4IPYA

Hiv capsid c-terminal domain
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
85
structure length
85
Chain Sequence
PTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPGATLEEMMTACQGVGGPGHKARVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A triclinic crystal structure of the carboxy-terminal domain of HIV-1 capsid protein with four molecules in the asymmetric unit reveals a novel packing interface.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Viral protein
molecule keywords Capsid protein p24
total genus 28
structure length 85
sequence length 85
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-01-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 4ipyA00
2BUOA 3DTJA 5HGLA 4XFXA 1D1DA 3VRLC 4XROA 2XV6A 1EOQA 2L6EA 1E6JP 3DS0A 1BAJA 4COPA 2JO0A 3MGEA 4U0CA 3H4EA 4IPYA 5I4TG 2JYLA 3NTEA 3DPHA 4U0EA 2ONTA 4QNBA 4COCA 1EIAA 3G21A 2M8NA 2XXMA 5HGOA 3G29A 3G0VA 4XFYA 3DS1A 5JPAA 4XRQA 1A43A 4PH0A 1QRJA 2KODA 5DCKA 3G28A 2LF4A 3P05A 3DS2A 3H47A 1A8OA 4U0AA 3G1GA 3DS4A 4U0FA 3DS5A 4U0DA 4WYMA 5HGNA 3G26A 4PH1A 2EIAA 2JYGA 4U0BA 3G1IA 2M8LA 1AUMA 2M8PA 4XFZA 5HGMA 4M0IA 3DS3A 2XT1A 3LRYA
chains in the Genus database with same CATH superfamily
1RO2A 3CMEP 2BHVA 2XZ1C 4H2YC 1F80D 2LMLA 5I4TG 7CEIA 2ROQA 2ONTA 4PXHB 2LKIA 2N6YA 3CD6P 5EJDA 1GXHA 3CCLP 2KG6A 2JYGA 2K92A 1M6NA 1YJ9P 3CCMP 2BUOA 3HYBA 1KLPA 2JQ4A 3DPHA 2K0DX 5JPAA 1K30A 2JAZA 2KR5A 2FHSC 4CA3A 3DS2A 1VQKP 4PH1A 2EIAA 3GKLC 1EMVA 2GZJA 2PY8A 1VQ9P 1VHNA 2WPTA 1A8OA 1GXGA 4U0FA 5KP8B 1K73Q 3EJBA 3DS3A 2XT1A 2K2QA 2KOSA 4XFXA 3VRLC 1EOQA 2L6EA 1VQOP 1N8RQ 3H4EA 2VLQA 3H0DA 2PENA 3U43A 3CC7P 2LTEA 4QNBA 1EIAA 2E1MA 5HGOA 2QNWA 2JU2A 2L9FA 2PEJA 2QEXP 1VQNP 2LIWA 2KODA 2GZEA 2AFDA 1AYIA 2KGAA 4BPFA 1QVFO 1W2BO 1VQ4P 1AF8A 4F37A 3E2DA 3GJNA 1IMPA 1GPJA 2KWLA 3M1MA 2Z46A 2FQ1A 2K93A 2JU1A 2KOQA 3NTEA 2CQ8A 2M8NA 3CE7A 1YHQP 2ERHA 5HGNA 3Q20A 1QVGO 2GZIA 4U0BA 2N98A 2N5HA 5HGMA 2N5IA 2FAEA 3LMOA 2M5RA 1VQMP 4GR2A 2GZFA 1DNYA 2EHTA 2LPKA 1NQ4A 3G1GA 5EW5E 3EJEA 2OARA 1AUMA 2PEOA 1M6EX 1E0HA 4R0MA 2KG9A 3CC2P 1VQ7P 4UHPB 4XRQA 3G71P 4H2XC 2LF4A 3GZLA 2K0XA 1Q7YQ 2M8PA 1HQBA 3CCRP 2EG5A 4U0CA 2GDXA 2JYLA 1BXIA 2Z44A 3CCUP 2FQ0A 2XZ0D 2MR7A 1ACPA 4WYMA 2OTJP 2EHSA 1YIJP 3G1IA 2MR8A 2K0YA 4PWVB 2XV6A 2LOLA 1Q82Q 3MGEA 5KP6B 3G21A 2KGCA 2PEMA 1UNKA 1YITP 2NO8A 5HVCA 3CCEP 4U0AA 2FACA 4QKOA 3CMAP 3G26A 3CCSP 4BPGA 2L0QA 3WBHA 4MRTC 4H2WC 1VQ6P 5HV8A 1MZ8A 4U0EA 3G0VA 3DS1A 2QA4P 3B5IA 1M1KQ 3RG6C 2MF4A 1X3OA 5KP7B 2FVAA 2L4BA 3RG2A 3OW2O 2VLOA 1Q86Q 4HKGA 2JBGA 4COPA 1OR5A 2LL8A 3HZQA 4NEOA 1DV5A 1VQ8P 1IUQA 3CC4P 3G4SP 2VSQA 2M8LA 2GYKA 3LRYA 1D1DA 4XROA 2PNGA 2CNRA 1RNIA 5F2KA 2MY5A 3I56P 1K8AQ 1ZNVA 2KGEA 1VQLP 3B4QA 2PEQA 1ZMBA 2KG8A 2X2BA 1Q81Q 2AFEA 1KD1Q 3DTJA 5HGLA 2CGQA 1VQPP 2MD9A 2JB0A 5F2OA 1A43A 4PH0A 2KORA 2VLPA 3DS4A 2MVUA 1JJ2O 1T8KA 1KC8Q 2OTLP 1CEIA 3CCJP 2FADA 1S72P 1L0IA 2KOPA 2KOOA 1E6JP 1UJZA 2L22A 1BAJA 2AF8A 2GZGA 1M90Q 5BS2A 1Z6MA 2AVAA 4XFYA 3I55P 2P9XA 3CXCO 2K5XA 2PEIA 4BPHA 1QRJA 1YJWP 2K94A 2CWOA 2N6ZA 2VLNA 3EJDA 1FR2A 3DS5A 5CZDB 2PEKA 4XFZA 4M0IA 1KQSO 2FQ2A 2KW2A 1RO0A 3CPWO 1YI2P 2LIUA 2JO0A 2DGYA 4COCA 2N50A 4DG9A 2XXMA 3G29A 1K9MQ 1VQ5P 1NJIQ 3G6EP 2GDYA 3G28A 3P05A 2Z45A 3GZMA 1M74A 2DNWA 1VKUA 1IMQA 2CG5B 1YJNP 1HY8A 2JGPA 2EFJA 3DS0A 4GR6A 4IPYA 2KGDA 2FVEA 5BS1A 4IZ6A 2FVFA 3CCQP 5DCKA 3NY7B 3H47A 4U0DA 1L0HA 3CCVP 2GDWA 2MVVA 5F2NA
chains in the Genus database with same CATH topology
3DTJA 5HGLA 1RO2A 3CMEP 2BHVA 2XV6A 1VQ4P 3E2DA 1Q82Q 1VQPP 3MGEA 3M1MA 5I4TG 2Z46A 3NTEA 2ONTA 3G21A 2M8NA 2PEMA 3CD6P 1YITP 5F2OA 1YHQP 1A43A 4PH0A 3CCEP 4U0AA 3DS4A 3CCLP 5HGNA 3CMAP 3G26A 3Q20A 1QVGO 1JJ2O 3CCSP 1KC8Q 2JYGA 4U0BA 2OTLP 1M6NA 3WBHA 1YJ9P 5HGMA 3CCJP 3CCMP 2BUOA 3HYBA 1S72P 1E6JP 1BAJA 1VQ6P 1M90Q 1VQMP 3DPHA 4U0EA 4GR2A 5BS2A 4XFYA 3G0VA 5JPAA 3DS1A 3I55P 1K30A 2P9XA 3CXCO 2QA4P 2PEIA 3B5IA 1M1KQ 1QRJA 1YJWP 3RG6C 2CWOA 3DS2A 1VQKP 3G1GA 3DS5A 4PH1A 2EIAA 2OARA 1AUMA 2PEKA 4XFZA 3OW2O 4M0IA 1Q86Q 1KQSO 2PEOA 1RO0A 1M6EX 3CPWO 1YI2P 4COPA 2JO0A 2PY8A 2DGYA 1VQ9P 3HZQA 3CC2P 4COCA 1VQ7P 2XXMA 3G29A 1K9MQ 1VQ8P 4XRQA 1VQ5P 1IUQA 3G71P 3CC4P 1NJIQ 3G6EP 3G28A 2LF4A 3P05A 2Z45A 1A8OA 3G4SP 1M74A 4U0FA 1K73Q 2M8LA 1YJNP 1Q7YQ 2M8PA 3CCRP 3DS3A 2XT1A 3LRYA 1D1DA 4XFXA 2EG5A 3VRLC 2EFJA 4XROA 1EOQA 2L6EA 3DS0A 4GR6A 1RNIA 1VQOP 1N8RQ 4U0CA 3H4EA 4IPYA 2JYLA 5F2KA 3H0DA 2PENA 2Z44A 3CC7P 4QNBA 3I56P 1EIAA 2E1MA 5HGOA 3CCUP 1K8AQ 5BS1A 2PEJA 2QEXP 1VQLP 1VQNP 2KODA 3CCQP 5DCKA 3H47A 2PEQA 1ZMBA 4WYMA 4U0DA 1Q81Q 2OTJP 1YIJP 3G1IA 3CCVP 1KD1Q 5F2NA 1QVFO 1W2BO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BUO A;  3DTJ A;  5HGL A;  4XFX A;  1D1D A;  3VRL C;  4XRO A;  2XV6 A;  1EOQ A;  2L6E A;  1E6J P;  3DS0 A;  1BAJ A;  4COP A;  2JO0 A;  3MGE A;  4U0C A;  3H4E A;  4IPY A;  5I4T G;  2JYL A;  3NTE A;  3DPH A;  4U0E A;  2ONT A;  4QNB A;  4COC A;  1EIA A;  3G21 A;  2M8N A;  2XXM A;  5HGO A;  3G29 A;  3G0V A;  4XFY A;  3DS1 A;  5JPA A;  4XRQ A;  1A43 A;  4PH0 A;  1QRJ A;  2KOD A;  5DCK A;  3G28 A;  2LF4 A;  3P05 A;  3DS2 A;  3H47 A;  1A8O A;  4U0A A;  3G1G A;  3DS4 A;  4U0F A;  3DS5 A;  4U0D A;  4WYM A;  5HGN A;  3G26 A;  4PH1 A;  2EIA A;  2JYG A;  4U0B A;  3G1I A;  2M8L A;  1AUM A;  2M8P A;  4XFZ A;  5HGM A;  4M0I A;  3DS3 A;  2XT1 A;  3LRY A; 
#chains in the Genus database with same CATH topology
 1RO2 A;  3CME P;  2BHV A;  2XZ1 C;  4H2Y C;  1F80 D;  2LML A;  5I4T G;  7CEI A;  2ROQ A;  2ONT A;  4PXH B;  2LKI A;  2N6Y A;  3CD6 P;  5EJD A;  1GXH A;  3CCL P;  2KG6 A;  2JYG A;  2K92 A;  1M6N A;  1YJ9 P;  3CCM P;  2BUO A;  3HYB A;  1KLP A;  2JQ4 A;  3DPH A;  2K0D X;  5JPA A;  1K30 A;  2JAZ A;  2KR5 A;  2FHS C;  4CA3 A;  3DS2 A;  1VQK P;  4PH1 A;  2EIA A;  3GKL C;  1EMV A;  2GZJ A;  2PY8 A;  1VQ9 P;  1VHN A;  2WPT A;  1A8O A;  1GXG A;  4U0F A;  5KP8 B;  1K73 Q;  3EJB A;  3DS3 A;  2XT1 A;  2K2Q A;  2KOS A;  4XFX A;  3VRL C;  1EOQ A;  2L6E A;  1VQO P;  1N8R Q;  3H4E A;  2VLQ A;  3H0D A;  2PEN A;  3U43 A;  3CC7 P;  2LTE A;  4QNB A;  1EIA A;  2E1M A;  5HGO A;  2QNW A;  2JU2 A;  2L9F A;  2PEJ A;  2QEX P;  1VQN P;  2LIW A;  2KOD A;  2GZE A;  2AFD A;  1AYI A;  2KGA A;  4BPF A;  1QVF O;  1W2B O;  1VQ4 P;  1AF8 A;  4F37 A;  3E2D A;  3GJN A;  1IMP A;  1GPJ A;  2KWL A;  3M1M A;  2Z46 A;  2FQ1 A;  2K93 A;  2JU1 A;  2KOQ A;  3NTE A;  2CQ8 A;  2M8N A;  3CE7 A;  1YHQ P;  2ERH A;  5HGN A;  3Q20 A;  1QVG O;  2GZI A;  4U0B A;  2N98 A;  2N5H A;  5HGM A;  2N5I A;  2FAE A;  3LMO A;  2M5R A;  1VQM P;  4GR2 A;  2GZF A;  1DNY A;  2EHT A;  2LPK A;  1NQ4 A;  3G1G A;  5EW5 E;  3EJE A;  2OAR A;  1AUM A;  2PEO A;  1M6E X;  1E0H A;  4R0M A;  2KG9 A;  3CC2 P;  1VQ7 P;  4UHP B;  4XRQ A;  3G71 P;  4H2X C;  2LF4 A;  3GZL A;  2K0X A;  1Q7Y Q;  2M8P A;  1HQB A;  3CCR P;  2EG5 A;  4U0C A;  2GDX A;  2JYL A;  1BXI A;  2Z44 A;  3CCU P;  2FQ0 A;  2XZ0 D;  2MR7 A;  1ACP A;  4WYM A;  2OTJ P;  2EHS A;  1YIJ P;  3G1I A;  2MR8 A;  2K0Y A;  4PWV B;  2XV6 A;  2LOL A;  1Q82 Q;  3MGE A;  5KP6 B;  3G21 A;  2KGC A;  2PEM A;  1UNK A;  1YIT P;  2NO8 A;  5HVC A;  3CCE P;  4U0A A;  2FAC A;  4QKO A;  3CMA P;  3G26 A;  3CCS P;  4BPG A;  2L0Q A;  3WBH A;  4MRT C;  4H2W C;  1VQ6 P;  5HV8 A;  1MZ8 A;  4U0E A;  3G0V A;  3DS1 A;  2QA4 P;  3B5I A;  1M1K Q;  3RG6 C;  2MF4 A;  1X3O A;  5KP7 B;  2FVA A;  2L4B A;  3RG2 A;  3OW2 O;  2VLO A;  1Q86 Q;  4HKG A;  2JBG A;  4COP A;  1OR5 A;  2LL8 A;  3HZQ A;  4NEO A;  1DV5 A;  1VQ8 P;  1IUQ A;  3CC4 P;  3G4S P;  2VSQ A;  2M8L A;  2GYK A;  3LRY A;  1D1D A;  4XRO A;  2PNG A;  2CNR A;  1RNI A;  5F2K A;  2MY5 A;  3I56 P;  1K8A Q;  1ZNV A;  2KGE A;  1VQL P;  3B4Q A;  2PEQ A;  1ZMB A;  2KG8 A;  2X2B A;  1Q81 Q;  2AFE A;  1KD1 Q;  3DTJ A;  5HGL A;  2CGQ A;  1VQP P;  2MD9 A;  2JB0 A;  5F2O A;  1A43 A;  4PH0 A;  2KOR A;  2VLP A;  3DS4 A;  2MVU A;  1JJ2 O;  1T8K A;  1KC8 Q;  2OTL P;  1CEI A;  3CCJ P;  2FAD A;  1S72 P;  1L0I A;  2KOP A;  2KOO A;  1E6J P;  1UJZ A;  2L22 A;  1BAJ A;  2AF8 A;  2GZG A;  1M90 Q;  5BS2 A;  1Z6M A;  2AVA A;  4XFY A;  3I55 P;  2P9X A;  3CXC O;  2K5X A;  2PEI A;  4BPH A;  1QRJ A;  1YJW P;  2K94 A;  2CWO A;  2N6Z A;  2VLN A;  3EJD A;  1FR2 A;  3DS5 A;  5CZD B;  2PEK A;  4XFZ A;  4M0I A;  1KQS O;  2FQ2 A;  2KW2 A;  1RO0 A;  3CPW O;  1YI2 P;  2LIU A;  2JO0 A;  2DGY A;  4COC A;  2N50 A;  4DG9 A;  2XXM A;  3G29 A;  1K9M Q;  1VQ5 P;  1NJI Q;  3G6E P;  2GDY A;  3G28 A;  3P05 A;  2Z45 A;  3GZM A;  1M74 A;  2DNW A;  1VKU A;  1IMQ A;  2CG5 B;  1YJN P;  1HY8 A;  2JGP A;  2EFJ A;  3DS0 A;  4GR6 A;  4IPY A;  2KGD A;  2FVE A;  5BS1 A;  4IZ6 A;  2FVF A;  3CCQ P;  5DCK A;  3NY7 B;  3H47 A;  4U0D A;  1L0H A;  3CCV P;  2GDW A;  2MVV A;  5F2N A; 
#chains in the Genus database with same CATH homology
 3DTJ A;  5HGL A;  1RO2 A;  3CME P;  2BHV A;  2XV6 A;  1VQ4 P;  3E2D A;  1Q82 Q;  1VQP P;  3MGE A;  3M1M A;  5I4T G;  2Z46 A;  3NTE A;  2ONT A;  3G21 A;  2M8N A;  2PEM A;  3CD6 P;  1YIT P;  5F2O A;  1YHQ P;  1A43 A;  4PH0 A;  3CCE P;  4U0A A;  3DS4 A;  3CCL P;  5HGN A;  3CMA P;  3G26 A;  3Q20 A;  1QVG O;  1JJ2 O;  3CCS P;  1KC8 Q;  2JYG A;  4U0B A;  2OTL P;  1M6N A;  3WBH A;  1YJ9 P;  5HGM A;  3CCJ P;  3CCM P;  2BUO A;  3HYB A;  1S72 P;  1E6J P;  1BAJ A;  1VQ6 P;  1M90 Q;  1VQM P;  3DPH A;  4U0E A;  4GR2 A;  5BS2 A;  4XFY A;  3G0V A;  5JPA A;  3DS1 A;  3I55 P;  1K30 A;  2P9X A;  3CXC O;  2QA4 P;  2PEI A;  3B5I A;  1M1K Q;  1QRJ A;  1YJW P;  3RG6 C;  2CWO A;  3DS2 A;  1VQK P;  3G1G A;  3DS5 A;  4PH1 A;  2EIA A;  2OAR A;  1AUM A;  2PEK A;  4XFZ A;  3OW2 O;  4M0I A;  1Q86 Q;  1KQS O;  2PEO A;  1RO0 A;  1M6E X;  3CPW O;  1YI2 P;  4COP A;  2JO0 A;  2PY8 A;  2DGY A;  1VQ9 P;  3HZQ A;  3CC2 P;  4COC A;  1VQ7 P;  2XXM A;  3G29 A;  1K9M Q;  1VQ8 P;  4XRQ A;  1VQ5 P;  1IUQ A;  3G71 P;  3CC4 P;  1NJI Q;  3G6E P;  3G28 A;  2LF4 A;  3P05 A;  2Z45 A;  1A8O A;  3G4S P;  1M74 A;  4U0F A;  1K73 Q;  2M8L A;  1YJN P;  1Q7Y Q;  2M8P A;  3CCR P;  3DS3 A;  2XT1 A;  3LRY A;  1D1D A;  4XFX A;  2EG5 A;  3VRL C;  2EFJ A;  4XRO A;  1EOQ A;  2L6E A;  3DS0 A;  4GR6 A;  1RNI A;  1VQO P;  1N8R Q;  4U0C A;  3H4E A;  4IPY A;  2JYL A;  5F2K A;  3H0D A;  2PEN A;  2Z44 A;  3CC7 P;  4QNB A;  3I56 P;  1EIA A;  2E1M A;  5HGO A;  3CCU P;  1K8A Q;  5BS1 A;  2PEJ A;  2QEX P;  1VQL P;  1VQN P;  2KOD A;  3CCQ P;  5DCK A;  3H47 A;  2PEQ A;  1ZMB A;  4WYM A;  4U0D A;  1Q81 Q;  2OTJ P;  1YIJ P;  3G1I A;  3CCV P;  1KD1 Q;  5F2N A;  1QVF O;  1W2B O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...