4IPYA

Hiv capsid c-terminal domain
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
85
structure length
85
Chain Sequence
PTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPGATLEEMMTACQGVGGPGHKARVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A triclinic crystal structure of the carboxy-terminal domain of HIV-1 capsid protein with four molecules in the asymmetric unit reveals a novel packing interface.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Viral protein
molecule keywords Capsid protein p24
total genus 28
structure length 85
sequence length 85
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-01-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 4ipyA00
1AUMA 5DCKA 5HGMA 5HGOA 2JYLA 3NTEA 4PH1A 3DS1A 2XXMA 4XFYA 4U0EA 5HGLA 4XFXA 1A43A 4COCA 3G28A 3DS5A 2L6EA 3DS3A 2M8LA 2JO0A 3VRLC 5I4TG 3MGEA 4U0BA 2JYGA 3DS4A 3G1GA 2BUOA 3DPHA 3G21A 3P05A 4IPYA 4U0FA 4U0AA 1E6JP 2XT1A 4XRQA 1EOQA 2EIAA 3H47A 4U0DA 4U0CA 3DS0A 3G26A 1A8OA 1D1DA 4QNBA 2KODA 4M0IA 4XROA 4WYMA 4PH0A 3G0VA 3G29A 3H4EA 3DTJA 5JPAA 4COPA 2LF4A 1BAJA 1EIAA 3LRYA 2XV6A 2M8NA 4XFZA 2ONTA 5HGNA 3DS2A 3G1IA 1QRJA 2M8PA
chains in the Genus database with same CATH superfamily
2AVAA 1EMVA 2JYLA 4XFYA 3DS5A 3E2DA 3GJNA 3GZMA 2L0QA 4HKGA 1RO0A 3CE7A 4U0CA 3CCRP 2LIUA 1YITP 2VLPA 2KOQA 2GDXA 1QRJA 5HGOA 2EFJA 2AFDA 2EHTA 1QVFO 1M90Q 3CCVP 1VQPP 2FHSC 2XZ0D 2CGQA 3LRYA 1Q7YQ 1K73Q 2DNWA 4MRTC 3G1IA 2PY8A 5F2KA 1IUQA 3CCSP 4UHPB 2N50A 4H2YC 1GXHA 2GZJA 2XT1A 1EOQA 1M6EX 2BHVA 4PXHB 3DS0A 2MR7A 2ROQA 2MVVA 1IMQA 2CQ8A 1VQ8P 1IMPA 2MF4A 1OR5A 4GR6A 2DGYA 2FACA 2WPTA 2MR8A 1VQOP 5KP6B 3CC4P 2PEMA 3GKLC 1YJWP 1EIAA 5KP8B 3B5IA 5HGNA 2EG5A 3MGEA 2KOPA 1VHNA 2VLOA 2MVUA 2XXMA 4XFXA 4COCA 1YHQP 5EW5E 4IZ6A 2M8LA 2Z45A 4PWVB 3I55P 3WBHA 3G26A 1VQ5P 2CNRA 2KORA 2QNWA 3G0VA 1NQ4A 2OTJP 1BAJA 5HV8A 2K0XA 2JU1A 2KOSA 4NEOA 1ZNVA 1AF8A 3CCJP 5I4TG 2FVAA 2BUOA 4U0FA 1KD1Q 1VKUA 1YJNP 1DNYA 2E1MA 1VQ6P 3H0DA 2NO8A 1S72P 1W2BO 1VQLP 1FR2A 1GXGA 5BS2A 3CCUP 2L9FA 3G1GA 3P05A 5HVCA 1M1KQ 1HY8A 2N6YA 2KR5A 4XFZA 3CD6P 2Z44A 2PENA 5F2OA 4BPFA 2K94A 3RG6C 3CCEP 1NJIQ 4H2WC 2KWLA 2PNGA 2JYGA 1Q81Q 2KGCA 2JB0A 1Q82Q 3G6EP 3NY7B 2CG5B 3U43A 1M74A 5EJDA 1MZ8A 2JAZA 2JGPA 1E0HA 1VQNP 1CEIA 1KLPA 1VQ4P 5BS1A 4PH1A 2N5IA 4H2XC 1F80D 5CZDB 3CCQP 4DG9A 4M0IA 2MD9A 2VSQA 4PH0A 3LMOA 3DTJA 2PEKA 1RO2A 2K2QA 2Z46A 2GZFA 2M8PA 2KGDA 3EJDA 3I56P 2FVEA 1ACPA 2JU2A 2L6EA 3VRLC 2ERHA 4QKOA 3G21A 2FQ1A 2QEXP 3EJEA 1HQBA 2FQ0A 2N98A 3CC7P 2JQ4A 2GYKA 5JPAA 2KW2A 2LF4A 4BPHA 4COPA 3CXCO 1K9MQ 5F2NA 2N6ZA 1AUMA 2AF8A 3DS1A 2LTEA 4F37A 3G28A 1N8RQ 1K8AQ 2FADA 3DS4A 3Q20A 2L4BA 2PEOA 1RNIA 2VLNA 3CC2P 3G4SP 3EJBA 1DV5A 3CMEP 4R0MA 2K5XA 2FAEA 5HGLA 2LKIA 1YI2P 1T8KA 2GZEA 4XRQA 1KQSO 2KG8A 1BXIA 1ZMBA 2EHSA 1KC8Q 1D1DA 2OARA 4QNBA 4XROA 2LMLA 7CEIA 1QVGO 3HZQA 2LPKA 1L0HA 2LOLA 2PEJA 4WYMA 4BPGA 3DS3A 2GDYA 3DPHA 2X2BA 3B4QA 2N5HA 3OW2O 1X3OA 3CCLP 2VLQA 2FVFA 2XV6A 3RG2A 1GPJA 2K0DX 1K30A 1VQ9P 2JO0A 2K93A 4CA3A 1AYIA 2P9XA 4IPYA 4U0AA 2KG9A 3CCMP 1E6JP 2XZ1C 2QA4P 2EIAA 2JBGA 2PEQA 2FQ2A 1YJ9P 3H4EA 2PEIA 1UJZA 2ONTA 1VQKP 1M6NA 3CMAP 5DCKA 3G71P 3NTEA 4U0EA 1UNKA 3CPWO 3GZLA 1A43A 2K0YA 2GDWA 2GZGA 3HYBA 1VQ7P 2KGAA 4U0DA 2LIWA 1A8OA 1Q86Q 2LL8A 3M1MA 4GR2A 5HGMA 1YIJP 2AFEA 2L22A 2M5RA 2K92A 5KP7B 2MY5A 1Z6MA 2KOOA 4U0BA 1JJ2O 1VQMP 3H47A 2KODA 2CWOA 3G29A 2GZIA 2KG6A 2OTLP 2KGEA 2M8NA 1L0IA 3DS2A
chains in the Genus database with same CATH topology
2JYLA 5BS1A 4PH1A 2XXMA 4XFYA 4XFXA 4COCA 1YHQP 3DS5A 3E2DA 2M8LA 3DS3A 2Z45A 3DPHA 3OW2O 1RO0A 3CCLP 3I55P 3WBHA 4U0CA 3G26A 3CCRP 1VQ5P 3CCQP 1YITP 4M0IA 4PH0A 3G0VA 3DTJA 2PEKA 1RO2A 2OTJP 1BAJA 2XV6A 2Z46A 1QRJA 2M8PA 5HGOA 3I56P 2EFJA 1K30A 3CCJP 1VQ9P 2L6EA 2JO0A 3VRLC 5I4TG 1QVFO 2P9XA 4IPYA 2BUOA 3G21A 4U0FA 4U0AA 3CCMP 1E6JP 1M90Q 3CCVP 1KD1Q 2QA4P 2QEXP 1VQPP 2EIAA 1YJNP 2PEQA 3CC7P 1YJ9P 3H4EA 5JPAA 4COPA 2LF4A 2E1MA 3LRYA 1VQ6P 3H0DA 2PEIA 3CXCO 1Q7YQ 1K73Q 2ONTA 1S72P 1W2BO 1K9MQ 1VQLP 1M6NA 3G1IA 5F2NA 1VQKP 3CMAP 1AUMA 2PY8A 5DCKA 5F2KA 3G71P 3NTEA 1IUQA 3DS1A 3CCSP 5BS2A 4U0EA 3CPWO 1A43A 3G28A 3CCUP 1N8RQ 1K8AQ 3DS4A 3G1GA 3HYBA 3P05A 3Q20A 1VQ7P 2XT1A 1M1KQ 1EOQA 1M6EX 2PEOA 1RNIA 3CC2P 2BHVA 4U0DA 3G4SP 3DS0A 1A8OA 1Q86Q 3CMEP 1VQ8P 3M1MA 4XFZA 4GR2A 3CD6P 2Z44A 2PENA 5HGMA 1YIJP 5F2OA 4GR6A 2DGYA 3RG6C 3CCEP 5HGLA 1NJIQ 1YI2P 1VQOP 4U0BA 2JYGA 1Q81Q 1JJ2O 3CC4P 4XRQA 2PEMA 1VQMP 1Q82Q 1KQSO 3G6EP 1YJWP 1ZMBA 3H47A 1KC8Q 1D1DA 2OARA 2KODA 4QNBA 4XROA 2CWOA 3G29A 1M74A 1QVGO 2OTLP 3HZQA 1EIAA 2M8NA 3B5IA 1VQNP 5HGNA 2EG5A 2PEJA 3MGEA 3DS2A 4WYMA 1VQ4P
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AUM A;  5DCK A;  5HGM A;  5HGO A;  2JYL A;  3NTE A;  4PH1 A;  3DS1 A;  2XXM A;  4XFY A;  4U0E A;  5HGL A;  4XFX A;  1A43 A;  4COC A;  3G28 A;  3DS5 A;  2L6E A;  3DS3 A;  2M8L A;  2JO0 A;  3VRL C;  5I4T G;  3MGE A;  4U0B A;  2JYG A;  3DS4 A;  3G1G A;  2BUO A;  3DPH A;  3G21 A;  3P05 A;  4IPY A;  4U0F A;  4U0A A;  1E6J P;  2XT1 A;  4XRQ A;  1EOQ A;  2EIA A;  3H47 A;  4U0D A;  4U0C A;  3DS0 A;  3G26 A;  1A8O A;  1D1D A;  4QNB A;  2KOD A;  4M0I A;  4XRO A;  4WYM A;  4PH0 A;  3G0V A;  3G29 A;  3H4E A;  3DTJ A;  5JPA A;  4COP A;  2LF4 A;  1BAJ A;  1EIA A;  3LRY A;  2XV6 A;  2M8N A;  4XFZ A;  2ONT A;  5HGN A;  3DS2 A;  3G1I A;  1QRJ A;  2M8P A; 
#chains in the Genus database with same CATH topology
 2AVA A;  1EMV A;  2JYL A;  4XFY A;  3DS5 A;  3E2D A;  3GJN A;  3GZM A;  2L0Q A;  4HKG A;  1RO0 A;  3CE7 A;  4U0C A;  3CCR P;  2LIU A;  1YIT P;  2VLP A;  2KOQ A;  2GDX A;  1QRJ A;  5HGO A;  2EFJ A;  2AFD A;  2EHT A;  1QVF O;  1M90 Q;  3CCV P;  1VQP P;  2FHS C;  2XZ0 D;  2CGQ A;  3LRY A;  1Q7Y Q;  1K73 Q;  2DNW A;  4MRT C;  3G1I A;  2PY8 A;  5F2K A;  1IUQ A;  3CCS P;  4UHP B;  2N50 A;  4H2Y C;  1GXH A;  2GZJ A;  2XT1 A;  1EOQ A;  1M6E X;  2BHV A;  4PXH B;  3DS0 A;  2MR7 A;  2ROQ A;  2MVV A;  1IMQ A;  2CQ8 A;  1VQ8 P;  1IMP A;  2MF4 A;  1OR5 A;  4GR6 A;  2DGY A;  2FAC A;  2WPT A;  2MR8 A;  1VQO P;  5KP6 B;  3CC4 P;  2PEM A;  3GKL C;  1YJW P;  1EIA A;  5KP8 B;  3B5I A;  5HGN A;  2EG5 A;  3MGE A;  2KOP A;  1VHN A;  2VLO A;  2MVU A;  2XXM A;  4XFX A;  4COC A;  1YHQ P;  5EW5 E;  4IZ6 A;  2M8L A;  2Z45 A;  4PWV B;  3I55 P;  3WBH A;  3G26 A;  1VQ5 P;  2CNR A;  2KOR A;  2QNW A;  3G0V A;  1NQ4 A;  2OTJ P;  1BAJ A;  5HV8 A;  2K0X A;  2JU1 A;  2KOS A;  4NEO A;  1ZNV A;  1AF8 A;  3CCJ P;  5I4T G;  2FVA A;  2BUO A;  4U0F A;  1KD1 Q;  1VKU A;  1YJN P;  1DNY A;  2E1M A;  1VQ6 P;  3H0D A;  2NO8 A;  1S72 P;  1W2B O;  1VQL P;  1FR2 A;  1GXG A;  5BS2 A;  3CCU P;  2L9F A;  3G1G A;  3P05 A;  5HVC A;  1M1K Q;  1HY8 A;  2N6Y A;  2KR5 A;  4XFZ A;  3CD6 P;  2Z44 A;  2PEN A;  5F2O A;  4BPF A;  2K94 A;  3RG6 C;  3CCE P;  1NJI Q;  4H2W C;  2KWL A;  2PNG A;  2JYG A;  1Q81 Q;  2KGC A;  2JB0 A;  1Q82 Q;  3G6E P;  3NY7 B;  2CG5 B;  3U43 A;  1M74 A;  5EJD A;  1MZ8 A;  2JAZ A;  2JGP A;  1E0H A;  1VQN P;  1CEI A;  1KLP A;  1VQ4 P;  5BS1 A;  4PH1 A;  2N5I A;  4H2X C;  1F80 D;  5CZD B;  3CCQ P;  4DG9 A;  4M0I A;  2MD9 A;  2VSQ A;  4PH0 A;  3LMO A;  3DTJ A;  2PEK A;  1RO2 A;  2K2Q A;  2Z46 A;  2GZF A;  2M8P A;  2KGD A;  3EJD A;  3I56 P;  2FVE A;  1ACP A;  2JU2 A;  2L6E A;  3VRL C;  2ERH A;  4QKO A;  3G21 A;  2FQ1 A;  2QEX P;  3EJE A;  1HQB A;  2FQ0 A;  2N98 A;  3CC7 P;  2JQ4 A;  2GYK A;  5JPA A;  2KW2 A;  2LF4 A;  4BPH A;  4COP A;  3CXC O;  1K9M Q;  5F2N A;  2N6Z A;  1AUM A;  2AF8 A;  3DS1 A;  2LTE A;  4F37 A;  3G28 A;  1N8R Q;  1K8A Q;  2FAD A;  3DS4 A;  3Q20 A;  2L4B A;  2PEO A;  1RNI A;  2VLN A;  3CC2 P;  3G4S P;  3EJB A;  1DV5 A;  3CME P;  4R0M A;  2K5X A;  2FAE A;  5HGL A;  2LKI A;  1YI2 P;  1T8K A;  2GZE A;  4XRQ A;  1KQS O;  2KG8 A;  1BXI A;  1ZMB A;  2EHS A;  1KC8 Q;  1D1D A;  2OAR A;  4QNB A;  4XRO A;  2LML A;  7CEI A;  1QVG O;  3HZQ A;  2LPK A;  1L0H A;  2LOL A;  2PEJ A;  4WYM A;  4BPG A;  3DS3 A;  2GDY A;  3DPH A;  2X2B A;  3B4Q A;  2N5H A;  3OW2 O;  1X3O A;  3CCL P;  2VLQ A;  2FVF A;  2XV6 A;  3RG2 A;  1GPJ A;  2K0D X;  1K30 A;  1VQ9 P;  2JO0 A;  2K93 A;  4CA3 A;  1AYI A;  2P9X A;  4IPY A;  4U0A A;  2KG9 A;  3CCM P;  1E6J P;  2XZ1 C;  2QA4 P;  2EIA A;  2JBG A;  2PEQ A;  2FQ2 A;  1YJ9 P;  3H4E A;  2PEI A;  1UJZ A;  2ONT A;  1VQK P;  1M6N A;  3CMA P;  5DCK A;  3G71 P;  3NTE A;  4U0E A;  1UNK A;  3CPW O;  3GZL A;  1A43 A;  2K0Y A;  2GDW A;  2GZG A;  3HYB A;  1VQ7 P;  2KGA A;  4U0D A;  2LIW A;  1A8O A;  1Q86 Q;  2LL8 A;  3M1M A;  4GR2 A;  5HGM A;  1YIJ P;  2AFE A;  2L22 A;  2M5R A;  2K92 A;  5KP7 B;  2MY5 A;  1Z6M A;  2KOO A;  4U0B A;  1JJ2 O;  1VQM P;  3H47 A;  2KOD A;  2CWO A;  3G29 A;  2GZI A;  2KG6 A;  2OTL P;  2KGE A;  2M8N A;  1L0I A;  3DS2 A; 
#chains in the Genus database with same CATH homology
 2JYL A;  5BS1 A;  4PH1 A;  2XXM A;  4XFY A;  4XFX A;  4COC A;  1YHQ P;  3DS5 A;  3E2D A;  2M8L A;  3DS3 A;  2Z45 A;  3DPH A;  3OW2 O;  1RO0 A;  3CCL P;  3I55 P;  3WBH A;  4U0C A;  3G26 A;  3CCR P;  1VQ5 P;  3CCQ P;  1YIT P;  4M0I A;  4PH0 A;  3G0V A;  3DTJ A;  2PEK A;  1RO2 A;  2OTJ P;  1BAJ A;  2XV6 A;  2Z46 A;  1QRJ A;  2M8P A;  5HGO A;  3I56 P;  2EFJ A;  1K30 A;  3CCJ P;  1VQ9 P;  2L6E A;  2JO0 A;  3VRL C;  5I4T G;  1QVF O;  2P9X A;  4IPY A;  2BUO A;  3G21 A;  4U0F A;  4U0A A;  3CCM P;  1E6J P;  1M90 Q;  3CCV P;  1KD1 Q;  2QA4 P;  2QEX P;  1VQP P;  2EIA A;  1YJN P;  2PEQ A;  3CC7 P;  1YJ9 P;  3H4E A;  5JPA A;  4COP A;  2LF4 A;  2E1M A;  3LRY A;  1VQ6 P;  3H0D A;  2PEI A;  3CXC O;  1Q7Y Q;  1K73 Q;  2ONT A;  1S72 P;  1W2B O;  1K9M Q;  1VQL P;  1M6N A;  3G1I A;  5F2N A;  1VQK P;  3CMA P;  1AUM A;  2PY8 A;  5DCK A;  5F2K A;  3G71 P;  3NTE A;  1IUQ A;  3DS1 A;  3CCS P;  5BS2 A;  4U0E A;  3CPW O;  1A43 A;  3G28 A;  3CCU P;  1N8R Q;  1K8A Q;  3DS4 A;  3G1G A;  3HYB A;  3P05 A;  3Q20 A;  1VQ7 P;  2XT1 A;  1M1K Q;  1EOQ A;  1M6E X;  2PEO A;  1RNI A;  3CC2 P;  2BHV A;  4U0D A;  3G4S P;  3DS0 A;  1A8O A;  1Q86 Q;  3CME P;  1VQ8 P;  3M1M A;  4XFZ A;  4GR2 A;  3CD6 P;  2Z44 A;  2PEN A;  5HGM A;  1YIJ P;  5F2O A;  4GR6 A;  2DGY A;  3RG6 C;  3CCE P;  5HGL A;  1NJI Q;  1YI2 P;  1VQO P;  4U0B A;  2JYG A;  1Q81 Q;  1JJ2 O;  3CC4 P;  4XRQ A;  2PEM A;  1VQM P;  1Q82 Q;  1KQS O;  3G6E P;  1YJW P;  1ZMB A;  3H47 A;  1KC8 Q;  1D1D A;  2OAR A;  2KOD A;  4QNB A;  4XRO A;  2CWO A;  3G29 A;  1M74 A;  1QVG O;  2OTL P;  3HZQ A;  1EIA A;  2M8N A;  3B5I A;  1VQN P;  5HGN A;  2EG5 A;  2PEJ A;  3MGE A;  3DS2 A;  4WYM A;  1VQ4 P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...