2K2QA

Complex structure of the external thioesterase of the surfactin-synthetase with a carrier domain
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
82
structure length
82
Chain Sequence
MGVTEAQYVAPTNAVESKLAEIWERVLGVSGIGILDNFFQIGGHSLKAMAVAAQVHREYQVELPLKVLFAQPTIKALAQYVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the selectivity of the external thioesterase of the surfactin synthetase.
pubmed doi rcsb
source organism Brevibacillus parabrevis
molecule tags Ligase/hydrolase
molecule keywords Tyrocidine synthetase 3 (Tyrocidine synthetase III)
total genus 14
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2008-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2k2qA00
4PXHB 1F80D 1DNYA 2KOPA 2AF8A 2L9FA 5HV8A 2KGDA 1OR5A 2X2BA 4DG9A 3NY7B 3CE7A 1AF8A 2FQ1A 4R0MA 2FVAA 2GDXA 2K92A 2LPKA 2CNRA 2FHSC 2LIUA 5KP8B 1L0HA 2KOOA 2MF4A 2JU2A 4H2YC 2K94A 2L4BA 4H2XC 5KP7B 2MVVA 2N50A 3EJEA 1ACPA 2FQ2A 2MD9A 4BPFA 3EJDA 3GZMA 2JGPA 2MVUA 2LTEA 2CQ8A 2AVAA 2AFEA 2KG9A 2FVFA 4PWVB 2MR8A 2LIWA 2N6ZA 4NEOA 5EJDA 2KR5A 2L22A 2AFDA 2N5HA 2LKIA 2N6YA 2FAEA 4IZ6A 2EHSA 1HY8A 2KG6A 2CGQA 2ROQA 2MR7A 2K93A 1KLPA 2KGCA 1L0IA 2FQ0A 2FVEA 2GDYA 1DV5A 3EJBA 3RG2A 2FADA 2PNGA 2M5RA 2VSQA 2N98A 1X3OA 2EHTA 4BPGA 2GDWA 2LMLA 2JU1A 2K2QA 2KORA 2KOQA 4H2WC 5KP6B 5HVCA 2KW2A 2K0YA 5CZDB 2L0QA 4BPHA 2FACA 2QNWA 2KOSA 2CG5B 2DNWA 1HQBA 4CA3A 2KWLA 2JQ4A 2KGEA 4HKGA 2XZ0D 2K0XA 4MRTC 1NQ4A 1T8KA 1VKUA 2KGAA 3GZLA 2KG8A 2LL8A 2LOLA 2MY5A 2XZ1C 3LMOA 2N5IA
chains in the Genus database with same CATH superfamily
4PXHB 2PENA 5HV8A 3DS5A 3CE7A 1AF8A 3CC7P 2PEQA 2FVAA 1NJIQ 2LPKA 5F2OA 1K30A 1M6NA 2QA4P 1K9MQ 1MZ8A 4H2YC 2L4BA 4H2XC 2VLNA 3EJEA 2Z45A 3CC2P 4PH1A 2L6EA 1A8OA 1KC8Q 3E2DA 1RO2A 2K5XA 2MVUA 1YITP 1YJWP 2JYGA 2PEKA 2NO8A 2N6ZA 1EIAA 3H0DA 1E0HA 2L22A 2N5HA 4IZ6A 3G26A 3CCUP 4U0AA 4F37A 3CMAP 1AYIA 3DS2A 1DV5A 2FADA 3G6EP 2VSQA 1BAJA 1X3OA 2GDWA 3RG6C 3CC4P 3HZQA 3WBHA 3Q20A 2M8PA 5KP6B 1VHNA 2GZIA 2KW2A 2PY8A 5HGMA 1KQSO 2GZGA 2Z46A 4GR6A 2K0YA 4XRQA 3GKLC 2E1MA 4U0EA 4BPHA 4M0IA 2KOSA 4CA3A 3CCVP 4GR2A 3G4SP 1W2BO 1NQ4A 1T8KA 2GZEA 1VKUA 3GZLA 1BXIA 3DS4A 3VRLC 2KODA 3CCMP 2VLPA 3I55P 2AF8A 4DG9A 3NY7B 4XFZA 2GDXA 3DS1A 2CNRA 2LIUA 5KP8B 3CCJP 5BS1A 3CD6P 3MGEA 1VQNP 2MVVA 2N50A 1Q7YQ 4XFXA 1IUQA 2FQ2A 4BPFA 2PEIA 1CEIA 2EIAA 2CQ8A 3G0VA 1M6EX 4PWVB 2KG9A 2FVFA 1YIJP 3DPHA 5EJDA 2KR5A 1QVFO 1D1DA 2JYLA 2M8LA 2CGQA 2ROQA 2K93A 1KLPA 1L0IA 5BS2A 3EJBA 3CCLP 3RG2A 1JJ2O 1GXGA 2PNGA 2M5RA 2OARA 1YI2P 1IMQA 2LMLA 2KORA 2KOQA 1VQMP 4H2WC 5I4TG 3CXCO 2P9XA 2EG5A 3CCRP 1N8RQ 2VLOA 1HQBA 2PEOA 1VQ9P 1Q81Q 2KGEA 4HKGA 2XZ0D 2K0XA 4MRTC 2BHVA 3G28A 2LL8A 2LOLA 2MY5A 3LMOA 1QRJA 2GYKA 2N5IA 1DNYA 5DCKA 4U0DA 3LRYA 2KGDA 4XROA 1VQ5P 2OTLP 1YJNP 4R0MA 1AUMA 3P05A 2K92A 2FHSC 2JBGA 1VQ8P 2KOOA 1VQ6P 2K94A 2OTJP 1Z6MA 2DGYA 4PH0A 2XT1A 4U0FA 1E6JP 3EJDA 3U43A 5F2NA 1A43A 4XFYA 3G71P 1RNIA 2LTEA 7CEIA 2AFEA 3CPWO 1VQLP 2BUOA 1VQPP 2MR8A 4WYMA 2LIWA 4NEOA 4U0BA 3I56P 2FAEA 2EHSA 3CMEP 4QNBA 1EMVA 1VQOP 3HYBA 1IMPA 2LF4A 2XXMA 5EW5E 2N98A 3OW2O 2ONTA 3M1MA 3DTJA 2JU1A 1K73Q 1M90Q 5HVCA 1RO0A 3NTEA 4UHPB 5CZDB 1QVGO 1YHQP 4COCA 2FACA 1VQ7P 2CG5B 2KWLA 5HGNA 3G21A 1KD1Q 2JQ4A 2EFJA 3H47A 1YJ9P 2KGAA 3G1IA 1VQ4P 2GZFA 1EOQA 1ZNVA 1ZMBA 1F80D 2KOPA 2L9FA 1OR5A 2X2BA 2FQ1A 4IPYA 3CCEP 1L0HA 5F2KA 2MF4A 3B5IA 1S72P 2JU2A 2PEMA 5KP7B 3CCSP 3DS3A 1ACPA 2ERHA 2MD9A 1GXHA 2M8NA 3GZMA 2JGPA 4COPA 3DS0A 4QKOA 2Z44A 2AVAA 1Q86Q 2PEJA 2AFDA 2LKIA 2N6YA 3G29A 1HY8A 2KG6A 2K0DX 2MR7A 2KGCA 2WPTA 1FR2A 2FQ0A 1UNKA 2FVEA 2GDYA 2GZJA 2VLQA 4U0CA 1Q82Q 2EHTA 4BPGA 5HGLA 2K2QA 1M1KQ 1M74A 2JAZA 2JO0A 3B4QA 3H4EA 2CWOA 3G1GA 5JPAA 2L0QA 1K8AQ 1VQKP 2QNWA 2XV6A 3CCQP 1GPJA 2DNWA 1UJZA 3GJNA 2QEXP 2KG8A 2XZ1C 2JB0A 5HGOA
chains in the Genus database with same CATH topology
4PXHB 1F80D 1DNYA 2KOPA 2AF8A 2L9FA 5HV8A 2KGDA 1OR5A 2X2BA 4DG9A 3NY7B 3CE7A 1AF8A 2FQ1A 4R0MA 2FVAA 2GDXA 2K92A 2LPKA 2CNRA 2FHSC 2LIUA 5KP8B 1L0HA 2KOOA 2MF4A 2JU2A 4H2YC 2K94A 2L4BA 4H2XC 5KP7B 2MVVA 2N50A 3EJEA 1ACPA 2FQ2A 2MD9A 4BPFA 3EJDA 3GZMA 2JGPA 2MVUA 2LTEA 2CQ8A 2AVAA 2AFEA 2KG9A 2FVFA 4PWVB 2MR8A 2LIWA 2N6ZA 4NEOA 5EJDA 2KR5A 2L22A 2AFDA 2N5HA 2LKIA 2N6YA 2FAEA 4IZ6A 2EHSA 1HY8A 2KG6A 2CGQA 2ROQA 2MR7A 2K93A 1KLPA 2KGCA 1L0IA 2FQ0A 2FVEA 2GDYA 1DV5A 3EJBA 3RG2A 2FADA 2PNGA 2M5RA 2VSQA 2N98A 1X3OA 2EHTA 4BPGA 2GDWA 2LMLA 2JU1A 2K2QA 2KORA 2KOQA 4H2WC 5KP6B 5HVCA 2KW2A 2K0YA 5CZDB 2L0QA 4BPHA 2FACA 2QNWA 2KOSA 2CG5B 2DNWA 1HQBA 4CA3A 2KWLA 2JQ4A 2KGEA 4HKGA 2XZ0D 2K0XA 4MRTC 1NQ4A 1T8KA 1VKUA 2KGAA 3GZLA 2KG8A 2LL8A 2LOLA 2MY5A 2XZ1C 3LMOA 2N5IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PXH B;  1F80 D;  1DNY A;  2KOP A;  2AF8 A;  2L9F A;  5HV8 A;  2KGD A;  1OR5 A;  2X2B A;  4DG9 A;  3NY7 B;  3CE7 A;  1AF8 A;  2FQ1 A;  4R0M A;  2FVA A;  2GDX A;  2K92 A;  2LPK A;  2CNR A;  2FHS C;  2LIU A;  5KP8 B;  1L0H A;  2KOO A;  2MF4 A;  2JU2 A;  4H2Y C;  2K94 A;  2L4B A;  4H2X C;  5KP7 B;  2MVV A;  2N50 A;  3EJE A;  1ACP A;  2FQ2 A;  2MD9 A;  4BPF A;  3EJD A;  3GZM A;  2JGP A;  2MVU A;  2LTE A;  2CQ8 A;  2AVA A;  2AFE A;  2KG9 A;  2FVF A;  4PWV B;  2MR8 A;  2LIW A;  2N6Z A;  4NEO A;  5EJD A;  2KR5 A;  2L22 A;  2AFD A;  2N5H A;  2LKI A;  2N6Y A;  2FAE A;  4IZ6 A;  2EHS A;  1HY8 A;  2KG6 A;  2CGQ A;  2ROQ A;  2MR7 A;  2K93 A;  1KLP A;  2KGC A;  1L0I A;  2FQ0 A;  2FVE A;  2GDY A;  1DV5 A;  3EJB A;  3RG2 A;  2FAD A;  2PNG A;  2M5R A;  2VSQ A;  2N98 A;  1X3O A;  2EHT A;  4BPG A;  2GDW A;  2LML A;  2JU1 A;  2K2Q A;  2KOR A;  2KOQ A;  4H2W C;  5KP6 B;  5HVC A;  2KW2 A;  2K0Y A;  5CZD B;  2L0Q A;  4BPH A;  2FAC A;  2QNW A;  2KOS A;  2CG5 B;  2DNW A;  1HQB A;  4CA3 A;  2KWL A;  2JQ4 A;  2KGE A;  4HKG A;  2XZ0 D;  2K0X A;  4MRT C;  1NQ4 A;  1T8K A;  1VKU A;  2KGA A;  3GZL A;  2KG8 A;  2LL8 A;  2LOL A;  2MY5 A;  2XZ1 C;  3LMO A;  2N5I A; 
#chains in the Genus database with same CATH topology
 4PXH B;  2PEN A;  5HV8 A;  3DS5 A;  3CE7 A;  1AF8 A;  3CC7 P;  2PEQ A;  2FVA A;  1NJI Q;  2LPK A;  5F2O A;  1K30 A;  1M6N A;  2QA4 P;  1K9M Q;  1MZ8 A;  4H2Y C;  2L4B A;  4H2X C;  2VLN A;  3EJE A;  2Z45 A;  3CC2 P;  4PH1 A;  2L6E A;  1A8O A;  1KC8 Q;  3E2D A;  1RO2 A;  2K5X A;  2MVU A;  1YIT P;  1YJW P;  2JYG A;  2PEK A;  2NO8 A;  2N6Z A;  1EIA A;  3H0D A;  1E0H A;  2L22 A;  2N5H A;  4IZ6 A;  3G26 A;  3CCU P;  4U0A A;  4F37 A;  3CMA P;  1AYI A;  3DS2 A;  1DV5 A;  2FAD A;  3G6E P;  2VSQ A;  1BAJ A;  1X3O A;  2GDW A;  3RG6 C;  3CC4 P;  3HZQ A;  3WBH A;  3Q20 A;  2M8P A;  5KP6 B;  1VHN A;  2GZI A;  2KW2 A;  2PY8 A;  5HGM A;  1KQS O;  2GZG A;  2Z46 A;  4GR6 A;  2K0Y A;  4XRQ A;  3GKL C;  2E1M A;  4U0E A;  4BPH A;  4M0I A;  2KOS A;  4CA3 A;  3CCV P;  4GR2 A;  3G4S P;  1W2B O;  1NQ4 A;  1T8K A;  2GZE A;  1VKU A;  3GZL A;  1BXI A;  3DS4 A;  3VRL C;  2KOD A;  3CCM P;  2VLP A;  3I55 P;  2AF8 A;  4DG9 A;  3NY7 B;  4XFZ A;  2GDX A;  3DS1 A;  2CNR A;  2LIU A;  5KP8 B;  3CCJ P;  5BS1 A;  3CD6 P;  3MGE A;  1VQN P;  2MVV A;  2N50 A;  1Q7Y Q;  4XFX A;  1IUQ A;  2FQ2 A;  4BPF A;  2PEI A;  1CEI A;  2EIA A;  2CQ8 A;  3G0V A;  1M6E X;  4PWV B;  2KG9 A;  2FVF A;  1YIJ P;  3DPH A;  5EJD A;  2KR5 A;  1QVF O;  1D1D A;  2JYL A;  2M8L A;  2CGQ A;  2ROQ A;  2K93 A;  1KLP A;  1L0I A;  5BS2 A;  3EJB A;  3CCL P;  3RG2 A;  1JJ2 O;  1GXG A;  2PNG A;  2M5R A;  2OAR A;  1YI2 P;  1IMQ A;  2LML A;  2KOR A;  2KOQ A;  1VQM P;  4H2W C;  5I4T G;  3CXC O;  2P9X A;  2EG5 A;  3CCR P;  1N8R Q;  2VLO A;  1HQB A;  2PEO A;  1VQ9 P;  1Q81 Q;  2KGE A;  4HKG A;  2XZ0 D;  2K0X A;  4MRT C;  2BHV A;  3G28 A;  2LL8 A;  2LOL A;  2MY5 A;  3LMO A;  1QRJ A;  2GYK A;  2N5I A;  1DNY A;  5DCK A;  4U0D A;  3LRY A;  2KGD A;  4XRO A;  1VQ5 P;  2OTL P;  1YJN P;  4R0M A;  1AUM A;  3P05 A;  2K92 A;  2FHS C;  2JBG A;  1VQ8 P;  2KOO A;  1VQ6 P;  2K94 A;  2OTJ P;  1Z6M A;  2DGY A;  4PH0 A;  2XT1 A;  4U0F A;  1E6J P;  3EJD A;  3U43 A;  5F2N A;  1A43 A;  4XFY A;  3G71 P;  1RNI A;  2LTE A;  7CEI A;  2AFE A;  3CPW O;  1VQL P;  2BUO A;  1VQP P;  2MR8 A;  4WYM A;  2LIW A;  4NEO A;  4U0B A;  3I56 P;  2FAE A;  2EHS A;  3CME P;  4QNB A;  1EMV A;  1VQO P;  3HYB A;  1IMP A;  2LF4 A;  2XXM A;  5EW5 E;  2N98 A;  3OW2 O;  2ONT A;  3M1M A;  3DTJ A;  2JU1 A;  1K73 Q;  1M90 Q;  5HVC A;  1RO0 A;  3NTE A;  4UHP B;  5CZD B;  1QVG O;  1YHQ P;  4COC A;  2FAC A;  1VQ7 P;  2CG5 B;  2KWL A;  5HGN A;  3G21 A;  1KD1 Q;  2JQ4 A;  2EFJ A;  3H47 A;  1YJ9 P;  2KGA A;  3G1I A;  1VQ4 P;  2GZF A;  1EOQ A;  1ZNV A;  1ZMB A;  1F80 D;  2KOP A;  2L9F A;  1OR5 A;  2X2B A;  2FQ1 A;  4IPY A;  3CCE P;  1L0H A;  5F2K A;  2MF4 A;  3B5I A;  1S72 P;  2JU2 A;  2PEM A;  5KP7 B;  3CCS P;  3DS3 A;  1ACP A;  2ERH A;  2MD9 A;  1GXH A;  2M8N A;  3GZM A;  2JGP A;  4COP A;  3DS0 A;  4QKO A;  2Z44 A;  2AVA A;  1Q86 Q;  2PEJ A;  2AFD A;  2LKI A;  2N6Y A;  3G29 A;  1HY8 A;  2KG6 A;  2K0D X;  2MR7 A;  2KGC A;  2WPT A;  1FR2 A;  2FQ0 A;  1UNK A;  2FVE A;  2GDY A;  2GZJ A;  2VLQ A;  4U0C A;  1Q82 Q;  2EHT A;  4BPG A;  5HGL A;  2K2Q A;  1M1K Q;  1M74 A;  2JAZ A;  2JO0 A;  3B4Q A;  3H4E A;  2CWO A;  3G1G A;  5JPA A;  2L0Q A;  1K8A Q;  1VQK P;  2QNW A;  2XV6 A;  3CCQ P;  1GPJ A;  2DNW A;  1UJZ A;  3GJN A;  2QEX P;  2KG8 A;  2XZ1 C;  2JB0 A;  5HGO A; 
#chains in the Genus database with same CATH homology
 4PXH B;  1F80 D;  1DNY A;  2KOP A;  2AF8 A;  2L9F A;  5HV8 A;  2KGD A;  1OR5 A;  2X2B A;  4DG9 A;  3NY7 B;  3CE7 A;  1AF8 A;  2FQ1 A;  4R0M A;  2FVA A;  2GDX A;  2K92 A;  2LPK A;  2CNR A;  2FHS C;  2LIU A;  5KP8 B;  1L0H A;  2KOO A;  2MF4 A;  2JU2 A;  4H2Y C;  2K94 A;  2L4B A;  4H2X C;  5KP7 B;  2MVV A;  2N50 A;  3EJE A;  1ACP A;  2FQ2 A;  2MD9 A;  4BPF A;  3EJD A;  3GZM A;  2JGP A;  2MVU A;  2LTE A;  2CQ8 A;  2AVA A;  2AFE A;  2KG9 A;  2FVF A;  4PWV B;  2MR8 A;  2LIW A;  2N6Z A;  4NEO A;  5EJD A;  2KR5 A;  2L22 A;  2AFD A;  2N5H A;  2LKI A;  2N6Y A;  2FAE A;  4IZ6 A;  2EHS A;  1HY8 A;  2KG6 A;  2CGQ A;  2ROQ A;  2MR7 A;  2K93 A;  1KLP A;  2KGC A;  1L0I A;  2FQ0 A;  2FVE A;  2GDY A;  1DV5 A;  3EJB A;  3RG2 A;  2FAD A;  2PNG A;  2M5R A;  2VSQ A;  2N98 A;  1X3O A;  2EHT A;  4BPG A;  2GDW A;  2LML A;  2JU1 A;  2K2Q A;  2KOR A;  2KOQ A;  4H2W C;  5KP6 B;  5HVC A;  2KW2 A;  2K0Y A;  5CZD B;  2L0Q A;  4BPH A;  2FAC A;  2QNW A;  2KOS A;  2CG5 B;  2DNW A;  1HQB A;  4CA3 A;  2KWL A;  2JQ4 A;  2KGE A;  4HKG A;  2XZ0 D;  2K0X A;  4MRT C;  1NQ4 A;  1T8K A;  1VKU A;  2KGA A;  3GZL A;  2KG8 A;  2LL8 A;  2LOL A;  2MY5 A;  2XZ1 C;  3LMO A;  2N5I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...