4IPYA

Hiv capsid c-terminal domain
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
85
structure length
85
Chain Sequence
PTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPGATLEEMMTACQGVGGPGHKARVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein
molecule keywords Capsid protein p24
publication title A triclinic crystal structure of the carboxy-terminal domain of HIV-1 capsid protein with four molecules in the asymmetric unit reveals a novel packing interface.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
total genus 28
structure length 85
sequence length 85
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-01-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 4ipyA00
2M8PA 4QNBA 3LRYA 2KODA 3DS5A 4U0BA 4COPA 2L6EA 3H47A 3P05A 3NTEA 4U0AA 4WYMA 3DS0A 1EIAA 4XFZA 4XRQA 5JPAA 1QRJA 3DS2A 2LF4A 3DTJA 4M0IA 3H4EA 4PH1A 4PH0A 4U0FA 2ONTA 3G1GA 2XXMA 1A43A 3G28A 2JYLA 4IPYA 2M8LA 1E6JP 3G29A 4XROA 2M8NA 4XFYA 3DS4A 4U0DA 5HGNA 3VRLC 1D1DA 3G0VA 1AUMA 3G21A 2XV6A 4U0EA 3MGEA 5HGMA 3DS1A 5HGLA 4COCA 1EOQA 3DS3A 3DPHA 4XFXA 3G1IA 5HGOA 2JYGA 5DCKA 3G26A 1A8OA 2JO0A 2EIAA 5I4TG 1BAJA 4U0CA 2XT1A 2BUOA
chains in the Genus database with same CATH superfamily
2KG9A 2LOLA 2PEIA 3DS5A 2OARA 4XRQA 4QKOA 4U0FA 1QVGO 2LL8A 3G29A 2FVEA 2L9FA 1AUMA 1K73Q 1EOQA 1BXIA 1Z6MA 1YITP 2KG6A 2JO0A 4WYMA 2LKIA 2BUOA 2XT1A 4U0BA 3OW2O 2GZFA 4U0AA 1S72P 2GZEA 2MY5A 1VQ9P 2QNWA 2FACA 1NJIQ 5HGNA 5KP8B 2KOOA 3GZMA 2JU2A 2K2QA 2PENA 1M74A 5HVCA 3G26A 3I56P 2KOQA 1HQBA 4PH0A 4H2WC 2JYLA 2Z45A 3I55P 1M6EX 2AFDA 2LTEA 2KWLA 4PXHB 1L0IA 3G6EP 3H0DA 1KQSO 3E2DA 2AFEA 1ZNVA 3DS0A 2OTJP 2KW2A 2KGAA 1M1KQ 2PEKA 2KGDA 2FQ2A 2JAZA 2XXMA 2N5IA 4IZ6A 1VKUA 4BPHA 5HGLA 2P9XA 3GKLC 3GJNA 1VHNA 2JYGA 5BS1A 5F2OA 5I4TG 3HZQA 2CQ8A 2M8PA 2VLPA 3NTEA 5F2NA 2XZ0D 1EIAA 2M5RA 3DTJA 2MVUA 3G71P 2KOSA 2MD9A 2L4BA 2M8NA 3CCQP 1Q86Q 2N50A 1VQ6P 2K0DX 2MR8A 1E0HA 1MZ8A 2XV6A 3MGEA 4XFXA 1VQNP 1BAJA 4BPGA 1VQOP 2JB0A 3P05A 2Z46A 5JPAA 3M1MA 1QRJA 1UJZA 2KGEA 3WBHA 3CCLP 1JJ2O 2FVAA 2GDXA 4XROA 3CCMP 5EJDA 2LMLA 2CWOA 2DNWA 2GYKA 4COCA 2ROQA 2EG5A 2LIUA 1NQ4A 2LPKA 3U43A 2VSQA 2KORA 2JGPA 1F80D 2VLNA 2ONTA 3CMAP 3G28A 3DS4A 4BPFA 1HY8A 3CD6P 1AYIA 1K30A 1L0HA 4CA3A 1YIJP 2FQ0A 2N6YA 3EJDA 2QA4P 1FR2A 2K93A 1VQ8P 2K94A 2PEJA 2K0YA 2L22A 4GR6A 1VQPP 1T8KA 3DS1A 2FQ1A 3DPHA 1Q82Q 2CGQA 3RG6C 7CEIA 3LMOA 2LIWA 2GZIA 2AF8A 3CC7P 2PEOA 2OTLP 2CG5B 3B4QA 2JBGA 4XFYA 4U0DA 5BS2A 1KC8Q 4UHPB 1D1DA 3HYBA 3CE7A 2K92A 1DV5A 1W2BO 2KOPA 4XFZA 2N6ZA 3CPWO 2EHTA 4IPYA 3VRLC 5KP7B 3CCVP 1X3OA 1YJWP 2ERHA 3CCUP 2PEQA 1IMPA 1RNIA 4H2XC 2EIAA 4NEOA 1K9MQ 4QNBA 2VLQA 2XZ1C 1YJNP 1GPJA 2GDWA 3EJEA 3CCEP 1IMQA 3DS2A 1IUQA 2K0XA 4M0IA 1RO0A 5CZDB 1GXGA 3CMEP 3EJBA 2MR7A 4DG9A 2PY8A 1VQ7P 2PEMA 3Q20A 3B5IA 3CCRP 1N8RQ 2X2BA 1E6JP 1CEIA 2K5XA 1VQ4P 2L0QA 3G0VA 1DNYA 1K8AQ 1M90Q 2GZJA 1Q81Q 3CC4P 5EW5E 2JQ4A 1VQ5P 3CXCO 1KD1Q 2L6EA 3H47A 2PNGA 2CNRA 4H2YC 2NO8A 2FVFA 1VQMP 2MVVA 4PWVB 1AF8A 1VQLP 5HGMA 4GR2A 4R0MA 5HGOA 5DCKA 2FHSC 1EMVA 1YHQP 1OR5A 3CCJP 2LF4A 4PH1A 3NY7B 3G1GA 3GZLA 2EFJA 1A43A 2M8LA 1YI2P 3RG2A 1KLPA 2GZGA 1YJ9P 2E1MA 4U0EA 3DS3A 1VQKP 1A8OA 2N98A 2MF4A 2BHVA 5KP6B 2DGYA 1GXHA 2GDYA 2KGCA 2KG8A 4MRTC 2JU1A 4F37A 2VLOA 3H4EA 2WPTA 3CC2P 1UNKA 3G21A 1Q7YQ 2EHSA 2FAEA 1M6NA 3G1IA 2QEXP 3G4SP 3LRYA 2KODA 4COPA 1QVFO 1ACPA 2Z44A 2KR5A 3CCSP 5HV8A 5F2KA 4HKGA 2N5HA 2FADA 1RO2A 2AVAA 4U0CA 1ZMBA
chains in the Genus database with same CATH topology
1VQ5P 2M8PA 3CXCO 2PEIA 1KD1Q 3DS5A 2L6EA 3H47A 2OARA 3NTEA 5F2NA 1EIAA 4XRQA 3CC7P 2PEOA 2OTLP 3DTJA 4U0CA 4U0FA 1VQMP 1QVGO 3G71P 3G29A 2M8NA 4XFYA 3CCQP 4U0DA 1Q86Q 5BS2A 1KC8Q 1VQ6P 1D1DA 3HYBA 1VQLP 1AUMA 2XV6A 5HGMA 3MGEA 1K73Q 1EOQA 4GR2A 4XFXA 5HGOA 1YITP 5DCKA 1VQNP 2JO0A 4WYMA 1YHQP 1BAJA 1VQOP 2XT1A 2BUOA 1W2BO 4U0BA 3CCJP 3OW2O 3P05A 2Z46A 4U0AA 1S72P 4XFZA 5JPAA 3M1MA 1QRJA 3WBHA 1VQ9P 3CCLP 2LF4A 4PH1A 3G1GA 3CPWO 2EFJA 1JJ2O 1A43A 2M8LA 4IPYA 4XROA 1NJIQ 1YI2P 3CCMP 5HGNA 3VRLC 1YJ9P 3CCVP 2E1MA 2CWOA 1YJWP 4U0EA 3CCUP 2PENA 1M74A 4COCA 3DS3A 2PEQA 2EG5A 1VQKP 3G26A 3I56P 1A8OA 1RNIA 2EIAA 1K9MQ 4QNBA 2BHVA 1YJNP 2DGYA 3CCEP 3DS2A 1IUQA 4M0IA 3H4EA 4PH0A 2ONTA 3CMAP 3G28A 3CC2P 2JYLA 2Z45A 3I55P 1RO0A 3DS4A 3CD6P 3G21A 1Q7YQ 1M6EX 3CMEP 1M6NA 3G1IA 1K30A 2QEXP 2PY8A 1VQ7P 3G4SP 2PEMA 1YIJP 3G6EP 3H0DA 1KQSO 3Q20A 3E2DA 3B5IA 3LRYA 2KODA 4COPA 1QVFO 3CCRP 3DS0A 2QA4P 1N8RQ 2Z44A 2OTJP 1M1KQ 2PEKA 1VQ8P 2XXMA 2PEJA 3CCSP 1E6JP 4GR6A 5F2KA 1VQ4P 3G0VA 1VQPP 3DS1A 5HGLA 2P9XA 1K8AQ 1Q82Q 3DPHA 3RG6C 1M90Q 2JYGA 5BS1A 1Q81Q 5F2OA 3CC4P 1RO2A 5I4TG 3HZQA 1ZMBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M8P A;  4QNB A;  3LRY A;  2KOD A;  3DS5 A;  4U0B A;  4COP A;  2L6E A;  3H47 A;  3P05 A;  3NTE A;  4U0A A;  4WYM A;  3DS0 A;  1EIA A;  4XFZ A;  4XRQ A;  5JPA A;  1QRJ A;  3DS2 A;  2LF4 A;  3DTJ A;  4M0I A;  3H4E A;  4PH1 A;  4PH0 A;  4U0F A;  2ONT A;  3G1G A;  2XXM A;  1A43 A;  3G28 A;  2JYL A;  4IPY A;  2M8L A;  1E6J P;  3G29 A;  4XRO A;  2M8N A;  4XFY A;  3DS4 A;  4U0D A;  5HGN A;  3VRL C;  1D1D A;  3G0V A;  1AUM A;  3G21 A;  2XV6 A;  4U0E A;  3MGE A;  5HGM A;  3DS1 A;  5HGL A;  4COC A;  1EOQ A;  3DS3 A;  3DPH A;  4XFX A;  3G1I A;  5HGO A;  2JYG A;  5DCK A;  3G26 A;  1A8O A;  2JO0 A;  2EIA A;  5I4T G;  1BAJ A;  4U0C A;  2XT1 A;  2BUO A; 
#chains in the Genus database with same CATH topology
 2KG9 A;  2LOL A;  2PEI A;  3DS5 A;  2OAR A;  4XRQ A;  4QKO A;  4U0F A;  1QVG O;  2LL8 A;  3G29 A;  2FVE A;  2L9F A;  1AUM A;  1K73 Q;  1EOQ A;  1BXI A;  1Z6M A;  1YIT P;  2KG6 A;  2JO0 A;  4WYM A;  2LKI A;  2BUO A;  2XT1 A;  4U0B A;  3OW2 O;  2GZF A;  4U0A A;  1S72 P;  2GZE A;  2MY5 A;  1VQ9 P;  2QNW A;  2FAC A;  1NJI Q;  5HGN A;  5KP8 B;  2KOO A;  3GZM A;  2JU2 A;  2K2Q A;  2PEN A;  1M74 A;  5HVC A;  3G26 A;  3I56 P;  2KOQ A;  1HQB A;  4PH0 A;  4H2W C;  2JYL A;  2Z45 A;  3I55 P;  1M6E X;  2AFD A;  2LTE A;  2KWL A;  4PXH B;  1L0I A;  3G6E P;  3H0D A;  1KQS O;  3E2D A;  2AFE A;  1ZNV A;  3DS0 A;  2OTJ P;  2KW2 A;  2KGA A;  1M1K Q;  2PEK A;  2KGD A;  2FQ2 A;  2JAZ A;  2XXM A;  2N5I A;  4IZ6 A;  1VKU A;  4BPH A;  5HGL A;  2P9X A;  3GKL C;  3GJN A;  1VHN A;  2JYG A;  5BS1 A;  5F2O A;  5I4T G;  3HZQ A;  2CQ8 A;  2M8P A;  2VLP A;  3NTE A;  5F2N A;  2XZ0 D;  1EIA A;  2M5R A;  3DTJ A;  2MVU A;  3G71 P;  2KOS A;  2MD9 A;  2L4B A;  2M8N A;  3CCQ P;  1Q86 Q;  2N50 A;  1VQ6 P;  2K0D X;  2MR8 A;  1E0H A;  1MZ8 A;  2XV6 A;  3MGE A;  4XFX A;  1VQN P;  1BAJ A;  4BPG A;  1VQO P;  2JB0 A;  3P05 A;  2Z46 A;  5JPA A;  3M1M A;  1QRJ A;  1UJZ A;  2KGE A;  3WBH A;  3CCL P;  1JJ2 O;  2FVA A;  2GDX A;  4XRO A;  3CCM P;  5EJD A;  2LML A;  2CWO A;  2DNW A;  2GYK A;  4COC A;  2ROQ A;  2EG5 A;  2LIU A;  1NQ4 A;  2LPK A;  3U43 A;  2VSQ A;  2KOR A;  2JGP A;  1F80 D;  2VLN A;  2ONT A;  3CMA P;  3G28 A;  3DS4 A;  4BPF A;  1HY8 A;  3CD6 P;  1AYI A;  1K30 A;  1L0H A;  4CA3 A;  1YIJ P;  2FQ0 A;  2N6Y A;  3EJD A;  2QA4 P;  1FR2 A;  2K93 A;  1VQ8 P;  2K94 A;  2PEJ A;  2K0Y A;  2L22 A;  4GR6 A;  1VQP P;  1T8K A;  3DS1 A;  2FQ1 A;  3DPH A;  1Q82 Q;  2CGQ A;  3RG6 C;  7CEI A;  3LMO A;  2LIW A;  2GZI A;  2AF8 A;  3CC7 P;  2PEO A;  2OTL P;  2CG5 B;  3B4Q A;  2JBG A;  4XFY A;  4U0D A;  5BS2 A;  1KC8 Q;  4UHP B;  1D1D A;  3HYB A;  3CE7 A;  2K92 A;  1DV5 A;  1W2B O;  2KOP A;  4XFZ A;  2N6Z A;  3CPW O;  2EHT A;  4IPY A;  3VRL C;  5KP7 B;  3CCV P;  1X3O A;  1YJW P;  2ERH A;  3CCU P;  2PEQ A;  1IMP A;  1RNI A;  4H2X C;  2EIA A;  4NEO A;  1K9M Q;  4QNB A;  2VLQ A;  2XZ1 C;  1YJN P;  1GPJ A;  2GDW A;  3EJE A;  3CCE P;  1IMQ A;  3DS2 A;  1IUQ A;  2K0X A;  4M0I A;  1RO0 A;  5CZD B;  1GXG A;  3CME P;  3EJB A;  2MR7 A;  4DG9 A;  2PY8 A;  1VQ7 P;  2PEM A;  3Q20 A;  3B5I A;  3CCR P;  1N8R Q;  2X2B A;  1E6J P;  1CEI A;  2K5X A;  1VQ4 P;  2L0Q A;  3G0V A;  1DNY A;  1K8A Q;  1M90 Q;  2GZJ A;  1Q81 Q;  3CC4 P;  5EW5 E;  2JQ4 A;  1VQ5 P;  3CXC O;  1KD1 Q;  2L6E A;  3H47 A;  2PNG A;  2CNR A;  4H2Y C;  2NO8 A;  2FVF A;  1VQM P;  2MVV A;  4PWV B;  1AF8 A;  1VQL P;  5HGM A;  4GR2 A;  4R0M A;  5HGO A;  5DCK A;  2FHS C;  1EMV A;  1YHQ P;  1OR5 A;  3CCJ P;  2LF4 A;  4PH1 A;  3NY7 B;  3G1G A;  3GZL A;  2EFJ A;  1A43 A;  2M8L A;  1YI2 P;  3RG2 A;  1KLP A;  2GZG A;  1YJ9 P;  2E1M A;  4U0E A;  3DS3 A;  1VQK P;  1A8O A;  2N98 A;  2MF4 A;  2BHV A;  5KP6 B;  2DGY A;  1GXH A;  2GDY A;  2KGC A;  2KG8 A;  4MRT C;  2JU1 A;  4F37 A;  2VLO A;  3H4E A;  2WPT A;  3CC2 P;  1UNK A;  3G21 A;  1Q7Y Q;  2EHS A;  2FAE A;  1M6N A;  3G1I A;  2QEX P;  3G4S P;  3LRY A;  2KOD A;  4COP A;  1QVF O;  1ACP A;  2Z44 A;  2KR5 A;  3CCS P;  5HV8 A;  5F2K A;  4HKG A;  2N5H A;  2FAD A;  1RO2 A;  2AVA A;  4U0C A;  1ZMB A; 
#chains in the Genus database with same CATH homology
 1VQ5 P;  2M8P A;  3CXC O;  2PEI A;  1KD1 Q;  3DS5 A;  2L6E A;  3H47 A;  2OAR A;  3NTE A;  5F2N A;  1EIA A;  4XRQ A;  3CC7 P;  2PEO A;  2OTL P;  3DTJ A;  4U0C A;  4U0F A;  1VQM P;  1QVG O;  3G71 P;  3G29 A;  2M8N A;  4XFY A;  3CCQ P;  4U0D A;  1Q86 Q;  5BS2 A;  1KC8 Q;  1VQ6 P;  1D1D A;  3HYB A;  1VQL P;  1AUM A;  2XV6 A;  5HGM A;  3MGE A;  1K73 Q;  1EOQ A;  4GR2 A;  4XFX A;  5HGO A;  1YIT P;  5DCK A;  1VQN P;  2JO0 A;  4WYM A;  1YHQ P;  1BAJ A;  1VQO P;  2XT1 A;  2BUO A;  1W2B O;  4U0B A;  3CCJ P;  3OW2 O;  3P05 A;  2Z46 A;  4U0A A;  1S72 P;  4XFZ A;  5JPA A;  3M1M A;  1QRJ A;  3WBH A;  1VQ9 P;  3CCL P;  2LF4 A;  4PH1 A;  3G1G A;  3CPW O;  2EFJ A;  1JJ2 O;  1A43 A;  2M8L A;  4IPY A;  4XRO A;  1NJI Q;  1YI2 P;  3CCM P;  5HGN A;  3VRL C;  1YJ9 P;  3CCV P;  2E1M A;  2CWO A;  1YJW P;  4U0E A;  3CCU P;  2PEN A;  1M74 A;  4COC A;  3DS3 A;  2PEQ A;  2EG5 A;  1VQK P;  3G26 A;  3I56 P;  1A8O A;  1RNI A;  2EIA A;  1K9M Q;  4QNB A;  2BHV A;  1YJN P;  2DGY A;  3CCE P;  3DS2 A;  1IUQ A;  4M0I A;  3H4E A;  4PH0 A;  2ONT A;  3CMA P;  3G28 A;  3CC2 P;  2JYL A;  2Z45 A;  3I55 P;  1RO0 A;  3DS4 A;  3CD6 P;  3G21 A;  1Q7Y Q;  1M6E X;  3CME P;  1M6N A;  3G1I A;  1K30 A;  2QEX P;  2PY8 A;  1VQ7 P;  3G4S P;  2PEM A;  1YIJ P;  3G6E P;  3H0D A;  1KQS O;  3Q20 A;  3E2D A;  3B5I A;  3LRY A;  2KOD A;  4COP A;  1QVF O;  3CCR P;  3DS0 A;  2QA4 P;  1N8R Q;  2Z44 A;  2OTJ P;  1M1K Q;  2PEK A;  1VQ8 P;  2XXM A;  2PEJ A;  3CCS P;  1E6J P;  4GR6 A;  5F2K A;  1VQ4 P;  3G0V A;  1VQP P;  3DS1 A;  5HGL A;  2P9X A;  1K8A Q;  1Q82 Q;  3DPH A;  3RG6 C;  1M90 Q;  2JYG A;  5BS1 A;  1Q81 Q;  5F2O A;  3CC4 P;  1RO2 A;  5I4T G;  3HZQ A;  1ZMB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...