2K2QA

Complex structure of the external thioesterase of the surfactin-synthetase with a carrier domain
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
82
structure length
82
Chain Sequence
MGVTEAQYVAPTNAVESKLAEIWERVLGVSGIGILDNFFQIGGHSLKAMAVAAQVHREYQVELPLKVLFAQPTIKALAQYVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase/hydrolase
molecule keywords Tyrocidine synthetase 3 (Tyrocidine synthetase III)
publication title Structural basis for the selectivity of the external thioesterase of the surfactin synthetase.
pubmed doi rcsb
source organism Brevibacillus parabrevis
total genus 14
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2008-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2k2qA00
5CZDB 1DV5A 2KR5A 2N5HA 2EHSA 2LPKA 4H2YC 2FVEA 2GDYA 2KGEA 2M5RA 2EHTA 1VKUA 3EJDA 1NQ4A 4MRTC 2GDXA 3NY7B 4CA3A 1KLPA 2FACA 2KW2A 2X2BA 4PXHB 2JU2A 2PNGA 2N6ZA 4NEOA 5HV8A 3RG2A 4H2XC 1HQBA 2LKIA 2XZ0D 2KG8A 2KOOA 2FVFA 2JQ4A 2FHSC 2VSQA 1T8KA 2KGCA 2MVVA 2XZ1C 2AFEA 1X3OA 3GZMA 2AVAA 2FQ0A 5KP6B 2KOQA 2MY5A 4BPFA 2LIUA 3EJEA 5EJDA 2N50A 2MD9A 2MF4A 1L0IA 2CGQA 4DG9A 2K0YA 3GZLA 1AF8A 3EJBA 2CNRA 2LMLA 2N98A 2N5IA 2GDWA 2L4BA 2LTEA 2CG5B 1ACPA 2K92A 2MVUA 2KGAA 2K94A 2KG6A 3LMOA 1L0HA 2FVAA 2FAEA 1DNYA 5HVCA 2JU1A 2JGPA 2LL8A 3CE7A 2LIWA 4PWVB 2MR7A 2K93A 2AF8A 2ROQA 1F80D 2KOSA 2L0QA 4R0MA 2FQ2A 2KWLA 2KOPA 2KG9A 2QNWA 2KGDA 2N6YA 2FQ1A 4HKGA 4IZ6A 2AFDA 5KP8B 2L22A 5KP7B 1OR5A 4BPHA 2K0XA 2LOLA 1HY8A 4BPGA 4H2WC 2KORA 2CQ8A 2MR8A 2DNWA 2FADA 2K2QA 2L9FA
chains in the Genus database with same CATH superfamily
2M8LA 3CC4P 4PH1A 3CCLP 2EHSA 2JO0A 3G6EP 1IMPA 2M5RA 2KGEA 2ONTA 2Z46A 4COPA 3HZQA 3NY7B 1Q86Q 3CCSP 4CA3A 2KW2A 2PNGA 1IUQA 2QA4P 2LF4A 2LKIA 2XZ0D 3DS5A 5HGOA 2FVFA 3NTEA 2MVVA 2CWOA 2JYLA 2PEIA 2L6EA 5I4TG 2KOQA 2Z45A 3G71P 1K8AQ 4BPFA 2LIUA 3EJEA 3I55P 2MD9A 3G28A 1VQ8P 7CEIA 1L0IA 2CGQA 4DG9A 2K0YA 4IPYA 4F37A 3G29A 1UJZA 3GKLC 2CG5B 1ACPA 1GPJA 1RO2A 2KGAA 2Z44A 2K94A 3LMOA 1L0HA 3G21A 2FAEA 4QKOA 2JGPA 3P05A 1M6NA 1YI2P 1YJNP 1BXIA 5HGLA 2ROQA 4XFXA 1Q82Q 3B4QA 2KOSA 2PEKA 1KC8Q 2KWLA 3DS4A 2KOPA 2KGDA 3M1MA 3VRLC 2VLPA 5KP8B 1D1DA 3CD6P 3DTJA 2FADA 2JYGA 2K2QA 2KR5A 3CCQP 3LRYA 2PEQA 2GDYA 2K0DX 1A8OA 2JBGA 2EFJA 2GDXA 1EIAA 2M8NA 4U0BA 1KLPA 2FACA 5HGNA 1Q7YQ 2JU2A 3DS2A 2N6ZA 5HV8A 2GZGA 1AYIA 2JQ4A 2GZIA 1T8KA 2GZJA 2JB0A 1X3OA 4U0FA 4GR6A 5EJDA 2N50A 3H0DA 2MF4A 2DGYA 2NO8A 1ZNVA 3G26A 3GZLA 3EJBA 1IMQA 2OTLP 1RO0A 2GDWA 1MZ8A 2L4BA 2K5XA 2LTEA 1GXGA 2MVUA 2WPTA 5HGMA 2XT1A 2QEXP 5F2NA 1BAJA 3CCVP 2FVAA 1YJWP 4U0DA 3CCJP 1M1KQ 2LL8A 1YHQP 1UNKA 1VQOP 3HYBA 1EMVA 1F80D 2L0QA 1KD1Q 2ERHA 2N6YA 2FQ1A 4IZ6A 1OR5A 4XFZA 2LOLA 4BPGA 2KORA 2CQ8A 3CCMP 2L9FA 1K73Q 1DV5A 2N5HA 2LPKA 1Z6MA 2FVEA 4U0EA 3EJDA 1NQ4A 2KODA 2X2BA 4PXHB 2EIAA 1NJIQ 5F2KA 4H2XC 3OW2O 2KG8A 1K30A 2VSQA 1CEIA 4QNBA 2XZ1C 2AFEA 3GZMA 3DS0A 5BS2A 3CC2P 2AVAA 5KP6B 1VQ5P 1VQ6P 4PH0A 3MGEA 5F2OA 5BS1A 2PEMA 3CC7P 4M0IA 1AF8A 2N98A 1VQPP 5EW5E 3CCUP 2K92A 1RNIA 4COCA 1N8RQ 2JU1A 4XRQA 1S72P 3CE7A 2LIWA 4PWVB 2MR7A 2K93A 4WYMA 1YJ9P 2BHVA 3Q20A 3G4SP 1A43A 1E6JP 2GZFA 2FQ2A 4R0MA 1YIJP 2QNWA 2E1MA 2VLNA 4HKGA 2AFDA 2L22A 3CPWO 5JPAA 4BPHA 1GXHA 2K0XA 1HY8A 2MR8A 2PY8A 1W2BO 3U43A 5CZDB 1YITP 4H2YC 1VQ4P 3CMAP 2EHTA 1VKUA 4U0AA 1QVFO 4MRTC 4XROA 2JAZA 3G1GA 3I56P 2P9XA 4NEOA 1QRJA 1ZMBA 3RG2A 1HQBA 5DCKA 1E0HA 4UHPB 3CCRP 2BUOA 2KOOA 2FHSC 2PEJA 2KGCA 4U0CA 3GJNA 4GR2A 2FQ0A 1VQMP 3B5IA 3CXCO 3G0VA 2MY5A 3H47A 1VQ7P 1EOQA 3CCEP 3DPHA 1M74A 1VQNP 2CNRA 2LMLA 2PENA 2GZEA 2N5IA 3G1IA 2EG5A 2XXMA 1QVGO 3E2DA 2M8PA 2XV6A 1JJ2O 2OTJP 2KG6A 1DNYA 5HVCA 1Q81Q 1KQSO 1K9MQ 2AF8A 1FR2A 4XFYA 2VLOA 3DS3A 3CMEP 2GYKA 3RG6C 1VHNA 1VQKP 2KG9A 2PEOA 3DS1A 3H4EA 5KP7B 1VQ9P 2OARA 1M6EX 3WBHA 4H2WC 1VQLP 2VLQA 1M90Q 2DNWA 1AUMA
chains in the Genus database with same CATH topology
5CZDB 1DV5A 2KR5A 2N5HA 2EHSA 2LPKA 4H2YC 2FVEA 2GDYA 2KGEA 2M5RA 2EHTA 1VKUA 3EJDA 1NQ4A 4MRTC 2GDXA 3NY7B 4CA3A 1KLPA 2FACA 2KW2A 2X2BA 4PXHB 2JU2A 2PNGA 2N6ZA 4NEOA 5HV8A 3RG2A 4H2XC 1HQBA 2LKIA 2XZ0D 2KG8A 2KOOA 2FVFA 2JQ4A 2FHSC 2VSQA 1T8KA 2KGCA 2MVVA 2XZ1C 2AFEA 1X3OA 3GZMA 2AVAA 2FQ0A 5KP6B 2KOQA 2MY5A 4BPFA 2LIUA 3EJEA 5EJDA 2N50A 2MD9A 2MF4A 1L0IA 2CGQA 4DG9A 2K0YA 3GZLA 1AF8A 3EJBA 2CNRA 2LMLA 2N98A 2N5IA 2GDWA 2L4BA 2LTEA 2CG5B 1ACPA 2K92A 2MVUA 2KGAA 2K94A 2KG6A 3LMOA 1L0HA 2FVAA 2FAEA 1DNYA 5HVCA 2JU1A 2JGPA 2LL8A 3CE7A 2LIWA 4PWVB 2MR7A 2K93A 2AF8A 2ROQA 1F80D 2KOSA 2L0QA 4R0MA 2FQ2A 2KWLA 2KOPA 2KG9A 2QNWA 2KGDA 2N6YA 2FQ1A 4HKGA 4IZ6A 2AFDA 5KP8B 2L22A 5KP7B 1OR5A 4BPHA 2K0XA 2LOLA 1HY8A 4BPGA 4H2WC 2KORA 2CQ8A 2MR8A 2DNWA 2FADA 2K2QA 2L9FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CZD B;  1DV5 A;  2KR5 A;  2N5H A;  2EHS A;  2LPK A;  4H2Y C;  2FVE A;  2GDY A;  2KGE A;  2M5R A;  2EHT A;  1VKU A;  3EJD A;  1NQ4 A;  4MRT C;  2GDX A;  3NY7 B;  4CA3 A;  1KLP A;  2FAC A;  2KW2 A;  2X2B A;  4PXH B;  2JU2 A;  2PNG A;  2N6Z A;  4NEO A;  5HV8 A;  3RG2 A;  4H2X C;  1HQB A;  2LKI A;  2XZ0 D;  2KG8 A;  2KOO A;  2FVF A;  2JQ4 A;  2FHS C;  2VSQ A;  1T8K A;  2KGC A;  2MVV A;  2XZ1 C;  2AFE A;  1X3O A;  3GZM A;  2AVA A;  2FQ0 A;  5KP6 B;  2KOQ A;  2MY5 A;  4BPF A;  2LIU A;  3EJE A;  5EJD A;  2N50 A;  2MD9 A;  2MF4 A;  1L0I A;  2CGQ A;  4DG9 A;  2K0Y A;  3GZL A;  1AF8 A;  3EJB A;  2CNR A;  2LML A;  2N98 A;  2N5I A;  2GDW A;  2L4B A;  2LTE A;  2CG5 B;  1ACP A;  2K92 A;  2MVU A;  2KGA A;  2K94 A;  2KG6 A;  3LMO A;  1L0H A;  2FVA A;  2FAE A;  1DNY A;  5HVC A;  2JU1 A;  2JGP A;  2LL8 A;  3CE7 A;  2LIW A;  4PWV B;  2MR7 A;  2K93 A;  2AF8 A;  2ROQ A;  1F80 D;  2KOS A;  2L0Q A;  4R0M A;  2FQ2 A;  2KWL A;  2KOP A;  2KG9 A;  2QNW A;  2KGD A;  2N6Y A;  2FQ1 A;  4HKG A;  4IZ6 A;  2AFD A;  5KP8 B;  2L22 A;  5KP7 B;  1OR5 A;  4BPH A;  2K0X A;  2LOL A;  1HY8 A;  4BPG A;  4H2W C;  2KOR A;  2CQ8 A;  2MR8 A;  2DNW A;  2FAD A;  2K2Q A;  2L9F A; 
#chains in the Genus database with same CATH topology
 2M8L A;  3CC4 P;  4PH1 A;  3CCL P;  2EHS A;  2JO0 A;  3G6E P;  1IMP A;  2M5R A;  2KGE A;  2ONT A;  2Z46 A;  4COP A;  3HZQ A;  3NY7 B;  1Q86 Q;  3CCS P;  4CA3 A;  2KW2 A;  2PNG A;  1IUQ A;  2QA4 P;  2LF4 A;  2LKI A;  2XZ0 D;  3DS5 A;  5HGO A;  2FVF A;  3NTE A;  2MVV A;  2CWO A;  2JYL A;  2PEI A;  2L6E A;  5I4T G;  2KOQ A;  2Z45 A;  3G71 P;  1K8A Q;  4BPF A;  2LIU A;  3EJE A;  3I55 P;  2MD9 A;  3G28 A;  1VQ8 P;  7CEI A;  1L0I A;  2CGQ A;  4DG9 A;  2K0Y A;  4IPY A;  4F37 A;  3G29 A;  1UJZ A;  3GKL C;  2CG5 B;  1ACP A;  1GPJ A;  1RO2 A;  2KGA A;  2Z44 A;  2K94 A;  3LMO A;  1L0H A;  3G21 A;  2FAE A;  4QKO A;  2JGP A;  3P05 A;  1M6N A;  1YI2 P;  1YJN P;  1BXI A;  5HGL A;  2ROQ A;  4XFX A;  1Q82 Q;  3B4Q A;  2KOS A;  2PEK A;  1KC8 Q;  2KWL A;  3DS4 A;  2KOP A;  2KGD A;  3M1M A;  3VRL C;  2VLP A;  5KP8 B;  1D1D A;  3CD6 P;  3DTJ A;  2FAD A;  2JYG A;  2K2Q A;  2KR5 A;  3CCQ P;  3LRY A;  2PEQ A;  2GDY A;  2K0D X;  1A8O A;  2JBG A;  2EFJ A;  2GDX A;  1EIA A;  2M8N A;  4U0B A;  1KLP A;  2FAC A;  5HGN A;  1Q7Y Q;  2JU2 A;  3DS2 A;  2N6Z A;  5HV8 A;  2GZG A;  1AYI A;  2JQ4 A;  2GZI A;  1T8K A;  2GZJ A;  2JB0 A;  1X3O A;  4U0F A;  4GR6 A;  5EJD A;  2N50 A;  3H0D A;  2MF4 A;  2DGY A;  2NO8 A;  1ZNV A;  3G26 A;  3GZL A;  3EJB A;  1IMQ A;  2OTL P;  1RO0 A;  2GDW A;  1MZ8 A;  2L4B A;  2K5X A;  2LTE A;  1GXG A;  2MVU A;  2WPT A;  5HGM A;  2XT1 A;  2QEX P;  5F2N A;  1BAJ A;  3CCV P;  2FVA A;  1YJW P;  4U0D A;  3CCJ P;  1M1K Q;  2LL8 A;  1YHQ P;  1UNK A;  1VQO P;  3HYB A;  1EMV A;  1F80 D;  2L0Q A;  1KD1 Q;  2ERH A;  2N6Y A;  2FQ1 A;  4IZ6 A;  1OR5 A;  4XFZ A;  2LOL A;  4BPG A;  2KOR A;  2CQ8 A;  3CCM P;  2L9F A;  1K73 Q;  1DV5 A;  2N5H A;  2LPK A;  1Z6M A;  2FVE A;  4U0E A;  3EJD A;  1NQ4 A;  2KOD A;  2X2B A;  4PXH B;  2EIA A;  1NJI Q;  5F2K A;  4H2X C;  3OW2 O;  2KG8 A;  1K30 A;  2VSQ A;  1CEI A;  4QNB A;  2XZ1 C;  2AFE A;  3GZM A;  3DS0 A;  5BS2 A;  3CC2 P;  2AVA A;  5KP6 B;  1VQ5 P;  1VQ6 P;  4PH0 A;  3MGE A;  5F2O A;  5BS1 A;  2PEM A;  3CC7 P;  4M0I A;  1AF8 A;  2N98 A;  1VQP P;  5EW5 E;  3CCU P;  2K92 A;  1RNI A;  4COC A;  1N8R Q;  2JU1 A;  4XRQ A;  1S72 P;  3CE7 A;  2LIW A;  4PWV B;  2MR7 A;  2K93 A;  4WYM A;  1YJ9 P;  2BHV A;  3Q20 A;  3G4S P;  1A43 A;  1E6J P;  2GZF A;  2FQ2 A;  4R0M A;  1YIJ P;  2QNW A;  2E1M A;  2VLN A;  4HKG A;  2AFD A;  2L22 A;  3CPW O;  5JPA A;  4BPH A;  1GXH A;  2K0X A;  1HY8 A;  2MR8 A;  2PY8 A;  1W2B O;  3U43 A;  5CZD B;  1YIT P;  4H2Y C;  1VQ4 P;  3CMA P;  2EHT A;  1VKU A;  4U0A A;  1QVF O;  4MRT C;  4XRO A;  2JAZ A;  3G1G A;  3I56 P;  2P9X A;  4NEO A;  1QRJ A;  1ZMB A;  3RG2 A;  1HQB A;  5DCK A;  1E0H A;  4UHP B;  3CCR P;  2BUO A;  2KOO A;  2FHS C;  2PEJ A;  2KGC A;  4U0C A;  3GJN A;  4GR2 A;  2FQ0 A;  1VQM P;  3B5I A;  3CXC O;  3G0V A;  2MY5 A;  3H47 A;  1VQ7 P;  1EOQ A;  3CCE P;  3DPH A;  1M74 A;  1VQN P;  2CNR A;  2LML A;  2PEN A;  2GZE A;  2N5I A;  3G1I A;  2EG5 A;  2XXM A;  1QVG O;  3E2D A;  2M8P A;  2XV6 A;  1JJ2 O;  2OTJ P;  2KG6 A;  1DNY A;  5HVC A;  1Q81 Q;  1KQS O;  1K9M Q;  2AF8 A;  1FR2 A;  4XFY A;  2VLO A;  3DS3 A;  3CME P;  2GYK A;  3RG6 C;  1VHN A;  1VQK P;  2KG9 A;  2PEO A;  3DS1 A;  3H4E A;  5KP7 B;  1VQ9 P;  2OAR A;  1M6E X;  3WBH A;  4H2W C;  1VQL P;  2VLQ A;  1M90 Q;  2DNW A;  1AUM A; 
#chains in the Genus database with same CATH homology
 5CZD B;  1DV5 A;  2KR5 A;  2N5H A;  2EHS A;  2LPK A;  4H2Y C;  2FVE A;  2GDY A;  2KGE A;  2M5R A;  2EHT A;  1VKU A;  3EJD A;  1NQ4 A;  4MRT C;  2GDX A;  3NY7 B;  4CA3 A;  1KLP A;  2FAC A;  2KW2 A;  2X2B A;  4PXH B;  2JU2 A;  2PNG A;  2N6Z A;  4NEO A;  5HV8 A;  3RG2 A;  4H2X C;  1HQB A;  2LKI A;  2XZ0 D;  2KG8 A;  2KOO A;  2FVF A;  2JQ4 A;  2FHS C;  2VSQ A;  1T8K A;  2KGC A;  2MVV A;  2XZ1 C;  2AFE A;  1X3O A;  3GZM A;  2AVA A;  2FQ0 A;  5KP6 B;  2KOQ A;  2MY5 A;  4BPF A;  2LIU A;  3EJE A;  5EJD A;  2N50 A;  2MD9 A;  2MF4 A;  1L0I A;  2CGQ A;  4DG9 A;  2K0Y A;  3GZL A;  1AF8 A;  3EJB A;  2CNR A;  2LML A;  2N98 A;  2N5I A;  2GDW A;  2L4B A;  2LTE A;  2CG5 B;  1ACP A;  2K92 A;  2MVU A;  2KGA A;  2K94 A;  2KG6 A;  3LMO A;  1L0H A;  2FVA A;  2FAE A;  1DNY A;  5HVC A;  2JU1 A;  2JGP A;  2LL8 A;  3CE7 A;  2LIW A;  4PWV B;  2MR7 A;  2K93 A;  2AF8 A;  2ROQ A;  1F80 D;  2KOS A;  2L0Q A;  4R0M A;  2FQ2 A;  2KWL A;  2KOP A;  2KG9 A;  2QNW A;  2KGD A;  2N6Y A;  2FQ1 A;  4HKG A;  4IZ6 A;  2AFD A;  5KP8 B;  2L22 A;  5KP7 B;  1OR5 A;  4BPH A;  2K0X A;  2LOL A;  1HY8 A;  4BPG A;  4H2W C;  2KOR A;  2CQ8 A;  2MR8 A;  2DNW A;  2FAD A;  2K2Q A;  2L9F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...