2K2QA

Complex structure of the external thioesterase of the surfactin-synthetase with a carrier domain
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
82
structure length
82
Chain Sequence
MGVTEAQYVAPTNAVESKLAEIWERVLGVSGIGILDNFFQIGGHSLKAMAVAAQVHREYQVELPLKVLFAQPTIKALAQYVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tyrocidine synthetase 3 (Tyrocidine synthetase III)
publication title Structural basis for the selectivity of the external thioesterase of the surfactin synthetase.
pubmed doi rcsb
source organism Brevibacillus parabrevis
molecule tags Ligase/hydrolase
total genus 14
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2008-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2k2qA00
2KGAA 2KG8A 2K92A 4DG9A 2FAEA 1NQ4A 2CGQA 2KOSA 2XZ0D 2FQ2A 2CQ8A 1DNYA 2K2QA 3NY7B 2KW2A 3EJEA 2L9FA 2K93A 2KORA 2KR5A 2FQ1A 2KGEA 4NEOA 2AVAA 1HY8A 3CE7A 2JQ4A 2PNGA 2QNWA 2CG5B 1X3OA 2LPKA 1ACPA 3LMOA 2GDXA 2XZ1C 2N6YA 2JU2A 2MVVA 2FACA 1AF8A 2MF4A 2N50A 4BPHA 2N5IA 2N5HA 2EHSA 2GDYA 4PXHB 2L0QA 2FVAA 4HKGA 2DNWA 2ROQA 4R0MA 5EJDA 1HQBA 2MR7A 2K0YA 2LTEA 2L22A 2L4BA 2FVEA 2FVFA 2MY5A 2KOPA 2MVUA 1OR5A 2N6ZA 3EJBA 2KG9A 4MRTC 2JU1A 2K94A 4BPGA 1L0IA 1F80D 3RG2A 1DV5A 2LKIA 2FADA 1T8KA 2KWLA 4H2YC 2KGCA 4PWVB 2KGDA 2KG6A 2KOOA 1L0HA 5CZDB 2FHSC 3EJDA 2LIWA 2K0XA 2AFDA 2N98A 5KP6B 4BPFA 2GDWA 2LOLA 2EHTA 2LIUA 2AF8A 2MR8A 2VSQA 4H2WC 4H2XC 1KLPA 5HV8A 1VKUA 4CA3A 2KOQA 2CNRA 5KP7B 2FQ0A 2JGPA 5HVCA 2MD9A 4IZ6A 2X2BA 2LMLA 2AFEA 3GZLA 2M5RA 2LL8A 5KP8B 3GZMA
chains in the Genus database with same CATH superfamily
2KGAA 1UNKA 1AUMA 2CGQA 2KOSA 2XZ0D 2PY8A 2PEQA 2BHVA 2M8NA 4XFZA 2KW2A 4F37A 2GZGA 3DS5A 2FQ1A 4NEOA 1HY8A 2AVAA 3CE7A 2PNGA 2BUOA 1X3OA 1ACPA 2PEIA 2Z46A 3H4EA 2N6YA 2MVVA 1MZ8A 2N50A 4BPHA 3CC2P 2N5IA 1VQ8P 2GDYA 4HKGA 2QA4P 1QVFO 4R0MA 1ZNVA 3GJNA 3U43A 1K73Q 5EJDA 1Q82Q 5HGNA 2K0YA 1Q7YQ 3H47A 2MY5A 5F2OA 3CCLP 3CCVP 1FR2A 4XFYA 1YI2P 1QVGO 4XROA 2JU1A 3G28A 3CCRP 1KD1Q 3RG2A 1K8AQ 1AYIA 3G29A 2KGDA 2OTLP 2KOOA 5CZDB 5DCKA 1BAJA 3CMAP 4PH0A 2XV6A 1VQNP 5BS2A 2K0XA 3G6EP 3DS2A 4U0AA 2EHTA 3CXCO 2MR8A 2VLNA 4H2WC 2VLPA 4CA3A 2KOQA 7CEIA 2MD9A 3CCSP 4IZ6A 1VQPP 2PEOA 3DTJA 4XRQA 2FQ2A 2L6EA 1VHNA 2CQ8A 2OARA 3NY7B 1UJZA 2KR5A 4U0EA 2M8PA 2PEMA 3DS4A 2KODA 1KQSO 2QNWA 4UHPB 2CG5B 3HZQA 3LMOA 2GDXA 2XZ1C 2JU2A 1AF8A 1IMPA 2N5HA 1N8RQ 4PXHB 4U0CA 1YJWP 2L0QA 2FVAA 2DNWA 3CC4P 1VQ6P 2PENA 2EFJA 2K0DX 1YITP 3G0VA 3G21A 2LTEA 2L22A 2L4BA 1GXHA 1M6EX 2Z44A 2MVUA 2GZFA 1OR5A 2N6ZA 4COCA 1QRJA 4MRTC 4PH1A 2VLQA 1YJNP 5F2NA 1F80D 5BS1A 2LKIA 1YHQP 4H2YC 5F2KA 4PWVB 3CCUP 2KG6A 1VQ5P 2M8LA 3OW2O 2OTJP 1A43A 1L0HA 1JJ2O 3EJDA 3WBHA 2LIWA 2JAZA 1M6NA 3DS0A 2E1MA 4BPFA 3CCJP 1W2BO 2LIUA 1RO0A 1ZMBA 2VSQA 1IMQA 2WPTA 3CCQP 5HVCA 2JGPA 1S72P 1Q81Q 1M1KQ 3G1GA 2LF4A 1VQ7P 3GZMA 3DS1A 4DG9A 2FAEA 4GR2A 2JB0A 2EG5A 2K2QA 3EJEA 1VQLP 2ERHA 3RG6C 5I4TG 3CCEP 1K30A 2FACA 1KC8Q 1GXGA 2EHSA 2JO0A 3GKLC 2ROQA 5HGMA 1EIAA 1HQBA 2PEJA 1E6JP 3CPWO 2MR7A 2K5XA 4IPYA 2JBGA 4WYMA 3NTEA 3G26A 1VQOP 3CMEP 2KOPA 1E0HA 2EIAA 2XT1A 2KG9A 2PEKA 4BPGA 2ONTA 1L0IA 1DV5A 1YJ9P 2KWLA 2JYLA 2FHSC 2QEXP 2P9XA 2GDWA 2LOLA 2AF8A 2XXMA 5HV8A 2CNRA 2FQ0A 2X2BA 1A8OA 3G71P 2AFEA 3MGEA 2M5RA 5KP8B 1RO2A 5EW5E 2KG8A 2K92A 4XFXA 4QNBA 1NQ4A 1IUQA 2NO8A 1DNYA 2L9FA 3G4SP 2K93A 2KORA 1CEIA 3LRYA 2KGEA 1VQKP 2DGYA 4U0FA 2JQ4A 3I55P 2GYKA 2LPKA 1YIJP 3CC7P 3HYBA 1VQ9P 2MF4A 3E2DA 5HGLA 1NJIQ 1EOQA 4U0DA 3M1MA 1BXIA 3I56P 1RNIA 1VQMP 2Z45A 1EMVA 2FVEA 2FVFA 3DPHA 2CWOA 3CCMP 3VRLC 3DS3A 1Q86Q 1K9MQ 1D1DA 3EJBA 3B4QA 5HGOA 2K94A 3B5IA 2GZIA 1M74A 3CD6P 2FADA 1T8KA 1Z6MA 1VQ4P 2KGCA 3G1IA 2GZJA 4QKOA 1GPJA 4GR6A 2AFDA 2N98A 5KP6B 4U0BA 3H0DA 2GZEA 2JYGA 4H2XC 3Q20A 1KLPA 1M90Q 1VKUA 5KP7B 3P05A 2LMLA 3GZLA 2VLOA 2LL8A 4COPA 5JPAA 4M0IA
chains in the Genus database with same CATH topology
2KGAA 2KG8A 2K92A 4DG9A 2FAEA 1NQ4A 2CGQA 2KOSA 2XZ0D 2FQ2A 2CQ8A 1DNYA 2K2QA 3NY7B 2KW2A 3EJEA 2L9FA 2K93A 2KORA 2KR5A 2FQ1A 2KGEA 4NEOA 2AVAA 1HY8A 3CE7A 2JQ4A 2PNGA 2QNWA 2CG5B 1X3OA 2LPKA 1ACPA 3LMOA 2GDXA 2XZ1C 2N6YA 2JU2A 2MVVA 2FACA 1AF8A 2MF4A 2N50A 4BPHA 2N5IA 2N5HA 2EHSA 2GDYA 4PXHB 2L0QA 2FVAA 4HKGA 2DNWA 2ROQA 4R0MA 5EJDA 1HQBA 2MR7A 2K0YA 2LTEA 2L22A 2L4BA 2FVEA 2FVFA 2MY5A 2KOPA 2MVUA 1OR5A 2N6ZA 3EJBA 2KG9A 4MRTC 2JU1A 2K94A 4BPGA 1L0IA 1F80D 3RG2A 1DV5A 2LKIA 2FADA 1T8KA 2KWLA 4H2YC 2KGCA 4PWVB 2KGDA 2KG6A 2KOOA 1L0HA 5CZDB 2FHSC 3EJDA 2LIWA 2K0XA 2AFDA 2N98A 5KP6B 4BPFA 2GDWA 2LOLA 2EHTA 2LIUA 2AF8A 2MR8A 2VSQA 4H2WC 4H2XC 1KLPA 5HV8A 1VKUA 4CA3A 2KOQA 2CNRA 5KP7B 2FQ0A 2JGPA 5HVCA 2MD9A 4IZ6A 2X2BA 2LMLA 2AFEA 3GZLA 2M5RA 2LL8A 5KP8B 3GZMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KGA A;  2KG8 A;  2K92 A;  4DG9 A;  2FAE A;  1NQ4 A;  2CGQ A;  2KOS A;  2XZ0 D;  2FQ2 A;  2CQ8 A;  1DNY A;  2K2Q A;  3NY7 B;  2KW2 A;  3EJE A;  2L9F A;  2K93 A;  2KOR A;  2KR5 A;  2FQ1 A;  2KGE A;  4NEO A;  2AVA A;  1HY8 A;  3CE7 A;  2JQ4 A;  2PNG A;  2QNW A;  2CG5 B;  1X3O A;  2LPK A;  1ACP A;  3LMO A;  2GDX A;  2XZ1 C;  2N6Y A;  2JU2 A;  2MVV A;  2FAC A;  1AF8 A;  2MF4 A;  2N50 A;  4BPH A;  2N5I A;  2N5H A;  2EHS A;  2GDY A;  4PXH B;  2L0Q A;  2FVA A;  4HKG A;  2DNW A;  2ROQ A;  4R0M A;  5EJD A;  1HQB A;  2MR7 A;  2K0Y A;  2LTE A;  2L22 A;  2L4B A;  2FVE A;  2FVF A;  2MY5 A;  2KOP A;  2MVU A;  1OR5 A;  2N6Z A;  3EJB A;  2KG9 A;  4MRT C;  2JU1 A;  2K94 A;  4BPG A;  1L0I A;  1F80 D;  3RG2 A;  1DV5 A;  2LKI A;  2FAD A;  1T8K A;  2KWL A;  4H2Y C;  2KGC A;  4PWV B;  2KGD A;  2KG6 A;  2KOO A;  1L0H A;  5CZD B;  2FHS C;  3EJD A;  2LIW A;  2K0X A;  2AFD A;  2N98 A;  5KP6 B;  4BPF A;  2GDW A;  2LOL A;  2EHT A;  2LIU A;  2AF8 A;  2MR8 A;  2VSQ A;  4H2W C;  4H2X C;  1KLP A;  5HV8 A;  1VKU A;  4CA3 A;  2KOQ A;  2CNR A;  5KP7 B;  2FQ0 A;  2JGP A;  5HVC A;  2MD9 A;  4IZ6 A;  2X2B A;  2LML A;  2AFE A;  3GZL A;  2M5R A;  2LL8 A;  5KP8 B;  3GZM A; 
#chains in the Genus database with same CATH topology
 2KGA A;  1UNK A;  1AUM A;  2CGQ A;  2KOS A;  2XZ0 D;  2PY8 A;  2PEQ A;  2BHV A;  2M8N A;  4XFZ A;  2KW2 A;  4F37 A;  2GZG A;  3DS5 A;  2FQ1 A;  4NEO A;  1HY8 A;  2AVA A;  3CE7 A;  2PNG A;  2BUO A;  1X3O A;  1ACP A;  2PEI A;  2Z46 A;  3H4E A;  2N6Y A;  2MVV A;  1MZ8 A;  2N50 A;  4BPH A;  3CC2 P;  2N5I A;  1VQ8 P;  2GDY A;  4HKG A;  2QA4 P;  1QVF O;  4R0M A;  1ZNV A;  3GJN A;  3U43 A;  1K73 Q;  5EJD A;  1Q82 Q;  5HGN A;  2K0Y A;  1Q7Y Q;  3H47 A;  2MY5 A;  5F2O A;  3CCL P;  3CCV P;  1FR2 A;  4XFY A;  1YI2 P;  1QVG O;  4XRO A;  2JU1 A;  3G28 A;  3CCR P;  1KD1 Q;  3RG2 A;  1K8A Q;  1AYI A;  3G29 A;  2KGD A;  2OTL P;  2KOO A;  5CZD B;  5DCK A;  1BAJ A;  3CMA P;  4PH0 A;  2XV6 A;  1VQN P;  5BS2 A;  2K0X A;  3G6E P;  3DS2 A;  4U0A A;  2EHT A;  3CXC O;  2MR8 A;  2VLN A;  4H2W C;  2VLP A;  4CA3 A;  2KOQ A;  7CEI A;  2MD9 A;  3CCS P;  4IZ6 A;  1VQP P;  2PEO A;  3DTJ A;  4XRQ A;  2FQ2 A;  2L6E A;  1VHN A;  2CQ8 A;  2OAR A;  3NY7 B;  1UJZ A;  2KR5 A;  4U0E A;  2M8P A;  2PEM A;  3DS4 A;  2KOD A;  1KQS O;  2QNW A;  4UHP B;  2CG5 B;  3HZQ A;  3LMO A;  2GDX A;  2XZ1 C;  2JU2 A;  1AF8 A;  1IMP A;  2N5H A;  1N8R Q;  4PXH B;  4U0C A;  1YJW P;  2L0Q A;  2FVA A;  2DNW A;  3CC4 P;  1VQ6 P;  2PEN A;  2EFJ A;  2K0D X;  1YIT P;  3G0V A;  3G21 A;  2LTE A;  2L22 A;  2L4B A;  1GXH A;  1M6E X;  2Z44 A;  2MVU A;  2GZF A;  1OR5 A;  2N6Z A;  4COC A;  1QRJ A;  4MRT C;  4PH1 A;  2VLQ A;  1YJN P;  5F2N A;  1F80 D;  5BS1 A;  2LKI A;  1YHQ P;  4H2Y C;  5F2K A;  4PWV B;  3CCU P;  2KG6 A;  1VQ5 P;  2M8L A;  3OW2 O;  2OTJ P;  1A43 A;  1L0H A;  1JJ2 O;  3EJD A;  3WBH A;  2LIW A;  2JAZ A;  1M6N A;  3DS0 A;  2E1M A;  4BPF A;  3CCJ P;  1W2B O;  2LIU A;  1RO0 A;  1ZMB A;  2VSQ A;  1IMQ A;  2WPT A;  3CCQ P;  5HVC A;  2JGP A;  1S72 P;  1Q81 Q;  1M1K Q;  3G1G A;  2LF4 A;  1VQ7 P;  3GZM A;  3DS1 A;  4DG9 A;  2FAE A;  4GR2 A;  2JB0 A;  2EG5 A;  2K2Q A;  3EJE A;  1VQL P;  2ERH A;  3RG6 C;  5I4T G;  3CCE P;  1K30 A;  2FAC A;  1KC8 Q;  1GXG A;  2EHS A;  2JO0 A;  3GKL C;  2ROQ A;  5HGM A;  1EIA A;  1HQB A;  2PEJ A;  1E6J P;  3CPW O;  2MR7 A;  2K5X A;  4IPY A;  2JBG A;  4WYM A;  3NTE A;  3G26 A;  1VQO P;  3CME P;  2KOP A;  1E0H A;  2EIA A;  2XT1 A;  2KG9 A;  2PEK A;  4BPG A;  2ONT A;  1L0I A;  1DV5 A;  1YJ9 P;  2KWL A;  2JYL A;  2FHS C;  2QEX P;  2P9X A;  2GDW A;  2LOL A;  2AF8 A;  2XXM A;  5HV8 A;  2CNR A;  2FQ0 A;  2X2B A;  1A8O A;  3G71 P;  2AFE A;  3MGE A;  2M5R A;  5KP8 B;  1RO2 A;  5EW5 E;  2KG8 A;  2K92 A;  4XFX A;  4QNB A;  1NQ4 A;  1IUQ A;  2NO8 A;  1DNY A;  2L9F A;  3G4S P;  2K93 A;  2KOR A;  1CEI A;  3LRY A;  2KGE A;  1VQK P;  2DGY A;  4U0F A;  2JQ4 A;  3I55 P;  2GYK A;  2LPK A;  1YIJ P;  3CC7 P;  3HYB A;  1VQ9 P;  2MF4 A;  3E2D A;  5HGL A;  1NJI Q;  1EOQ A;  4U0D A;  3M1M A;  1BXI A;  3I56 P;  1RNI A;  1VQM P;  2Z45 A;  1EMV A;  2FVE A;  2FVF A;  3DPH A;  2CWO A;  3CCM P;  3VRL C;  3DS3 A;  1Q86 Q;  1K9M Q;  1D1D A;  3EJB A;  3B4Q A;  5HGO A;  2K94 A;  3B5I A;  2GZI A;  1M74 A;  3CD6 P;  2FAD A;  1T8K A;  1Z6M A;  1VQ4 P;  2KGC A;  3G1I A;  2GZJ A;  4QKO A;  1GPJ A;  4GR6 A;  2AFD A;  2N98 A;  5KP6 B;  4U0B A;  3H0D A;  2GZE A;  2JYG A;  4H2X C;  3Q20 A;  1KLP A;  1M90 Q;  1VKU A;  5KP7 B;  3P05 A;  2LML A;  3GZL A;  2VLO A;  2LL8 A;  4COP A;  5JPA A;  4M0I A; 
#chains in the Genus database with same CATH homology
 2KGA A;  2KG8 A;  2K92 A;  4DG9 A;  2FAE A;  1NQ4 A;  2CGQ A;  2KOS A;  2XZ0 D;  2FQ2 A;  2CQ8 A;  1DNY A;  2K2Q A;  3NY7 B;  2KW2 A;  3EJE A;  2L9F A;  2K93 A;  2KOR A;  2KR5 A;  2FQ1 A;  2KGE A;  4NEO A;  2AVA A;  1HY8 A;  3CE7 A;  2JQ4 A;  2PNG A;  2QNW A;  2CG5 B;  1X3O A;  2LPK A;  1ACP A;  3LMO A;  2GDX A;  2XZ1 C;  2N6Y A;  2JU2 A;  2MVV A;  2FAC A;  1AF8 A;  2MF4 A;  2N50 A;  4BPH A;  2N5I A;  2N5H A;  2EHS A;  2GDY A;  4PXH B;  2L0Q A;  2FVA A;  4HKG A;  2DNW A;  2ROQ A;  4R0M A;  5EJD A;  1HQB A;  2MR7 A;  2K0Y A;  2LTE A;  2L22 A;  2L4B A;  2FVE A;  2FVF A;  2MY5 A;  2KOP A;  2MVU A;  1OR5 A;  2N6Z A;  3EJB A;  2KG9 A;  4MRT C;  2JU1 A;  2K94 A;  4BPG A;  1L0I A;  1F80 D;  3RG2 A;  1DV5 A;  2LKI A;  2FAD A;  1T8K A;  2KWL A;  4H2Y C;  2KGC A;  4PWV B;  2KGD A;  2KG6 A;  2KOO A;  1L0H A;  5CZD B;  2FHS C;  3EJD A;  2LIW A;  2K0X A;  2AFD A;  2N98 A;  5KP6 B;  4BPF A;  2GDW A;  2LOL A;  2EHT A;  2LIU A;  2AF8 A;  2MR8 A;  2VSQ A;  4H2W C;  4H2X C;  1KLP A;  5HV8 A;  1VKU A;  4CA3 A;  2KOQ A;  2CNR A;  5KP7 B;  2FQ0 A;  2JGP A;  5HVC A;  2MD9 A;  4IZ6 A;  2X2B A;  2LML A;  2AFE A;  3GZL A;  2M5R A;  2LL8 A;  5KP8 B;  3GZM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...