3H1KG 4N3YB 3A2AA 2QJPB 1LJ2A 1CEIA 1ZN5A 4XFZA 1N7SC 1NTZK 3C8VA 1NTKJ 1MKMA 3A0HE 2HPCA 2QJPC 5HGMA 2W90A 4JQ0D 1VQ6P 1GL2B 3S4RA 3G4SP 3KPEA 2VLOA 1PZQA 4H44D 1DIPA 2PP6A 2XNDH 2V7QH 5KKZB 2A06G 3L74E 4H2XC 1EZVG 3IR9A 5AW1B 3BCCG 1WRGA 5B5EE 3R2PA 2AF8A 1SQQD 1Z6MA 5KP8B 1P84D 3L73E 3H4EA 4BPHA 2JDIH 2B9BA 1P84H 1S4XA 1SQPD 4IZ6A 4QKOA 2K9JA 2PAJA 3MP7B 1SQQG 3L75E 2YXQB 1NTMD 1SQVJ 1EXJA 2BEZF 2AFDA 2XV6A 4L74A 1E6JP 4ZNCA 2P67A 2DGYA 1JY3P 1PEOA 3HTKA 1ACPA 2PENA 2MY5A 3P32A 5AVQB 2E5YA 1A43A 1EDJA 3LW5J 2Z44A 1SQXE 2YXRB 2Z5IA 1FZCC 1QX8A 2WQYC 2H7HA 2HPCB 2LIWA 2E42A 1YIJP 1VQ9P 1Z56A 1FZGA 5K5GB 4DCKA 5CCHC 2OGUA 4WVZA 1OVUA 3RG2A 2WPVB 3L36A 4BPFA 2WTYA 1JEKA 1JM0A 1KQLA 4U0AA 1GU5A 4UHPB 1MZ8A 2FYNB 1NU1J 1L0LG 3G0VA 2FVAA 2GDXA 3MTUE 3VRLC 1FDIA 3HZQA 3JSVC 3MD0A 2M5RA 5AVXB 2KP8A 1GDTA 1BCCD 2NPSB 1YTZI 2WSEJ 4D6TJ 2WT7A 2QVAA 3RK2D 1SQVE 4I7ZB 2KLVA 4KHXA 2W6JH 3Q5PA 1KILA 3CMAP 3CWBD 1OW7A 1W2BO 1KD1Q 1HGZA 3AEFC 1LTAC 1OWAA 1KQFB 5AVVB 1FZCA 3H1JJ 4H13D 1LWUC 2XKMA 3K5BA 2FFDA 1SQXK 3V2RA 1KN7A 4DG9A 3O8ZA 1M57D 2IYOA 2QSIA 1Y8AA 4OGQC 1N73A 5GTHE 4COPA 1EIAA 2FAEA 5AW9B 4OGQB 4ZKUA 1OZHA 5KAFE 2W27A 1M6EX 4WYMA 1KMIZ 2EIAA 1NTZG 3PTZA 2K9YA 1OW8A 3ABVC 2YIUB 7CEIA 1HUCA 3EQ2A 1NHLA 1DNYA 2ZT9D 3BCCD 1LTGC 1RF1A 2K1AA 2FADA 4BWNA 3V2NA 3ZDMA 4F37A 5EW5E 3L74D 3HD7D 5APQA 2IYPA 2KI7B 4IFFA 1IFJA 1NTKD 1KC8Q 1KB9H 3H6PA 1K05A 2N6ZA 2I1JA 2KG8A 2N9YB 1OW6A 2JWAA 1LTJA 3VMZA 3LW5H 2KORA 1NTME 1SQBD 2N6YA 1H8AA 1JY3N 2JQ4A 1U7MA 3HD7C 3GLMA 3DS4A 3AEGC 1YYCA 1IFDA 1DV5A 4QMAA 2L91A 3F89A 1HY8A 1VPCA 5BU5A 3DPHA 2X2BA 3CXHH 3JCUE 3HE4B 3DS0A 2N1TC 1CI6B 3H1KE 3P8MC 1W5CE 1EDKA 2GA1A 2A06E 2LR2A 1HBWA 4JYCA 4WWIA 1A02J 1FAVA 1OIPA 4AYCA 2BASA 3VMXA 5F2NA 3GHGA 5HGLA 5CZDB 4U3FE 1MV8A 2IDBA 2B87A 1L4AB 1NKNA 2FYUD 2MJZA 1BE3E 3VYIA 3B8EB 1KB9I 2R5BA 1VQ7P 3EFGA 5CBNA 1IC2A 3H1HE 1L0IA 4XFJA 1LT1A 4H2WC 1NJIQ 3E1IA 4M3LA 1QL2A 2N5HA 1XTGB 3RL0C 2O01J 4XRQA 2M5AA 1IFIA 2CG5B 3B5IA 1VQLP 2MVUA 2HYNA 2KG9A 2OYHA 3H1JD 1NWQA 3M9BA 1VQ4P 1PV3A 2IBZD 2GDYA 2L5GB 1YHQP 2PEKA 3TGUG 3RK3E 5HGNA 4PXHB 2E76C 5AW0B 1RNIA 1PP9D 3G9RA 3E2DA 3V2QA 2VLNA 3G1GA 4DT0A 3DS1A 5KAFH 1S72P 4UB6H 3JC22 2K37A 4R4MA 3CCRP 1WT6A 2M3BA 3M9HA 4C46A 2VRSA 2O1JA 2OYHB 2KB7P 1T6AA 3DS2A 1S5LE 1X9VA 3O6QA 1VQPP 3DS3A 3GZMA 1IMPA 1KB9E 2JAZA 1PPJE 1Y47A 2WSCH 3TNUA 4PD4I 4A7PA 1M1JA 3CX5H 4YPCA 1LTBC 1IUQA 2CNRA 5GTHH 4N78D 2K9JB 3PH0A 5GTIE 1N2DC 1W2EA 2QJKB 1IFPA 1EZVD 3L71G 2Y9YA 1P84I 3RBZA 3CE7A 3HYBA 1AA0A 1VQOP 5I4TG 2KUBA 1T3UA 4KJMA 2J5UA 5KKZC 1GL2D 1GK4A 2FYUG 1NU1E 4NPEA 3H0DA 5KP6B 2LXCB 3VMAA 3U1AA 4RJTA 3IN6A 1QEXA 3NMDA 1FOSF 1FR2A 3HUSA 1H89A 5APVA 3L72D 3VP8A 5AVTB 3SWYA 1BCCG 1GXGA 4PJ0H 2BQ1E 1M6NA 1SQXG 4H13C 4WY4A 3D6ZA 1EXIA 1N7SD 5AW7B 2V4HA 4D6TD 1VQMP 3L70J 4TT3H 2O3JA 4H13B 1SLQA 2C0WA 1KTMA 3QH9A 1H0TA 1NOHA 2NZ2A 3F5HA 1AVOA 2AXTH 2FYUE 3CCLP 1BE3D 4ASVA 2E43A 1QVFO 2E74B 2AEFA 1ZMBA 2EG5A 3H1IJ 2H88C 3H1HD 3BVHA 1PGJA 2JGPA 2FYNC 2KIKA 3AE9C 1DEEG 2L6EA 4DOJA 3EWKA 3C1LA 3L72J 4IL6H 1SQPJ 3W67A 2WPQA 5B66H 3B71A 1FS0E 1X79B 5HV8A 5EJDA 1IO4A 5BVZA 1IZNB 1M1JC 2OQQA 1NTMJ 2N1TA 2MR7A 2HFED 2NPSC 2QNWA 2Y0CA 4H44B 3IF4A 1FZBA 1LWUA 1SFCB 1GMJA 4I7ZC 1HJ0A 4U0DA 1DD4A 2ZT9B 4BXLA 2IPPA 2O1KA 4EOTA 5KLIB 3L71J 1S5LX 1SQVG 2ZT9C 1KILC 1LTJB 2JO0A 1L0ND 3P8CE 2A45I 1X3OA 2BEQD 3G71P 3E1RA 2WVRA 2NPSD 4C7NA 4GKGA 1VL2A 2GDWA 2LPKA 5APYA 1BE3G
chains in the Genus database with same CATH topology
1E6JP 1EOQA 1M6NA 1QVGO 2DGYA 1M90Q 3OW2O 3DPHA 2BQ1E 3G26A 1YITP 2BHVA 1PEOA 3M1MA 3DS5A 1VQ5P 4IPYA 1M74A 3E2DA 1VQMP 2M8LA 3G1GA 2JYLA 2XXMA 3DS0A 3DS1A 1JJ2O 4COPA 1EIAA 2PENA 1S72P 2OARA 3CCRP 2OTJP 3CCQP 2Z45A 2CWOA 3WBHA 3G21A 3P05A 1A43A 1M6EX 4PH1A 4WYMA 2Z44A 3CCLP 3G29A 2EIAA 1A8OA 1K8AQ 1QVFO 1D1DA 5F2NA 3DS2A 1ZMBA 1YIJP 3CCJP 2PEIA 3CCUP 1VQ9P 2EG5A 1VQPP 1N8RQ 2E1MA 3DS3A 4COCA 3CXCO 5HGLA 4PH0A 2QA4P 1Q82Q 1PEUA 1RO2A 2OTLP 3CPWO 1RO0A 3LRYA 3H47A 2M8NA 1IUQA 4U0AA 3CC2P 4U0BA 3G28A 2L6EA 4XFZA 3I56P 1VQ7P 2XT1A 2BUOA 3CCEP 2EFJA 1PEQA 3G0VA 5HGMA 4U0EA 5DCKA 5F2KA 3VRLC 1VQ6P 3HYBA 3NTEA 2PEQA 3HZQA 1KQSO 3G1IA 1Q86Q 1VQOP 1VQNP 5I4TG 3G6EP 1PEMA 3G4SP 1NJIQ 4QNBA 2QEXP 1YJNP 2LF4A 1KC8Q 3CCVP 1K9MQ 3CC4P 3CD6P 3I55P 2Z46A 3Q20A 4U0DA 4XFYA 3H0DA 3CCSP 2M8PA 4XRQA 3DTJA 1VQKP 3B5IA 1QRJA 1VQLP 4M0IA 4XFXA 1K73Q 1K30A 5HGOA 2ONTA 4GR2A 5JPAA 3MGEA 3CCMP 1Q81Q 1YI2P 2JYGA 1AUMA 4U0FA 2JO0A 2KODA 5BS1A 3H4EA 5BS2A 1VQ4P 3CMAP 1YJWP 1W2BO 2PEOA 4GR6A 4XROA 5F2OA 1KD1Q 1M1KQ 2PEJA 3G71P 3DS4A 1YHQP 1Q7YQ 2PEKA 3CMEP 1YJ9P 4U0CA 2PEMA 5HGNA 3CC7P 1VQ8P 1RNIA 3RG6C 2XV6A 2PY8A 1BAJA 2P9XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCL P;  1QVG O;  1K73 Q;  1M90 Q;  3OW2 O;  1K8A Q;  1QVF O;  3CCM P;  1Q81 Q;  1YI2 P;  1YIT P;  1VQ6 P;  1VQ5 P;  1YIJ P;  3CCJ P;  3CCU P;  1VQM P;  1KQS O;  1VQ9 P;  1VQP P;  1VQ4 P;  1N8R Q;  3CMA P;  1VQO P;  3CXC O;  1YJW P;  1Q86 Q;  3G6E P;  1VQN P;  2QA4 P;  1JJ2 O;  3G4S P;  1Q82 Q;  1NJI Q;  2QEX P;  1W2B O;  1KD1 Q;  1YJN P;  1KC8 Q;  1S72 P;  3CPW O;  3CCV P;  3G71 P;  1K9M Q;  1M1K Q;  3I55 P;  3CC4 P;  3CD6 P;  1YHQ P;  2OTL P;  1Q7Y Q;  3CCR P;  3CCE P;  1YJ9 P;  3CC2 P;  3CCQ P;  3CME P;  2OTJ P;  3CCS P;  3CC7 P;  3I56 P;  1VQ8 P;  1VQ7 P;  1VQK P;  1VQL P; 
#chains in the Genus database with same CATH topology
 1QVG O;  4BRY A;  1VHN A;  1YIT P;  1MZ9 A;  2WT7 B;  3DS5 A;  4IPY A;  4JF7 A;  3H32 A;  1YQ3 C;  1FZC B;  4PD4 E;  2VLQ A;  1AQT A;  2W8Z A;  2FFD C;  4N78 E;  2I1K A;  3GF7 A;  1P84 E;  3B5N A;  1J1E C;  1USE A;  2JU2 A;  2J59 M;  2KGD A;  3AE5 C;  2XZR A;  2E1M A;  3L75 D;  2P58 A;  2QA4 P;  2VSQ A;  1PEU A;  4L75 A;  4Z1M H;  2KR5 A;  4U0B A;  2H89 C;  2WPR A;  5HVC A;  5TIS H;  2XT1 A;  3CWB J;  5APS A;  2NRG A;  5APT A;  4U0E A;  1GD2 E;  3Q2Y A;  2K5X A;  3L71 E;  5L8R J;  1VQN P;  4LC1 A;  3WUU A;  1YJN P;  4H0L C;  2HOD B;  5TIS E;  1K9M Q;  2KOG A;  3I55 P;  3L72 E;  4U3F D;  4UB8 E;  3Q20 A;  1SQX D;  5AW6 B;  3HTK B;  3B4Q A;  5AW2 B;  3NFQ A;  3AED C;  3HUS B;  1IMQ A;  1YI2 P;  1PPJ G;  2ERH A;  2O01 N;  1ZOY C;  1AQ5 A;  2N50 A;  2LKI A;  2YMY A;  2FYZ A;  3KQG A;  5CJ0 A;  4D6T E;  2OTK E;  3R4Y A;  3Q5R A;  1L0N G;  1UJZ A;  1RHZ B;  1SQQ J;  3M0D C;  2K3R A;  1VQ8 P;  2KOO A;  1TU3 F;  1FE6 A;  2BHV A;  2M8R A;  3GW6 A;  2JP3 A;  2QIW A;  1VQ5 P;  1AF8 A;  4UB8 H;  3H1J E;  1JTH A;  5M1B A;  2P2U A;  2IX7 C;  1XTC C;  3EJE A;  3CCQ P;  4PD4 H;  1KFM A;  3H1I D;  1IK7 A;  1HJB A;  1E79 H;  2ZYA A;  3M0A A;  1USD A;  3A5T A;  2W6B A;  3CWB E;  3C9I A;  3FXD A;  3V4W A;  1HWT C;  3RL0 g;  1N8R Q;  5DJU B;  1ZRT E;  1PP9 J;  2LXB A;  2HOD A;  4LGD E;  1VF5 C;  1BGY E;  3MIW A;  3G28 A;  1JTH B;  3M06 A;  1YQ4 C;  2K93 A;  2OYO A;  1VF5 B;  2YO3 A;  3KZI H;  5DCK A;  4GDO A;  1L0L J;  1HQB A;  1KYO I;  1MFT A;  1OMI A;  4IOI H;  3G6E P;  3GHG C;  2RN0 A;  1PEM A;  1N73 C;  2ZXX A;  3CD6 P;  3L73 J;  3P8C D;  2C9N Y;  1JMB A;  3GHG B;  1JCD A;  1L0N J;  1NH4 A;  1JCC A;  1VQK P;  2VLP A;  1GL2 C;  4WBA A;  3SWF A;  1Q2N A;  5CCH D;  2ONT A;  4GR2 A;  1BCC J;  2Z5H A;  2K2Q A;  1EZV E;  5BS2 A;  2WPS A;  1GPJ A;  1NU1 K;  1UII A;  5CMZ A;  3L72 G;  3H1L D;  2IFN A;  2O01 H;  4U0C A;  1FZF A;  3TNU B;  2K88 A;  2KS1 B;  1SS1 A;  4XA4 A;  4R0M A;  3H1I G;  1RY3 A;  1RH5 B;  3M1M A;  5GTI H;  2AXT E;  2FYU J;  1WMK A;  5B66 E;  1FOS E;  4XE5 B;  3OA7 A;  2N9B A;  4D6T G;  5AVU B;  2EHS A;  1EDL A;  2A45 H;  4CPG A;  1LP1 B;  2QM8 A;  3FWN A;  3MZW B;  1NAY A;  1EQ7 A;  3E7K A;  1BSN A;  1EDI A;  3BCC J;  1OVV A;  4R4L A;  3U59 A;  3VMY A;  1ZR4 A;  2ZAE B;  1RE4 A;  2FY8 A;  4W80 A;  1U57 A;  3CL3 D;  3Q5S A;  2K0D X;  1Q90 D;  5H2F H;  2RH0 A;  4PV1 B;  3H32 B;  1L0L K;  4GOD A;  2SPZ A;  3N7N A;  4OGQ D;  2IZ0 A;  3RL0 B;  2WSS H;  4U3F J;  1ZR2 A;  1YTZ T;  3HE5 B;  5KLV G;  5KJ7 D;  1EMV A;  1BCC E;  3CX5 E;  1L2P A;  1LNQ A;  4QNB A;  2QEX P;  2KNC B;  2GUV A;  3TF5 A;  4DJG A;  1HH0 A;  4XFY A;  2WSF H;  1G1I A;  1RE4 C;  2KYV A;  3CX5 I;  4EIJ A;  2E75 C;  2C9L Y;  2HLO A;  1K73 Q;  1AYI A;  2QE7 H;  2FXO A;  2E75 B;  4PJ0 E;  2KOD A;  5BS1 A;  1NTK K;  1CSB A;  4UB6 E;  4JBZ A;  2GZI A;  1FZE A;  5KJ7 A;  1NTM K;  3IAO A;  3CC7 P;  3H25 A;  2E5T A;  1GXH A;  1URQ A;  4WY4 B;  1EOQ A;  1YBK A;  1T2K D;  2KS1 A;  2KSE A;  3FXE A;  1UIX A;  2YNY A;  4WY4 C;  5AW4 B;  2KG6 A;  5CCG C;  1SQQ K;  1LWU B;  1SFC A;  4K3A A;  1OVR A;  3A3Y B;  3NY7 B;  3WU2 E;  3WBH A;  4HB1 A;  5KAI H;  2QJY B;  4PH1 A;  2QG4 A;  2IBZ E;  4BRY B;  2DW3 A;  1GK6 A;  2KOQ A;  1DEB A;  2BCC E;  2I8D A;  3CXH D;  3H47 A;  1VDF A;  2R3C A;  1NTZ D;  3BRT B;  3TGU J;  3RK2 C;  2L22 A;  1KYO D;  1KFN A;  1PEQ A;  3KYQ A;  5CJ4 A;  3TGU E;  4Y99 C;  1S1C X;  1MFZ A;  2WMM A;  2LIU A;  1JY2 P;  2ZFC A;  4HKZ H;  1X8Y A;  4Y99 B;  4W7Z A;  3T97 A;  2WSC J;  3CCV P;  1AV1 A;  3CC4 P;  4U7J A;  3FWL A;  3HD7 A;  1S9K D;  1BSH A;  1PP9 G;  5KTB A;  3H1L E;  2KZJ A;  1KIL B;  1OX3 A;  4H0L D;  2M0B A;  5JPA A;  1FBM A;  2WIT A;  1D7M A;  1NTM G;  1X0T A;  3MUD C;  2NPS A;  4L76 A;  2JU1 A;  4XRO A;  1FJK A;  3L74 J;  1SQP E;  1KQG B;  3CME P;  4K35 A;  2AVA A;  2CPB A;  3AE1 C;  1CW5 A;  4NEO A;  2R32 A;  5APX A;  2MD9 A;  2YKO A;  2Z4E A;  3Q3D A;  1N86 A;  2GZJ A;  1EZV I;  3W68 A;  2XXM A;  2ITA A;  3EFF K;  3G3Z A;  3VP9 A;  5KP7 B;  2YMK A;  2IBZ I;  1E0H A;  5KLV K;  4YXW H;  1J1E B;  3FGA D;  2GZF A;  3O6Q B;  1L4A D;  2G3A A;  2AEJ A;  1OXZ A;  2M5A B;  2D2C B;  3RK3 B;  1G2C A;  1NVO A;  2QM7 A;  3AE3 C;  4AQR D;  1NKZ B;  2KOS A;  1M1J B;  2EHT A;  2HG5 D;  2KZI A;  3S9O A;  1JOC A;  1DX7 A;  2IZ1 A;  4H44 C;  1NGM B;  3AE6 C;  1JO5 A;  2AXC A;  2R3S A;  3H1I E;  2L9F A;  2CK3 H;  1M8O B;  2P7J A;  2N98 A;  1L4A A;  3TK1 A;  2P10 A;  1ZRT D;  1S2E A;  1UNK A;  2PFX A;  5CHX A;  2WWW A;  1QRJ A;  4M0I A;  1L0L E;  2NO8 A;  1OFC X;  2IFM A;  2WZ7 A;  4GOF A;  4EDF A;  2LKM A;  1K04 A;  2Q1K A;  2N1T D;  3PLN A;  3Q1M A;  3N4X A;  2XNX A;  3RK3 D;  5CCG D;  5F2O A;  2GM4 A;  1ZW0 A;  2PEJ A;  2Q6Q A;  5AW5 B;  2MKV A;  3IFM A;  1PP9 E;  3TDK A;  1JUN A;  1RF0 A;  4RES B;  2L4B A;  3RG6 C;  3SSU A;  1BGY J;  1R5S A;  3AEE C;  1IK9 A;  2E74 D;  2AFE A;  2A45 G;  2FYU K;  5E79 E;  1L0H A;  1GZL A;  2MVV A;  1URQ C;  4EYY Q;  2OAR A;  4IL6 X;  3V2P A;  2B87 B;  2Z45 A;  3EJB A;  2CWO A;  3EJD A;  1R8E A;  1LGH B;  1HGV A;  1L0N E;  3JCU H;  1PGO A;  2Q3E A;  1KB9 D;  1PPJ D;  1KYO E;  3AE8 C;  4C7R A;  2Q5U A;  1EC5 A;  3CWB G;  1BDC A;  4COC A;  2YKP A;  2IBZ G;  1SQQ E;  1HF9 A;  1Q82 Q;  3A0B E;  1SQB J;  1ZP0 C;  1BXI A;  3SWK A;  2OYH C;  2GZG A;  4I1L A;  2OYI C;  1RE3 C;  2Y0D A;  3H1J G;  3HE4 A;  2V7Q J;  3VN0 A;  4H0L B;  3BCC E;  3RBX A;  3B5N B;  2C0X A;  2OYI B;  4PWV B;  5CBO A;  3B4S A;  2KK7 A;  3NTE A;  1OR5 A;  2KWL A;  1NU1 D;  4IFD K;  4LLH A;  3HD7 B;  1NTK E;  1FJP A;  1GTW A;  2LML A;  3U43 A;  3AE7 C;  2YO2 A;  1SQB K;  3BAS A;  3OJA B;  2G8Y A;  1GL2 A;  1K30 A;  2Q7C A;  2GYK A;  3BRV B;  3TYY A;  3LMO A;  3KXD A;  4KT0 J;  2Q9I A;  3L70 E;  2RMZ A;  1LT9 A;  1ZME C;  3T97 B;  3WUT A;  1NAF A;  3M9Q A;  2P9X A;  1PIX A;  2JJL A;  2W6A A;  1M90 Q;  3M91 A;  3G26 A;  1LT9 B;  3S1K A;  2KGE A;  3NXS A;  5TJH A;  2M8L A;  2FXM A;  1T2K C;  4H2Y C;  4O9B A;  2DNW A;  4WY4 D;  1NQ4 A;  1KV4 A;  2XV5 A;  1FDO A;  1F80 D;  1FC2 C;  2FQ1 A;  1J2J B;  3I5C A;  1J1D B;  1K8A Q;  1KLP A;  1SQV D;  3MUD A;  1SQP G;  3TSI A;  1J1D C;  1DD3 A;  2OTL P;  2E75 D;  5EFW B;  3CC2 P;  4JPZ B;  2JO1 A;  2POH A;  2WSF J;  1N73 B;  1NYH A;  1ZXG A;  3PP5 A;  3L75 J;  2JEE A;  1N7S B;  3H1L J;  2PEQ A;  1VF5 D;  1KIL D;  3G1I A;  2XZ0 D;  3CXH I;  1H0T B;  2K0X A;  4ASW A;  2FXP A;  2LF4 A;  1IFN A;  4HKG A;  2KGC A;  1H88 A;  2FAC A;  3HRN A;  4HH2 A;  5KLV D;  3L74 G;  3V4Q A;  2FVF A;  3CXH E;  3RGU A;  2D2C D;  1NTZ E;  2FHS C;  4AUW A;  1IJD B;  3MGE A;  3CCM P;  1ZNV A;  2JYG A;  3TGU D;  3BAT A;  2QRX A;  3AE2 C;  2CPS A;  3KZI E;  2Y9Z A;  1SFC C;  1PGP A;  3GJN A;  4GT1 A;  4YXD C;  2R44 A;  1SVF A;  2KLU A;  3VTP C;  5KLI C;  2PEM A;  2BCC J;  1LTJ C;  2ZXE B;  1S9K E;  2UWJ E;  4W7Y A;  1KZU B;  2ZYD A;  2HR3 A;  2CQ8 A;  1NO4 A;  2J58 A;  1M74 A;  3MGN A;  2M3E A;  2KW2 A;  2JYL A;  4GIF A;  2R5D A;  1KOR A;  3G21 A;  4NPD A;  3P05 A;  1U7J A;  3L35 A;  3G29 A;  1A8O A;  4PV1 C;  4PV1 D;  2ZYG A;  2XZ1 C;  2GZE A;  2MF4 A;  3RK2 B;  1N7L A;  5AVW B;  2M8N A;  4U3F G;  4Y28 J;  1GW3 A;  1ZLL A;  2WSE H;  3CCE P;  3ITK A;  1KYO H;  3AEB C;  3V6I A;  3L73 D;  2LL8 A;  2E76 D;  1DH3 A;  1SQV K;  1KQS O;  1A02 F;  1Q86 Q;  2FQ2 A;  5AW3 B;  1SQP K;  1G2C B;  2XDJ A;  4DZO A;  3UIA A;  3A7O A;  2M8P A;  3AEA C;  3H1K D;  4HJG H;  3H1L G;  4I2L C;  1LTI C;  2B89 A;  1HTL C;  3WMM 0;  2FBW C;  1Q81 Q;  3GMA A;  4TLF A;  1CI6 A;  2JBG A;  5AVZ B;  2K94 A;  3U1C A;  1Q7Y Q;  3KDP B;  2KXP B;  3CLQ A;  1VKU A;  3HUS C;  3L70 G;  1JNM A;  2Y0E A;  3PHL A;  4NPF X;  3CX5 D;  1SQX J;  3PRJ A;  2QJY C;  2E74 C;  1LTT C;  1NTK G;  2B88 A;  2OTJ P;  1R5L A;  3GG2 A;  3D71 A;  2D2C C;  2KOP A;  3RK3 C;  1PGQ A;  4IL6 E;  3M0D A;  2YKQ A;  1X22 A;  3CCU P;  3D70 A;  3GF3 A;  1T8K A;  4L73 A;  3CXC O;  1BGY D;  5H2F E;  1SFC D;  2GUS A;  5KAI E;  3CPW O;  2YIU C;  1FDM A;  1CZQ A;  2RKL A;  5BU8 B;  1HVV A;  3AE4 C;  2BUO A;  1RF1 C;  3D6Y A;  1E5W A;  4N6J A;  4CA3 A;  3II6 A;  3SFD C;  1T8Z A;  1GW4 A;  2JR8 A;  5AVY B;  5F2K A;  1RF1 B;  2FVE A;  1L4A C;  3WUV A;  1FZA A;  3VOP A;  1ZV8 A;  4ZMD A;  2WPT A;  2Z46 A;  3A0B H;  4RKU J;  2K0Y A;  1T3J A;  2PGD A;  3CCS P;  1GU4 A;  1RQU A;  2PRR A;  3DTJ A;  1JMM A;  1JY2 O;  2Q3I A;  2PNG A;  2MR8 A;  4YTP C;  1AUM A;  2BCC D;  1BGY G;  1YJW P;  3LIE A;  5CCG A;  2L0Q A;  4C7N B;  1SQB G;  2LTE A;  4GR6 A;  2AEM A;  3L37 A;  5CCH A;  4BPG A;  2LOL A;  2W83 C;  5B5E H;  1S5L H;  1RF0 C;  4RO0 A;  1JY3 O;  1M7L A;  2XU6 A;  3MHV A;  4HYT B;  1URQ B;  3USS A;  2ROQ A;  2H43 A;  2FFD B;  3RL0 D;  3A0H H;  4IFM A;  4MN4 C;  4OWF A;  5AVS B;  3LID A;  1NU1 G;  2E76 B;  3B5N D;  2KNC A;  1BDD A;  4PD4 D;  1QGK B;  2N1T B;  3L70 D;  3PJS K;  5APU A;  2JB0 A;  2ZVN B;  3GKL C;  1D1D A;  1JY2 N;  2H8P D;  2BCC G;  1FU1 A;  2PEI A;  4I6M C;  5DJT B;  5AW8 B;  4JYB A;  1M56 D;  2KSJ A;  1RO2 A;  4OVN F;  4MRT C;  1BE3 J;  3LRY A;  3P7K A;  1IFM A;  1RE3 A;  2ZVO B;  3GZL A;  3B5N C;  1MUU A;  4WB4 A;  1L0N K;  1S3J A;  3I56 P;  1SQB E;  1JB0 J;  3AEC C;  5E79 H;  2OYI A;  2EFJ A;  3H1H J;  3OAK A;  1G1J A;  2P1J A;  1NTZ J;  3H1K J;  1LTS C;  3SFE C;  1AJY A;  3L71 D;  2N5I A;  2QJK C;  3CI9 A;  3KHU A;  1Y9B A;  2CGQ A;  4GOE A;  4EI2 A;  2JWD A;  1SP4 A;  2JKV A;  4XFX A;  1AVY A;  5HGO A;  1N7S A;  4U0F A;  5C39 A;  1RQV A;  2A06 D;  2PEO A;  3H1H G;  1M1K Q;  1KIL E;  1YJ9 P;  2FKW B;  2PY8 A;  1LT9 C;  5KLV E;  1BAJ A;  3HE5 A;  4B86 A;  3OW2 O;  3V5B A;  1QLE D;  5KLV J;  3FX0 A;  3L4F A;  1URQ D;  1AFO A;  1JJ2 O;  1PL5 A;  3L73 G;  1L0L D;  5APW A;  3QWO C;  1PFI A;  3L75 G;  3NTN A;  5KJ7 C;  2ZJS E;  2FQ0 A;  4OH8 B;  1QL1 A;  2K92 A;  3CCJ P;  2KGA A;  4ZKP A;  4PH0 A;  1LP1 A;  5AVR B;  3WU2 H;  1RO0 A;  3H1K G;  4N3Y B;  3A2A A;  2QJP B;  1LJ2 A;  1CEI A;  1ZN5 A;  4XFZ A;  1N7S C;  1NTZ K;  3C8V A;  1NTK J;  1MKM A;  3A0H E;  2HPC A;  2QJP C;  5HGM A;  2W90 A;  4JQ0 D;  1VQ6 P;  1GL2 B;  3S4R A;  3G4S P;  3KPE A;  2VLO A;  1PZQ A;  4H44 D;  1DIP A;  2PP6 A;  2XND H;  2V7Q H;  5KKZ B;  2A06 G;  3L74 E;  4H2X C;  1EZV G;  3IR9 A;  5AW1 B;  3BCC G;  1WRG A;  5B5E E;  3R2P A;  2AF8 A;  1SQQ D;  1Z6M A;  5KP8 B;  1P84 D;  3L73 E;  3H4E A;  4BPH A;  2JDI H;  2B9B A;  1P84 H;  1S4X A;  1SQP D;  4IZ6 A;  4QKO A;  2K9J A;  2PAJ A;  3MP7 B;  1SQQ G;  3L75 E;  2YXQ B;  1NTM D;  1SQV J;  1EXJ A;  2BEZ F;  2AFD A;  2XV6 A;  4L74 A;  1E6J P;  4ZNC A;  2P67 A;  2DGY A;  1JY3 P;  1PEO A;  3HTK A;  1ACP A;  2PEN A;  2MY5 A;  3P32 A;  5AVQ B;  2E5Y A;  1A43 A;  1EDJ A;  3LW5 J;  2Z44 A;  1SQX E;  2YXR B;  2Z5I A;  1FZC C;  1QX8 A;  2WQY C;  2H7H A;  2HPC B;  2LIW A;  2E42 A;  1YIJ P;  1VQ9 P;  1Z56 A;  1FZG A;  5K5G B;  4DCK A;  5CCH C;  2OGU A;  4WVZ A;  1OVU A;  3RG2 A;  2WPV B;  3L36 A;  4BPF A;  2WTY A;  1JEK A;  1JM0 A;  1KQL A;  4U0A A;  1GU5 A;  4UHP B;  1MZ8 A;  2FYN B;  1NU1 J;  1L0L G;  3G0V A;  2FVA A;  2GDX A;  3MTU E;  3VRL C;  1FDI A;  3HZQ A;  3JSV C;  3MD0 A;  2M5R A;  5AVX B;  2KP8 A;  1GDT A;  1BCC D;  2NPS B;  1YTZ I;  2WSE J;  4D6T J;  2WT7 A;  2QVA A;  3RK2 D;  1SQV E;  4I7Z B;  2KLV A;  4KHX A;  2W6J H;  3Q5P A;  1KIL A;  3CMA P;  3CWB D;  1OW7 A;  1W2B O;  1KD1 Q;  1HGZ A;  3AEF C;  1LTA C;  1OWA A;  1KQF B;  5AVV B;  1FZC A;  3H1J J;  4H13 D;  1LWU C;  2XKM A;  3K5B A;  2FFD A;  1SQX K;  3V2R A;  1KN7 A;  4DG9 A;  3O8Z A;  1M57 D;  2IYO A;  2QSI A;  1Y8A A;  4OGQ C;  1N73 A;  5GTH E;  4COP A;  1EIA A;  2FAE A;  5AW9 B;  4OGQ B;  4ZKU A;  1OZH A;  5KAF E;  2W27 A;  1M6E X;  4WYM A;  1KMI Z;  2EIA A;  1NTZ G;  3PTZ A;  2K9Y A;  1OW8 A;  3ABV C;  2YIU B;  7CEI A;  1HUC A;  3EQ2 A;  1NHL A;  1DNY A;  2ZT9 D;  3BCC D;  1LTG C;  1RF1 A;  2K1A A;  2FAD A;  4BWN A;  3V2N A;  3ZDM A;  4F37 A;  5EW5 E;  3L74 D;  3HD7 D;  5APQ A;  2IYP A;  2KI7 B;  4IFF A;  1IFJ A;  1NTK D;  1KC8 Q;  1KB9 H;  3H6P A;  1K05 A;  2N6Z A;  2I1J A;  2KG8 A;  2N9Y B;  1OW6 A;  2JWA A;  1LTJ A;  3VMZ A;  3LW5 H;  2KOR A;  1NTM E;  1SQB D;  2N6Y A;  1H8A A;  1JY3 N;  2JQ4 A;  1U7M A;  3HD7 C;  3GLM A;  3DS4 A;  3AEG C;  1YYC A;  1IFD A;  1DV5 A;  4QMA A;  2L91 A;  3F89 A;  1HY8 A;  1VPC A;  5BU5 A;  3DPH A;  2X2B A;  3CXH H;  3JCU E;  3HE4 B;  3DS0 A;  2N1T C;  1CI6 B;  3H1K E;  3P8M C;  1W5C E;  1EDK A;  2GA1 A;  2A06 E;  2LR2 A;  1HBW A;  4JYC A;  4WWI A;  1A02 J;  1FAV A;  1OIP A;  4AYC A;  2BAS A;  3VMX A;  5F2N A;  3GHG A;  5HGL A;  5CZD B;  4U3F E;  1MV8 A;  2IDB A;  2B87 A;  1L4A B;  1NKN A;  2FYU D;  2MJZ A;  1BE3 E;  3VYI A;  3B8E B;  1KB9 I;  2R5B A;  1VQ7 P;  3EFG A;  5CBN A;  1IC2 A;  3H1H E;  1L0I A;  4XFJ A;  1LT1 A;  4H2W C;  1NJI Q;  3E1I A;  4M3L A;  1QL2 A;  2N5H A;  1XTG B;  3RL0 C;  2O01 J;  4XRQ A;  2M5A A;  1IFI A;  2CG5 B;  3B5I A;  1VQL P;  2MVU A;  2HYN A;  2KG9 A;  2OYH A;  3H1J D;  1NWQ A;  3M9B A;  1VQ4 P;  1PV3 A;  2IBZ D;  2GDY A;  2L5G B;  1YHQ P;  2PEK A;  3TGU G;  3RK3 E;  5HGN A;  4PXH B;  2E76 C;  5AW0 B;  1RNI A;  1PP9 D;  3G9R A;  3E2D A;  3V2Q A;  2VLN A;  3G1G A;  4DT0 A;  3DS1 A;  5KAF H;  1S72 P;  4UB6 H;  3JC2 2;  2K37 A;  4R4M A;  3CCR P;  1WT6 A;  2M3B A;  3M9H A;  4C46 A;  2VRS A;  2O1J A;  2OYH B;  2KB7 P;  1T6A A;  3DS2 A;  1S5L E;  1X9V A;  3O6Q A;  1VQP P;  3DS3 A;  3GZM A;  1IMP A;  1KB9 E;  2JAZ A;  1PPJ E;  1Y47 A;  2WSC H;  3TNU A;  4PD4 I;  4A7P A;  1M1J A;  3CX5 H;  4YPC A;  1LTB C;  1IUQ A;  2CNR A;  5GTH H;  4N78 D;  2K9J B;  3PH0 A;  5GTI E;  1N2D C;  1W2E A;  2QJK B;  1IFP A;  1EZV D;  3L71 G;  2Y9Y A;  1P84 I;  3RBZ A;  3CE7 A;  3HYB A;  1AA0 A;  1VQO P;  5I4T G;  2KUB A;  1T3U A;  4KJM A;  2J5U A;  5KKZ C;  1GL2 D;  1GK4 A;  2FYU G;  1NU1 E;  4NPE A;  3H0D A;  5KP6 B;  2LXC B;  3VMA A;  3U1A A;  4RJT A;  3IN6 A;  1QEX A;  3NMD A;  1FOS F;  1FR2 A;  3HUS A;  1H89 A;  5APV A;  3L72 D;  3VP8 A;  5AVT B;  3SWY A;  1BCC G;  1GXG A;  4PJ0 H;  2BQ1 E;  1M6N A;  1SQX G;  4H13 C;  4WY4 A;  3D6Z A;  1EXI A;  1N7S D;  5AW7 B;  2V4H A;  4D6T D;  1VQM P;  3L70 J;  4TT3 H;  2O3J A;  4H13 B;  1SLQ A;  2C0W A;  1KTM A;  3QH9 A;  1H0T A;  1NOH A;  2NZ2 A;  3F5H A;  1AVO A;  2AXT H;  2FYU E;  3CCL P;  1BE3 D;  4ASV A;  2E43 A;  1QVF O;  2E74 B;  2AEF A;  1ZMB A;  2EG5 A;  3H1I J;  2H88 C;  3H1H D;  3BVH A;  1PGJ A;  2JGP A;  2FYN C;  2KIK A;  3AE9 C;  1DEE G;  2L6E A;  4DOJ A;  3EWK A;  3C1L A;  3L72 J;  4IL6 H;  1SQP J;  3W67 A;  2WPQ A;  5B66 H;  3B71 A;  1FS0 E;  1X79 B;  5HV8 A;  5EJD A;  1IO4 A;  5BVZ A;  1IZN B;  1M1J C;  2OQQ A;  1NTM J;  2N1T A;  2MR7 A;  2HFE D;  2NPS C;  2QNW A;  2Y0C A;  4H44 B;  3IF4 A;  1FZB A;  1LWU A;  1SFC B;  1GMJ A;  4I7Z C;  1HJ0 A;  4U0D A;  1DD4 A;  2ZT9 B;  4BXL A;  2IPP A;  2O1K A;  4EOT A;  5KLI B;  3L71 J;  1S5L X;  1SQV G;  2ZT9 C;  1KIL C;  1LTJ B;  2JO0 A;  1L0N D;  3P8C E;  2A45 I;  1X3O A;  2BEQ D;  3G71 P;  3E1R A;  2WVR A;  2NPS D;  4C7N A;  4GKG A;  1VL2 A;  2GDW A;  2LPK A;  5APY A;  1BE3 G; 
#chains in the Genus database with same CATH homology
 1E6J P;  1EOQ A;  1M6N A;  1QVG O;  2DGY A;  1M90 Q;  3OW2 O;  3DPH A;  2BQ1 E;  3G26 A;  1YIT P;  2BHV A;  1PEO A;  3M1M A;  3DS5 A;  1VQ5 P;  4IPY A;  1M74 A;  3E2D A;  1VQM P;  2M8L A;  3G1G A;  2JYL A;  2XXM A;  3DS0 A;  3DS1 A;  1JJ2 O;  4COP A;  1EIA A;  2PEN A;  1S72 P;  2OAR A;  3CCR P;  2OTJ P;  3CCQ P;  2Z45 A;  2CWO A;  3WBH A;  3G21 A;  3P05 A;  1A43 A;  1M6E X;  4PH1 A;  4WYM A;  2Z44 A;  3CCL P;  3G29 A;  2EIA A;  1A8O A;  1K8A Q;  1QVF O;  1D1D A;  5F2N A;  3DS2 A;  1ZMB A;  1YIJ P;  3CCJ P;  2PEI A;  3CCU P;  1VQ9 P;  2EG5 A;  1VQP P;  1N8R Q;  2E1M A;  3DS3 A;  4COC A;  3CXC O;  5HGL A;  4PH0 A;  2QA4 P;  1Q82 Q;  1PEU A;  1RO2 A;  2OTL P;  3CPW O;  1RO0 A;  3LRY A;  3H47 A;  2M8N A;  1IUQ A;  4U0A A;  3CC2 P;  4U0B A;  3G28 A;  2L6E A;  4XFZ A;  3I56 P;  1VQ7 P;  2XT1 A;  2BUO A;  3CCE P;  2EFJ A;  1PEQ A;  3G0V A;  5HGM A;  4U0E A;  5DCK A;  5F2K A;  3VRL C;  1VQ6 P;  3HYB A;  3NTE A;  2PEQ A;  3HZQ A;  1KQS O;  3G1I A;  1Q86 Q;  1VQO P;  1VQN P;  5I4T G;  3G6E P;  1PEM A;  3G4S P;  1NJI Q;  4QNB A;  2QEX P;  1YJN P;  2LF4 A;  1KC8 Q;  3CCV P;  1K9M Q;  3CC4 P;  3CD6 P;  3I55 P;  2Z46 A;  3Q20 A;  4U0D A;  4XFY A;  3H0D A;  3CCS P;  2M8P A;  4XRQ A;  3DTJ A;  1VQK P;  3B5I A;  1QRJ A;  1VQL P;  4M0I A;  4XFX A;  1K73 Q;  1K30 A;  5HGO A;  2ONT A;  4GR2 A;  5JPA A;  3MGE A;  3CCM P;  1Q81 Q;  1YI2 P;  2JYG A;  1AUM A;  4U0F A;  2JO0 A;  2KOD A;  5BS1 A;  3H4E A;  5BS2 A;  1VQ4 P;  3CMA P;  1YJW P;  1W2B O;  2PEO A;  4GR6 A;  4XRO A;  5F2O A;  1KD1 Q;  1M1K Q;  2PEJ A;  3G71 P;  3DS4 A;  1YHQ P;  1Q7Y Q;  2PEK A;  3CME P;  1YJ9 P;  4U0C A;  2PEM A;  5HGN A;  3CC7 P;  1VQ8 P;  1RNI A;  3RG6 C;  2XV6 A;  2PY8 A;  1BAJ A;  2P9X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...