2K2QA

Complex structure of the external thioesterase of the surfactin-synthetase with a carrier domain
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
82
structure length
82
Chain Sequence
MGVTEAQYVAPTNAVESKLAEIWERVLGVSGIGILDNFFQIGGHSLKAMAVAAQVHREYQVELPLKVLFAQPTIKALAQYVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the selectivity of the external thioesterase of the surfactin synthetase.
pubmed doi rcsb
source organism Brevibacillus parabrevis
molecule tags Ligase/hydrolase
molecule keywords Tyrocidine synthetase 3 (Tyrocidine synthetase III)
total genus 14
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2008-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2k2qA00
2LL8A 2K2QA 1DV5A 2N6ZA 2MVUA 2FAEA 2EHSA 2MR8A 5CZDB 5KP8B 4NEOA 2FQ1A 2MVVA 2LPKA 2VSQA 2L9FA 4BPHA 2GDYA 2L22A 5EJDA 2KORA 4H2WC 5HVCA 2LMLA 1HY8A 2KR5A 1T8KA 2MY5A 4DG9A 1HQBA 3EJEA 1DNYA 2K0YA 2ROQA 2LIUA 2N98A 2M5RA 2FQ2A 2JU1A 1OR5A 1L0HA 2L0QA 1VKUA 2N6YA 2AFDA 2KWLA 2MF4A 4CA3A 2FHSC 2KW2A 2X2BA 2DNWA 2EHTA 2XZ1C 2LIWA 2K94A 2KOSA 2FADA 2KOOA 2KG8A 2JGPA 3CE7A 2XZ0D 3RG2A 3NY7B 2FVEA 3EJBA 3GZLA 2N50A 3GZMA 4R0MA 2FACA 2K93A 2K92A 1KLPA 4PXHB 2FQ0A 2KGDA 2KOQA 2KOPA 4BPFA 2PNGA 2AVAA 2JQ4A 3EJDA 2KGAA 2MD9A 3LMOA 1L0IA 4H2YC 2N5HA 5KP6B 4HKGA 2LKIA 2KG9A 2K0XA 2KG6A 2LTEA 2GDWA 2FVFA 2CNRA 1ACPA 4BPGA 4H2XC 5HV8A 1NQ4A 4MRTC 2GDXA 2LOLA 1X3OA 2CGQA 2FVAA 2AFEA 2CG5B 1AF8A 2AF8A 2N5IA 2KGEA 4IZ6A 2JU2A 2L4BA 2QNWA 5KP7B 2CQ8A 2MR7A 2KGCA 1F80D 4PWVB
chains in the Genus database with same CATH superfamily
1A8OA 2PENA 1DV5A 2N6ZA 2EHSA 1ZMBA 5KP8B 1M90Q 2LPKA 2VLPA 2VSQA 4H2WC 5HVCA 1RO2A 3CCRP 1W2BO 1VQ5P 1YHQP 3EJEA 1DNYA 2K0YA 2GZGA 3DS3A 1M6EX 3CCEP 2M5RA 4WYMA 1NJIQ 2N6YA 2XV6A 1K9MQ 4CA3A 3U43A 5EW5E 3CCVP 2PEQA 2X2BA 2LIWA 1IMQA 3VRLC 2M8NA 3RG2A 4GR6A 3GZMA 4R0MA 1GXHA 2FACA 2K93A 2K92A 2GZEA 3M1MA 1VQKP 2GZJA 1AYIA 2PNGA 3B4QA 3CCJP 2KGAA 4QKOA 3DTJA 3H47A 4HKGA 2KG9A 5DCKA 2VLOA 2LTEA 5BS2A 2GDWA 1FR2A 1Z6MA 4BPGA 4H2XC 3CMAP 1VQ6P 1AUMA 1VHNA 2GDXA 2LOLA 1X3OA 2KODA 2JBGA 3G1IA 1YIJP 3NTEA 2QNWA 2ONTA 3G1GA 1F80D 1N8RQ 2LL8A 4XRQA 2MR8A 2M8PA 2GYKA 2QA4P 2M8LA 2LMLA 2KR5A 2MY5A 1E6JP 3I55P 2ROQA 1Q81Q 3DS2A 3CCSP 2FQ2A 1OR5A 1L0HA 1K73Q 3WBHA 2AFDA 2FHSC 2BHVA 2Z45A 1D1DA 1KC8Q 3H0DA 2PEIA 2PEJA 4XFXA 1KD1Q 2JGPA 2XZ0D 3NY7B 2K5XA 2FVEA 3GZLA 5HGMA 2CWOA 1JJ2O 1VQPP 2FQ0A 3CC7P 2KOPA 4BPFA 5JPAA 1QRJA 4XFZA 1BXIA 5HGOA 2K0DX 4U0DA 1Q82Q 4UHPB 2EG5A 1NQ4A 4PH1A 2WPTA 4XFYA 4MRTC 4COPA 1M6NA 2PEMA 2FVAA 2GZFA 2JAZA 2GZIA 4M0IA 2AFEA 3CMEP 2AF8A 3G21A 2VLNA 4IZ6A 2JU2A 1S72P 2CQ8A 1K8AQ 4PWVB 1CEIA 2DGYA 1GXGA 1RO0A 1YJWP 2FQ1A 1RNIA 3I56P 2L9FA 4BPHA 5HGNA 4PH0A 3CXCO 1HY8A 4DG9A 2LIUA 3Q20A 5F2KA 1VQMP 2N98A 4F37A 2JU1A 3P05A 1ZNVA 2NO8A 1VKUA 1VQ7P 2Z44A 2JO0A 3G29A 2ERHA 4U0FA 2EHTA 2XZ1C 1YI2P 1YJNP 3G26A 2KOSA 2FADA 2XXMA 2OTLP 3DS4A 3EJBA 3H4EA 1VQNP 3GJNA 4PXHB 3RG6C 2OTJP 2AVAA 2E1MA 4U0BA 3CCQP 1QVFO 2EFJA 3CPWO 1YITP 2PEKA 3HYBA 3DS1A 3LRYA 3DPHA 1L0IA 4H2YC 2OARA 5KP6B 2LKIA 1QVGO 3G28A 2KG6A 1KQSO 2FVFA 2CNRA 1ACPA 5HV8A 5BS1A 2XT1A 2PY8A 1GPJA 7CEIA 2CGQA 2L6EA 1AF8A 2EIAA 3G6EP 2N5IA 2KGEA 2JYLA 5KP7B 1EMVA 1M74A 3HZQA 1YJ9P 1IMPA 1VQ9P 2KGCA 3G4SP 2K2QA 2MVUA 3B5IA 2FAEA 5CZDB 4NEOA 3CC2P 3CD6P 1IUQA 2MVVA 4XROA 3E2DA 5F2NA 2GDYA 2L22A 2LF4A 5EJDA 2KORA 1Q7YQ 1A43A 1T8KA 3G71P 1HQBA 3MGEA 1VQ8P 5F2OA 2PEOA 2L0QA 1VQ4P 2KWLA 2JYGA 2MF4A 2VLQA 4U0EA 2KW2A 2DNWA 1VQLP 1VQOP 2K94A 2KOOA 2KG8A 3CE7A 4COCA 4U0CA 2N50A 3CCLP 1K30A 2Z46A 1KLPA 2KOQA 2KGDA 1UJZA 3CC4P 2JB0A 2JQ4A 3EJDA 3G0VA 3CCUP 2MD9A 3LMOA 4GR2A 2QEXP 5HGLA 2BUOA 4IPYA 2N5HA 1UNKA 2K0XA 1BAJA 1M1KQ 3OW2O 1Q86Q 5I4TG 1EIAA 1E0HA 3DS0A 3DS5A 4U0AA 4QNBA 2CG5B 1MZ8A 3GKLC 2P9XA 1EOQA 3CCMP 2L4BA 2MR7A
chains in the Genus database with same CATH topology
2LL8A 2K2QA 1DV5A 2N6ZA 2MVUA 2FAEA 2EHSA 2MR8A 5CZDB 5KP8B 4NEOA 2FQ1A 2MVVA 2LPKA 2VSQA 2L9FA 4BPHA 2GDYA 2L22A 5EJDA 2KORA 4H2WC 5HVCA 2LMLA 1HY8A 2KR5A 1T8KA 2MY5A 4DG9A 1HQBA 3EJEA 1DNYA 2K0YA 2ROQA 2LIUA 2N98A 2M5RA 2FQ2A 2JU1A 1OR5A 1L0HA 2L0QA 1VKUA 2N6YA 2AFDA 2KWLA 2MF4A 4CA3A 2FHSC 2KW2A 2X2BA 2DNWA 2EHTA 2XZ1C 2LIWA 2K94A 2KOSA 2FADA 2KOOA 2KG8A 2JGPA 3CE7A 2XZ0D 3RG2A 3NY7B 2FVEA 3EJBA 3GZLA 2N50A 3GZMA 4R0MA 2FACA 2K93A 2K92A 1KLPA 4PXHB 2FQ0A 2KGDA 2KOQA 2KOPA 4BPFA 2PNGA 2AVAA 2JQ4A 3EJDA 2KGAA 2MD9A 3LMOA 1L0IA 4H2YC 2N5HA 5KP6B 4HKGA 2LKIA 2KG9A 2K0XA 2KG6A 2LTEA 2GDWA 2FVFA 2CNRA 1ACPA 4BPGA 4H2XC 5HV8A 1NQ4A 4MRTC 2GDXA 2LOLA 1X3OA 2CGQA 2FVAA 2AFEA 2CG5B 1AF8A 2AF8A 2N5IA 2KGEA 4IZ6A 2JU2A 2L4BA 2QNWA 5KP7B 2CQ8A 2MR7A 2KGCA 1F80D 4PWVB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LL8 A;  2K2Q A;  1DV5 A;  2N6Z A;  2MVU A;  2FAE A;  2EHS A;  2MR8 A;  5CZD B;  5KP8 B;  4NEO A;  2FQ1 A;  2MVV A;  2LPK A;  2VSQ A;  2L9F A;  4BPH A;  2GDY A;  2L22 A;  5EJD A;  2KOR A;  4H2W C;  5HVC A;  2LML A;  1HY8 A;  2KR5 A;  1T8K A;  2MY5 A;  4DG9 A;  1HQB A;  3EJE A;  1DNY A;  2K0Y A;  2ROQ A;  2LIU A;  2N98 A;  2M5R A;  2FQ2 A;  2JU1 A;  1OR5 A;  1L0H A;  2L0Q A;  1VKU A;  2N6Y A;  2AFD A;  2KWL A;  2MF4 A;  4CA3 A;  2FHS C;  2KW2 A;  2X2B A;  2DNW A;  2EHT A;  2XZ1 C;  2LIW A;  2K94 A;  2KOS A;  2FAD A;  2KOO A;  2KG8 A;  2JGP A;  3CE7 A;  2XZ0 D;  3RG2 A;  3NY7 B;  2FVE A;  3EJB A;  3GZL A;  2N50 A;  3GZM A;  4R0M A;  2FAC A;  2K93 A;  2K92 A;  1KLP A;  4PXH B;  2FQ0 A;  2KGD A;  2KOQ A;  2KOP A;  4BPF A;  2PNG A;  2AVA A;  2JQ4 A;  3EJD A;  2KGA A;  2MD9 A;  3LMO A;  1L0I A;  4H2Y C;  2N5H A;  5KP6 B;  4HKG A;  2LKI A;  2KG9 A;  2K0X A;  2KG6 A;  2LTE A;  2GDW A;  2FVF A;  2CNR A;  1ACP A;  4BPG A;  4H2X C;  5HV8 A;  1NQ4 A;  4MRT C;  2GDX A;  2LOL A;  1X3O A;  2CGQ A;  2FVA A;  2AFE A;  2CG5 B;  1AF8 A;  2AF8 A;  2N5I A;  2KGE A;  4IZ6 A;  2JU2 A;  2L4B A;  2QNW A;  5KP7 B;  2CQ8 A;  2MR7 A;  2KGC A;  1F80 D;  4PWV B; 
#chains in the Genus database with same CATH topology
 1A8O A;  2PEN A;  1DV5 A;  2N6Z A;  2EHS A;  1ZMB A;  5KP8 B;  1M90 Q;  2LPK A;  2VLP A;  2VSQ A;  4H2W C;  5HVC A;  1RO2 A;  3CCR P;  1W2B O;  1VQ5 P;  1YHQ P;  3EJE A;  1DNY A;  2K0Y A;  2GZG A;  3DS3 A;  1M6E X;  3CCE P;  2M5R A;  4WYM A;  1NJI Q;  2N6Y A;  2XV6 A;  1K9M Q;  4CA3 A;  3U43 A;  5EW5 E;  3CCV P;  2PEQ A;  2X2B A;  2LIW A;  1IMQ A;  3VRL C;  2M8N A;  3RG2 A;  4GR6 A;  3GZM A;  4R0M A;  1GXH A;  2FAC A;  2K93 A;  2K92 A;  2GZE A;  3M1M A;  1VQK P;  2GZJ A;  1AYI A;  2PNG A;  3B4Q A;  3CCJ P;  2KGA A;  4QKO A;  3DTJ A;  3H47 A;  4HKG A;  2KG9 A;  5DCK A;  2VLO A;  2LTE A;  5BS2 A;  2GDW A;  1FR2 A;  1Z6M A;  4BPG A;  4H2X C;  3CMA P;  1VQ6 P;  1AUM A;  1VHN A;  2GDX A;  2LOL A;  1X3O A;  2KOD A;  2JBG A;  3G1I A;  1YIJ P;  3NTE A;  2QNW A;  2ONT A;  3G1G A;  1F80 D;  1N8R Q;  2LL8 A;  4XRQ A;  2MR8 A;  2M8P A;  2GYK A;  2QA4 P;  2M8L A;  2LML A;  2KR5 A;  2MY5 A;  1E6J P;  3I55 P;  2ROQ A;  1Q81 Q;  3DS2 A;  3CCS P;  2FQ2 A;  1OR5 A;  1L0H A;  1K73 Q;  3WBH A;  2AFD A;  2FHS C;  2BHV A;  2Z45 A;  1D1D A;  1KC8 Q;  3H0D A;  2PEI A;  2PEJ A;  4XFX A;  1KD1 Q;  2JGP A;  2XZ0 D;  3NY7 B;  2K5X A;  2FVE A;  3GZL A;  5HGM A;  2CWO A;  1JJ2 O;  1VQP P;  2FQ0 A;  3CC7 P;  2KOP A;  4BPF A;  5JPA A;  1QRJ A;  4XFZ A;  1BXI A;  5HGO A;  2K0D X;  4U0D A;  1Q82 Q;  4UHP B;  2EG5 A;  1NQ4 A;  4PH1 A;  2WPT A;  4XFY A;  4MRT C;  4COP A;  1M6N A;  2PEM A;  2FVA A;  2GZF A;  2JAZ A;  2GZI A;  4M0I A;  2AFE A;  3CME P;  2AF8 A;  3G21 A;  2VLN A;  4IZ6 A;  2JU2 A;  1S72 P;  2CQ8 A;  1K8A Q;  4PWV B;  1CEI A;  2DGY A;  1GXG A;  1RO0 A;  1YJW P;  2FQ1 A;  1RNI A;  3I56 P;  2L9F A;  4BPH A;  5HGN A;  4PH0 A;  3CXC O;  1HY8 A;  4DG9 A;  2LIU A;  3Q20 A;  5F2K A;  1VQM P;  2N98 A;  4F37 A;  2JU1 A;  3P05 A;  1ZNV A;  2NO8 A;  1VKU A;  1VQ7 P;  2Z44 A;  2JO0 A;  3G29 A;  2ERH A;  4U0F A;  2EHT A;  2XZ1 C;  1YI2 P;  1YJN P;  3G26 A;  2KOS A;  2FAD A;  2XXM A;  2OTL P;  3DS4 A;  3EJB A;  3H4E A;  1VQN P;  3GJN A;  4PXH B;  3RG6 C;  2OTJ P;  2AVA A;  2E1M A;  4U0B A;  3CCQ P;  1QVF O;  2EFJ A;  3CPW O;  1YIT P;  2PEK A;  3HYB A;  3DS1 A;  3LRY A;  3DPH A;  1L0I A;  4H2Y C;  2OAR A;  5KP6 B;  2LKI A;  1QVG O;  3G28 A;  2KG6 A;  1KQS O;  2FVF A;  2CNR A;  1ACP A;  5HV8 A;  5BS1 A;  2XT1 A;  2PY8 A;  1GPJ A;  7CEI A;  2CGQ A;  2L6E A;  1AF8 A;  2EIA A;  3G6E P;  2N5I A;  2KGE A;  2JYL A;  5KP7 B;  1EMV A;  1M74 A;  3HZQ A;  1YJ9 P;  1IMP A;  1VQ9 P;  2KGC A;  3G4S P;  2K2Q A;  2MVU A;  3B5I A;  2FAE A;  5CZD B;  4NEO A;  3CC2 P;  3CD6 P;  1IUQ A;  2MVV A;  4XRO A;  3E2D A;  5F2N A;  2GDY A;  2L22 A;  2LF4 A;  5EJD A;  2KOR A;  1Q7Y Q;  1A43 A;  1T8K A;  3G71 P;  1HQB A;  3MGE A;  1VQ8 P;  5F2O A;  2PEO A;  2L0Q A;  1VQ4 P;  2KWL A;  2JYG A;  2MF4 A;  2VLQ A;  4U0E A;  2KW2 A;  2DNW A;  1VQL P;  1VQO P;  2K94 A;  2KOO A;  2KG8 A;  3CE7 A;  4COC A;  4U0C A;  2N50 A;  3CCL P;  1K30 A;  2Z46 A;  1KLP A;  2KOQ A;  2KGD A;  1UJZ A;  3CC4 P;  2JB0 A;  2JQ4 A;  3EJD A;  3G0V A;  3CCU P;  2MD9 A;  3LMO A;  4GR2 A;  2QEX P;  5HGL A;  2BUO A;  4IPY A;  2N5H A;  1UNK A;  2K0X A;  1BAJ A;  1M1K Q;  3OW2 O;  1Q86 Q;  5I4T G;  1EIA A;  1E0H A;  3DS0 A;  3DS5 A;  4U0A A;  4QNB A;  2CG5 B;  1MZ8 A;  3GKL C;  2P9X A;  1EOQ A;  3CCM P;  2L4B A;  2MR7 A; 
#chains in the Genus database with same CATH homology
 2LL8 A;  2K2Q A;  1DV5 A;  2N6Z A;  2MVU A;  2FAE A;  2EHS A;  2MR8 A;  5CZD B;  5KP8 B;  4NEO A;  2FQ1 A;  2MVV A;  2LPK A;  2VSQ A;  2L9F A;  4BPH A;  2GDY A;  2L22 A;  5EJD A;  2KOR A;  4H2W C;  5HVC A;  2LML A;  1HY8 A;  2KR5 A;  1T8K A;  2MY5 A;  4DG9 A;  1HQB A;  3EJE A;  1DNY A;  2K0Y A;  2ROQ A;  2LIU A;  2N98 A;  2M5R A;  2FQ2 A;  2JU1 A;  1OR5 A;  1L0H A;  2L0Q A;  1VKU A;  2N6Y A;  2AFD A;  2KWL A;  2MF4 A;  4CA3 A;  2FHS C;  2KW2 A;  2X2B A;  2DNW A;  2EHT A;  2XZ1 C;  2LIW A;  2K94 A;  2KOS A;  2FAD A;  2KOO A;  2KG8 A;  2JGP A;  3CE7 A;  2XZ0 D;  3RG2 A;  3NY7 B;  2FVE A;  3EJB A;  3GZL A;  2N50 A;  3GZM A;  4R0M A;  2FAC A;  2K93 A;  2K92 A;  1KLP A;  4PXH B;  2FQ0 A;  2KGD A;  2KOQ A;  2KOP A;  4BPF A;  2PNG A;  2AVA A;  2JQ4 A;  3EJD A;  2KGA A;  2MD9 A;  3LMO A;  1L0I A;  4H2Y C;  2N5H A;  5KP6 B;  4HKG A;  2LKI A;  2KG9 A;  2K0X A;  2KG6 A;  2LTE A;  2GDW A;  2FVF A;  2CNR A;  1ACP A;  4BPG A;  4H2X C;  5HV8 A;  1NQ4 A;  4MRT C;  2GDX A;  2LOL A;  1X3O A;  2CGQ A;  2FVA A;  2AFE A;  2CG5 B;  1AF8 A;  2AF8 A;  2N5I A;  2KGE A;  4IZ6 A;  2JU2 A;  2L4B A;  2QNW A;  5KP7 B;  2CQ8 A;  2MR7 A;  2KGC A;  1F80 D;  4PWV B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...