2K2QA

Complex structure of the external thioesterase of the surfactin-synthetase with a carrier domain
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
82
structure length
82
Chain Sequence
b'MGVTEAQYVAPTNAVESKLAEIWERVLGVSGIGILDNFFQIGGHSLKAMAVAAQVHREYQVELPLKVLFAQPTIKALAQYVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tyrocidine synthetase 3 (Tyrocidine synthetase III)
publication title Structural basis for the selectivity of the external thioesterase of the surfactin synthetase.
pubmed doi rcsb
source organism Brevibacillus parabrevis
molecule tags Ligase/hydrolase
total genus 14
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2008-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2k2qA00
2FQ1A 2AFDA 2XZ0D 2L0QA 2PNGA 1HQBA 2CQ8A 2FACA 2KOOA 1X3OA 2EHSA 2MR8A 5HVCA 1T8KA 2LIUA 2FADA 2GDYA 2XZ1C 2CG5B 2N5IA 2KGCA 2K93A 4IZ6A 4DG9A 4BPHA 4H2WC 1KLPA 2MR7A 2LMLA 1AF8A 2LIWA 1DNYA 2N6YA 2K92A 2KGDA 2JU2A 2KOPA 2KORA 2K94A 3NY7B 2ROQA 2MY5A 2FQ2A 1L0IA 2AVAA 2LOLA 2KGAA 1L0HA 2N50A 2GDXA 2MVVA 2KG8A 4PXHB 2FHSC 5HV8A 2CNRA 2X2BA 3EJBA 2EHTA 2KR5A 2L22A 2FAEA 2CGQA 2JQ4A 4BPFA 2LTEA 2L9FA 2MD9A 4CA3A 2FVAA 2AFEA 5KP6B 1HY8A 5CZDB 2KGEA 2FVEA 4PWVB 1OR5A 3CE7A 2JGPA 4NEOA 3EJEA 2K2QA 2KG6A 2AF8A 2KOQA 2N98A 2DNWA 2FVFA 4HKGA 2K0XA 3EJDA 1NQ4A 3RG2A 2GDWA 3GZLA 1VKUA 1F80D 3GZMA 2L4BA 4BPGA 2KG9A 2N6ZA 2QNWA 2LL8A 2LKIA 4R0MA 2KW2A 2N5HA 5EJDA 2MF4A 2M5RA 5KP8B 2FQ0A 2KWLA 4MRTC 1DV5A 2MVUA 2K0YA 2VSQA 2JU1A 5KP7B 3LMOA 2LPKA 1ACPA 2KOSA 4H2XC 4H2YC
chains in the Genus database with same CATH superfamily
3DS2A 1BXIA 2XZ0D 1HQBA 5F2KA 2FACA 2KOOA 2P9XA 1BAJA 5BS1A 1X3OA 2MR8A 5HVCA 1VQ9P 2XZ1C 3DS5A 2CG5B 1MZ8A 3B4QA 3G21A 4XFXA 1VQ4P 4BPHA 4H2WC 1CEIA 1KC8Q 2LIWA 2GZJA 2N6YA 3RG6C 4COCA 2K92A 2KOPA 1EMVA 2VLOA 4U0EA 2VLPA 2ROQA 2PEKA 2LOLA 2AVAA 2N50A 3G6EP 4PXHB 2VLQA 5HV8A 1VQMP 3EJBA 2QA4P 3CCMP 1VQ7P 3MGEA 4PH0A 2NO8A 2AFEA 4U0AA 2BUOA 1NJIQ 4IPYA 3CPWO 3CCRP 4GR2A 4NEOA 2DNWA 4F37A 2PEMA 3DS3A 2M8PA 1AUMA 1A43A 1VKUA 3G28A 2KG9A 2QNWA 2PEOA 3I56P 1QRJA 2LF4A 4R0MA 1VQKP 2PEQA 2QEXP 1M6NA 2MVUA 1A8OA 1K9MQ 1KD1Q 2VSQA 5KP7B 1IMQA 3G71P 3CMEP 2GZEA 1ACPA 2KOSA 4H2YC 2L0QA 2GZFA 2CQ8A 2GZIA 1RO0A 1VQ5P 2N5IA 2K93A 1ZMBA 4U0DA 1GXHA 1QVGO 2JYGA 3CD6P 2MR7A 2EIAA 3CCSP 2WPTA 3CCQP 1YJWP 1RO2A 1E0HA 2L6EA 1S72P 1YIJP 1M6EX 3CC4P 2DGYA 2KORA 3G1IA 3CCVP 1K73Q 1L0IA 2VLNA 1L0HA 2FHSC 2PY8A 2KODA 2KR5A 4CA3A 3LRYA 1Z6MA 1K8AQ 3GKLC 1UNKA 5CZDB 2M8NA 2Z44A 3CE7A 4XRQA 2JGPA 3EJEA 2K2QA 3CMAP 1W2BO 1VQ8P 2FVFA 2EG5A 2K0XA 3EJDA 2ONTA 2ERHA 2GDWA 3G1GA 1E6JP 1AYIA 2JAZA 4BPGA 5I4TG 1FR2A 1GXGA 3DPHA 3G0VA 2Z46A 2N5HA 5EJDA 2FQ0A 1DV5A 3G26A 4GR6A 3G29A 1EOQA 3CCEP 4H2XC 7CEIA 4QNBA 3NTEA 2JBGA 4QKOA 2PENA 3H4EA 1Q82Q 1JJ2O 1M1KQ 2GDYA 2FADA 2LIUA 3VRLC 1YI2P 2KGCA 4IZ6A 1M74A 4DG9A 1EIAA 2OTLP 2LMLA 3CXCO 1AF8A 1DNYA 2KGDA 2JU2A 1UJZA 1RNIA 1YJNP 1N8RQ 3CC7P 2K94A 3NY7B 3CCLP 3CCUP 2FQ2A 5BS2A 2KGAA 2GDXA 3M1MA 2MVVA 3E2DA 2CNRA 1GPJA 5HGLA 2X2BA 1IMPA 3GJNA 2EHTA 2FAEA 2CGQA 2JQ4A 4BPFA 2LTEA 2MD9A 5EW5E 3DS0A 4U0CA 2XXMA 3H47A 1HY8A 2FVEA 5F2OA 1VHNA 2KG6A 5F2NA 2KOQA 3DS4A 3DTJA 4WYMA 3CCJP 1YITP 3RG2A 2XT1A 3G4SP 3GZLA 2K0DX 2XV6A 3GZMA 2L4BA 2N6ZA 1VQOP 2LKIA 3Q20A 2MF4A 3B5IA 4MRTC 2CWOA 4M0IA 1Q86Q 2K0YA 2E1MA 2JU1A 3LMOA 3P05A 2LPKA 2FQ1A 2AFDA 5HGMA 1M90Q 2PNGA 4PH1A 1Q81Q 2EHSA 2JB0A 1T8KA 1YHQP 1KLPA 1VQ6P 3HYBA 2GZGA 2K5XA 4U0BA 5DCKA 3H0DA 5JPAA 2MY5A 1YJ9P 2M8LA 2PEJA 3HZQA 3WBHA 2KG8A 4XROA 2Z45A 1IUQA 2L22A 2L9FA 2FVAA 5KP6B 2EFJA 1KQSO 2KGEA 3DS1A 4PWVB 1OR5A 2JO0A 4XFZA 1QVFO 5HGOA 2AF8A 2N98A 4HKGA 1K30A 3CC2P 2PEIA 1NQ4A 1ZNVA 1F80D 4COPA 4U0FA 4XFYA 2LL8A 2OTJP 2OARA 1VQNP 1VQLP 5HGNA 1D1DA 2KW2A 2M5RA 3OW2O 5KP8B 2KWLA 2JYLA 4UHPB 1VQPP 1Q7YQ 3I55P 2BHVA 3U43A 2GYKA
chains in the Genus database with same CATH topology
2FQ1A 2AFDA 2XZ0D 2L0QA 2PNGA 1HQBA 2CQ8A 2FACA 2KOOA 1X3OA 2EHSA 2MR8A 5HVCA 1T8KA 2LIUA 2FADA 2GDYA 2XZ1C 2CG5B 2N5IA 2KGCA 2K93A 4IZ6A 4DG9A 4BPHA 4H2WC 1KLPA 2MR7A 2LMLA 1AF8A 2LIWA 1DNYA 2N6YA 2K92A 2KGDA 2JU2A 2KOPA 2KORA 2K94A 3NY7B 2ROQA 2MY5A 2FQ2A 1L0IA 2AVAA 2LOLA 2KGAA 1L0HA 2N50A 2GDXA 2MVVA 2KG8A 4PXHB 2FHSC 5HV8A 2CNRA 2X2BA 3EJBA 2EHTA 2KR5A 2L22A 2FAEA 2CGQA 2JQ4A 4BPFA 2LTEA 2L9FA 2MD9A 4CA3A 2FVAA 2AFEA 5KP6B 1HY8A 5CZDB 2KGEA 2FVEA 4PWVB 1OR5A 3CE7A 2JGPA 4NEOA 3EJEA 2K2QA 2KG6A 2AF8A 2KOQA 2N98A 2DNWA 2FVFA 4HKGA 2K0XA 3EJDA 1NQ4A 3RG2A 2GDWA 3GZLA 1VKUA 1F80D 3GZMA 2L4BA 4BPGA 2KG9A 2N6ZA 2QNWA 2LL8A 2LKIA 4R0MA 2KW2A 2N5HA 5EJDA 2MF4A 2M5RA 5KP8B 2FQ0A 2KWLA 4MRTC 1DV5A 2MVUA 2K0YA 2VSQA 2JU1A 5KP7B 3LMOA 2LPKA 1ACPA 2KOSA 4H2XC 4H2YC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FQ1 A;  2AFD A;  2XZ0 D;  2L0Q A;  2PNG A;  1HQB A;  2CQ8 A;  2FAC A;  2KOO A;  1X3O A;  2EHS A;  2MR8 A;  5HVC A;  1T8K A;  2LIU A;  2FAD A;  2GDY A;  2XZ1 C;  2CG5 B;  2N5I A;  2KGC A;  2K93 A;  4IZ6 A;  4DG9 A;  4BPH A;  4H2W C;  1KLP A;  2MR7 A;  2LML A;  1AF8 A;  2LIW A;  1DNY A;  2N6Y A;  2K92 A;  2KGD A;  2JU2 A;  2KOP A;  2KOR A;  2K94 A;  3NY7 B;  2ROQ A;  2MY5 A;  2FQ2 A;  1L0I A;  2AVA A;  2LOL A;  2KGA A;  1L0H A;  2N50 A;  2GDX A;  2MVV A;  2KG8 A;  4PXH B;  2FHS C;  5HV8 A;  2CNR A;  2X2B A;  3EJB A;  2EHT A;  2KR5 A;  2L22 A;  2FAE A;  2CGQ A;  2JQ4 A;  4BPF A;  2LTE A;  2L9F A;  2MD9 A;  4CA3 A;  2FVA A;  2AFE A;  5KP6 B;  1HY8 A;  5CZD B;  2KGE A;  2FVE A;  4PWV B;  1OR5 A;  3CE7 A;  2JGP A;  4NEO A;  3EJE A;  2K2Q A;  2KG6 A;  2AF8 A;  2KOQ A;  2N98 A;  2DNW A;  2FVF A;  4HKG A;  2K0X A;  3EJD A;  1NQ4 A;  3RG2 A;  2GDW A;  3GZL A;  1VKU A;  1F80 D;  3GZM A;  2L4B A;  4BPG A;  2KG9 A;  2N6Z A;  2QNW A;  2LL8 A;  2LKI A;  4R0M A;  2KW2 A;  2N5H A;  5EJD A;  2MF4 A;  2M5R A;  5KP8 B;  2FQ0 A;  2KWL A;  4MRT C;  1DV5 A;  2MVU A;  2K0Y A;  2VSQ A;  2JU1 A;  5KP7 B;  3LMO A;  2LPK A;  1ACP A;  2KOS A;  4H2X C;  4H2Y C; 
#chains in the Genus database with same CATH topology
 3DS2 A;  1BXI A;  2XZ0 D;  1HQB A;  5F2K A;  2FAC A;  2KOO A;  2P9X A;  1BAJ A;  5BS1 A;  1X3O A;  2MR8 A;  5HVC A;  1VQ9 P;  2XZ1 C;  3DS5 A;  2CG5 B;  1MZ8 A;  3B4Q A;  3G21 A;  4XFX A;  1VQ4 P;  4BPH A;  4H2W C;  1CEI A;  1KC8 Q;  2LIW A;  2GZJ A;  2N6Y A;  3RG6 C;  4COC A;  2K92 A;  2KOP A;  1EMV A;  2VLO A;  4U0E A;  2VLP A;  2ROQ A;  2PEK A;  2LOL A;  2AVA A;  2N50 A;  3G6E P;  4PXH B;  2VLQ A;  5HV8 A;  1VQM P;  3EJB A;  2QA4 P;  3CCM P;  1VQ7 P;  3MGE A;  4PH0 A;  2NO8 A;  2AFE A;  4U0A A;  2BUO A;  1NJI Q;  4IPY A;  3CPW O;  3CCR P;  4GR2 A;  4NEO A;  2DNW A;  4F37 A;  2PEM A;  3DS3 A;  2M8P A;  1AUM A;  1A43 A;  1VKU A;  3G28 A;  2KG9 A;  2QNW A;  2PEO A;  3I56 P;  1QRJ A;  2LF4 A;  4R0M A;  1VQK P;  2PEQ A;  2QEX P;  1M6N A;  2MVU A;  1A8O A;  1K9M Q;  1KD1 Q;  2VSQ A;  5KP7 B;  1IMQ A;  3G71 P;  3CME P;  2GZE A;  1ACP A;  2KOS A;  4H2Y C;  2L0Q A;  2GZF A;  2CQ8 A;  2GZI A;  1RO0 A;  1VQ5 P;  2N5I A;  2K93 A;  1ZMB A;  4U0D A;  1GXH A;  1QVG O;  2JYG A;  3CD6 P;  2MR7 A;  2EIA A;  3CCS P;  2WPT A;  3CCQ P;  1YJW P;  1RO2 A;  1E0H A;  2L6E A;  1S72 P;  1YIJ P;  1M6E X;  3CC4 P;  2DGY A;  2KOR A;  3G1I A;  3CCV P;  1K73 Q;  1L0I A;  2VLN A;  1L0H A;  2FHS C;  2PY8 A;  2KOD A;  2KR5 A;  4CA3 A;  3LRY A;  1Z6M A;  1K8A Q;  3GKL C;  1UNK A;  5CZD B;  2M8N A;  2Z44 A;  3CE7 A;  4XRQ A;  2JGP A;  3EJE A;  2K2Q A;  3CMA P;  1W2B O;  1VQ8 P;  2FVF A;  2EG5 A;  2K0X A;  3EJD A;  2ONT A;  2ERH A;  2GDW A;  3G1G A;  1E6J P;  1AYI A;  2JAZ A;  4BPG A;  5I4T G;  1FR2 A;  1GXG A;  3DPH A;  3G0V A;  2Z46 A;  2N5H A;  5EJD A;  2FQ0 A;  1DV5 A;  3G26 A;  4GR6 A;  3G29 A;  1EOQ A;  3CCE P;  4H2X C;  7CEI A;  4QNB A;  3NTE A;  2JBG A;  4QKO A;  2PEN A;  3H4E A;  1Q82 Q;  1JJ2 O;  1M1K Q;  2GDY A;  2FAD A;  2LIU A;  3VRL C;  1YI2 P;  2KGC A;  4IZ6 A;  1M74 A;  4DG9 A;  1EIA A;  2OTL P;  2LML A;  3CXC O;  1AF8 A;  1DNY A;  2KGD A;  2JU2 A;  1UJZ A;  1RNI A;  1YJN P;  1N8R Q;  3CC7 P;  2K94 A;  3NY7 B;  3CCL P;  3CCU P;  2FQ2 A;  5BS2 A;  2KGA A;  2GDX A;  3M1M A;  2MVV A;  3E2D A;  2CNR A;  1GPJ A;  5HGL A;  2X2B A;  1IMP A;  3GJN A;  2EHT A;  2FAE A;  2CGQ A;  2JQ4 A;  4BPF A;  2LTE A;  2MD9 A;  5EW5 E;  3DS0 A;  4U0C A;  2XXM A;  3H47 A;  1HY8 A;  2FVE A;  5F2O A;  1VHN A;  2KG6 A;  5F2N A;  2KOQ A;  3DS4 A;  3DTJ A;  4WYM A;  3CCJ P;  1YIT P;  3RG2 A;  2XT1 A;  3G4S P;  3GZL A;  2K0D X;  2XV6 A;  3GZM A;  2L4B A;  2N6Z A;  1VQO P;  2LKI A;  3Q20 A;  2MF4 A;  3B5I A;  4MRT C;  2CWO A;  4M0I A;  1Q86 Q;  2K0Y A;  2E1M A;  2JU1 A;  3LMO A;  3P05 A;  2LPK A;  2FQ1 A;  2AFD A;  5HGM A;  1M90 Q;  2PNG A;  4PH1 A;  1Q81 Q;  2EHS A;  2JB0 A;  1T8K A;  1YHQ P;  1KLP A;  1VQ6 P;  3HYB A;  2GZG A;  2K5X A;  4U0B A;  5DCK A;  3H0D A;  5JPA A;  2MY5 A;  1YJ9 P;  2M8L A;  2PEJ A;  3HZQ A;  3WBH A;  2KG8 A;  4XRO A;  2Z45 A;  1IUQ A;  2L22 A;  2L9F A;  2FVA A;  5KP6 B;  2EFJ A;  1KQS O;  2KGE A;  3DS1 A;  4PWV B;  1OR5 A;  2JO0 A;  4XFZ A;  1QVF O;  5HGO A;  2AF8 A;  2N98 A;  4HKG A;  1K30 A;  3CC2 P;  2PEI A;  1NQ4 A;  1ZNV A;  1F80 D;  4COP A;  4U0F A;  4XFY A;  2LL8 A;  2OTJ P;  2OAR A;  1VQN P;  1VQL P;  5HGN A;  1D1D A;  2KW2 A;  2M5R A;  3OW2 O;  5KP8 B;  2KWL A;  2JYL A;  4UHP B;  1VQP P;  1Q7Y Q;  3I55 P;  2BHV A;  3U43 A;  2GYK A; 
#chains in the Genus database with same CATH homology
 2FQ1 A;  2AFD A;  2XZ0 D;  2L0Q A;  2PNG A;  1HQB A;  2CQ8 A;  2FAC A;  2KOO A;  1X3O A;  2EHS A;  2MR8 A;  5HVC A;  1T8K A;  2LIU A;  2FAD A;  2GDY A;  2XZ1 C;  2CG5 B;  2N5I A;  2KGC A;  2K93 A;  4IZ6 A;  4DG9 A;  4BPH A;  4H2W C;  1KLP A;  2MR7 A;  2LML A;  1AF8 A;  2LIW A;  1DNY A;  2N6Y A;  2K92 A;  2KGD A;  2JU2 A;  2KOP A;  2KOR A;  2K94 A;  3NY7 B;  2ROQ A;  2MY5 A;  2FQ2 A;  1L0I A;  2AVA A;  2LOL A;  2KGA A;  1L0H A;  2N50 A;  2GDX A;  2MVV A;  2KG8 A;  4PXH B;  2FHS C;  5HV8 A;  2CNR A;  2X2B A;  3EJB A;  2EHT A;  2KR5 A;  2L22 A;  2FAE A;  2CGQ A;  2JQ4 A;  4BPF A;  2LTE A;  2L9F A;  2MD9 A;  4CA3 A;  2FVA A;  2AFE A;  5KP6 B;  1HY8 A;  5CZD B;  2KGE A;  2FVE A;  4PWV B;  1OR5 A;  3CE7 A;  2JGP A;  4NEO A;  3EJE A;  2K2Q A;  2KG6 A;  2AF8 A;  2KOQ A;  2N98 A;  2DNW A;  2FVF A;  4HKG A;  2K0X A;  3EJD A;  1NQ4 A;  3RG2 A;  2GDW A;  3GZL A;  1VKU A;  1F80 D;  3GZM A;  2L4B A;  4BPG A;  2KG9 A;  2N6Z A;  2QNW A;  2LL8 A;  2LKI A;  4R0M A;  2KW2 A;  2N5H A;  5EJD A;  2MF4 A;  2M5R A;  5KP8 B;  2FQ0 A;  2KWL A;  4MRT C;  1DV5 A;  2MVU A;  2K0Y A;  2VSQ A;  2JU1 A;  5KP7 B;  3LMO A;  2LPK A;  1ACP A;  2KOS A;  4H2X C;  4H2Y C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...