4IPYA

Hiv capsid c-terminal domain
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
85
structure length
85
Chain Sequence
PTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPGATLEEMMTACQGVGGPGHKARVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Capsid protein p24
publication title A triclinic crystal structure of the carboxy-terminal domain of HIV-1 capsid protein with four molecules in the asymmetric unit reveals a novel packing interface.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Viral protein
total genus 28
structure length 85
sequence length 85
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-01-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 4ipyA00
3G26A 4COPA 4M0IA 4XROA 2JYLA 3DS0A 1EIAA 3H47A 4XFXA 2BUOA 5DCKA 5HGLA 3LRYA 1QRJA 3DS5A 4U0CA 3NTEA 2XT1A 3VRLC 2L6EA 4XFYA 2JO0A 2JYGA 5HGMA 3DS1A 5HGNA 2ONTA 1AUMA 3G21A 3DTJA 2KODA 2M8PA 3DPHA 1D1DA 4WYMA 4U0AA 3DS4A 4IPYA 4PH0A 2M8NA 3G1IA 4XRQA 5I4TG 5JPAA 4U0FA 3G28A 2LF4A 2XV6A 4U0DA 3DS2A 1A8OA 4QNBA 4U0BA 4PH1A 2EIAA 3DS3A 4COCA 1BAJA 1E6JP 3G0VA 4XFZA 2M8LA 1EOQA 5HGOA 3G1GA 3P05A 3H4EA 4U0EA 1A43A 3MGEA 2XXMA 3G29A
chains in the Genus database with same CATH superfamily
2BUOA 1RNIA 1IMPA 3VRLC 4XFYA 4BPHA 1AUMA 2N50A 2MR8A 2CG5B 1F80D 5BS2A 2PEMA 3WBHA 2KG6A 1A8OA 3GJNA 1K73Q 4COCA 1KD1Q 1GXHA 1VQ8P 1VQOP 3RG6C 3G26A 1KQSO 5KP7B 1QVFO 2L9FA 1ZMBA 2LPKA 3CD6P 1KLPA 3CCMP 1E0HA 4WYMA 1UJZA 2PEQA 2KGAA 4U0FA 2FVEA 3CCUP 2M8LA 4XFZA 1IMQA 1HQBA 4MRTC 3GZLA 2PENA 2EHTA 2XXMA 4M0IA 2JYLA 2K94A 5EJDA 1Z6MA 1Q81Q 2K0XA 2CGQA 1HY8A 2L22A 4PH1A 2MD9A 2ERHA 3HYBA 2X2BA 3I56P 1EIAA 2LTEA 2KGCA 2PNGA 4U0CA 4H2YC 3CCQP 4UHPB 3EJBA 2KGDA 2KR5A 1VQLP 2MY5A 3E2DA 4DG9A 1NJIQ 4PXHB 5KP8B 1VHNA 2JBGA 1RO2A 2FHSC 1GXGA 3G6EP 3H0DA 2KW2A 2L4BA 2FVAA 2M5RA 4XROA 3I55P 4F37A 2XZ0D 2KOOA 1VQPP 2AF8A 2N5HA 3DPHA 1D1DA 5I4TG 1VQ5P 2K0YA 1FR2A 1MZ8A 1K30A 1E6JP 7CEIA 4H2WC 1NQ4A 4U0EA 1K9MQ 3GKLC 2FVFA 3H47A 4XFXA 2K0DX 1OR5A 1ZNVA 2JGPA 3CE7A 2KODA 2CQ8A 2GZIA 2LOLA 1JJ2O 1GPJA 2BHVA 4PWVB 2LF4A 2XV6A 5HVCA 4QKOA 1M6NA 1BAJA 2GZEA 1L0IA 2GDXA 1Q7YQ 2EG5A 2OTLP 3EJDA 2VLOA 1M74A 1AF8A 2LKIA 1YIJP 1K8AQ 1M6EX 2XZ1C 1YI2P 2ROQA 1A43A 1YJ9P 2QNWA 3CC2P 2JAZA 2WPTA 2Z44A 1M1KQ 4IZ6A 2JU2A 1S72P 1VKUA 2EFJA 3CCEP 1M90Q 2K92A 2MVVA 1ACPA 2CWOA 2N6YA 2LMLA 1DV5A 2N98A 2PY8A 2FQ0A 2DGYA 5F2OA 2KOPA 3G0VA 2Z46A 1N8RQ 5F2NA 2GDYA 2K93A 2GZFA 3CCSP 3LRYA 2OARA 3NTEA 2AVAA 5HGMA 4BPFA 1BXIA 3GZMA 1VQ7P 2LIWA 2M8PA 3M1MA 3HZQA 2KG8A 1IUQA 5HV8A 1YJNP 2VLPA 3CPWO 1VQ6P 3G29A 4COPA 1CEIA 4PH0A 3DS0A 2LL8A 2JYGA 2GZGA 4IPYA 2GDWA 3Q20A 3CCLP 2JB0A 2P9XA 3P05A 1KC8Q 2VLQA 1VQKP 2FQ2A 1AYIA 1Q82Q 5HGLA 4HKGA 2JU1A 2PEIA 1YITP 2NO8A 2AFDA 2FACA 4U0AA 1VQMP 2K5XA 2LIUA 4CA3A 3DS2A 2QA4P 3B5IA 4QNBA 3DS3A 2CNRA 1DNYA 3G1GA 3EJEA 2PEOA 1T8KA 2L0QA 2OTJP 2AFEA 2JO0A 3G21A 1L0HA 2M8NA 4NEOA 5JPAA 2N5IA 2QEXP 4U0DA 2Z45A 4BPGA 4R0MA 2JQ4A 1VQNP 2GZJA 2N6ZA 3CCVP 5HGNA 2L6EA 2DNWA 2ONTA 3NY7B 2KG9A 3G71P 3CC4P 1YHQP 3RG2A 3G28A 3CCJP 1VQ4P 1Q86Q 1W2BO 5HGOA 2GYKA 3OW2O 5EW5E 2EHSA 2KOQA 1QVGO 3DS5A 2PEKA 2XT1A 2VSQA 3CMAP 2FAEA 2MVUA 2FADA 3LMOA 2MF4A 4U0BA 2EIAA 2KORA 1X3OA 2PEJA 3U43A 1EMVA 3CCRP 1VQ9P 3CC7P 2KGEA 3DS1A 2KWLA 2MR7A 3DTJA 3DS4A 2K2QA 1UNKA 5F2KA 5CZDB 1EOQA 3B4QA 3MGEA 5DCKA 1YJWP 1QRJA 3CMEP 5KP6B 4H2XC 3G4SP 4GR2A 3G1IA 4XRQA 5BS1A 2E1MA 2KOSA 2FQ1A 1RO0A 4GR6A 3H4EA 3CXCO 2VLNA
chains in the Genus database with same CATH topology
5F2NA 4XROA 3I55P 3CCSP 2BUOA 3CCVP 3LRYA 1RNIA 2OARA 3NTEA 3VRLC 2L6EA 4XFYA 5HGNA 1VQPP 5HGMA 2ONTA 1AUMA 1VQ7P 3DPHA 2M8PA 3G71P 3CC4P 1D1DA 1YHQP 5BS2A 2PEMA 5I4TG 1VQ5P 3M1MA 3HZQA 3WBHA 3G28A 3CCJP 1IUQA 1A8OA 1K30A 1YJNP 1K73Q 4COCA 1KD1Q 1VQ4P 1Q86Q 1E6JP 1W2BO 5HGOA 3OW2O 4U0EA 1VQ8P 3CPWO 1VQOP 1K9MQ 3RG6C 1VQ6P 3G29A 3G26A 4COPA 4PH0A 3H47A 3DS0A 4XFXA 1QVGO 1KQSO 1QVFO 3DS5A 2PEKA 1ZMBA 2XT1A 2JYGA 3CD6P 2KODA 3CMAP 3CCMP 4WYMA 4IPYA 2PEQA 1JJ2O 4U0FA 2BHVA 2LF4A 2XV6A 3Q20A 3CCLP 4U0BA 2EIAA 1M6NA 3CCUP 1BAJA 2P9XA 4XFZA 2M8LA 1VQNP 2PEJA 3P05A 1KC8Q 1VQKP 2PENA 2XXMA 1Q7YQ 2EG5A 1Q82Q 4M0IA 5HGLA 2JYLA 2OTLP 3CCRP 1VQ9P 3CC7P 2PEIA 1Q81Q 3DS1A 1M74A 1YITP 3DTJA 1YIJP 4U0AA 3DS4A 1VQMP 1K8AQ 5F2KA 3DS2A 1M6EX 2QA4P 3B5IA 4QNBA 4PH1A 3DS3A 1EOQA 1YI2P 3G1GA 3HYBA 1A43A 3MGEA 1YJ9P 3I56P 3CC2P 5DCKA 1YJWP 1EIAA 2PEOA 2Z44A 1QRJA 1M1KQ 4U0CA 3CMEP 1S72P 2OTJP 3CCQP 2JO0A 3G21A 3G4SP 2EFJA 3CCEP 1M90Q 1VQLP 4GR2A 2M8NA 3G1IA 4XRQA 2CWOA 5JPAA 5BS1A 3E2DA 2E1MA 1NJIQ 2QEXP 4U0DA 2PY8A 2DGYA 2Z45A 5F2OA 3G0VA 2Z46A 1RO0A 4GR6A 1RO2A 3H4EA 3CXCO 3G6EP 3H0DA 1N8RQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G26 A;  4COP A;  4M0I A;  4XRO A;  2JYL A;  3DS0 A;  1EIA A;  3H47 A;  4XFX A;  2BUO A;  5DCK A;  5HGL A;  3LRY A;  1QRJ A;  3DS5 A;  4U0C A;  3NTE A;  2XT1 A;  3VRL C;  2L6E A;  4XFY A;  2JO0 A;  2JYG A;  5HGM A;  3DS1 A;  5HGN A;  2ONT A;  1AUM A;  3G21 A;  3DTJ A;  2KOD A;  2M8P A;  3DPH A;  1D1D A;  4WYM A;  4U0A A;  3DS4 A;  4IPY A;  4PH0 A;  2M8N A;  3G1I A;  4XRQ A;  5I4T G;  5JPA A;  4U0F A;  3G28 A;  2LF4 A;  2XV6 A;  4U0D A;  3DS2 A;  1A8O A;  4QNB A;  4U0B A;  4PH1 A;  2EIA A;  3DS3 A;  4COC A;  1BAJ A;  1E6J P;  3G0V A;  4XFZ A;  2M8L A;  1EOQ A;  5HGO A;  3G1G A;  3P05 A;  3H4E A;  4U0E A;  1A43 A;  3MGE A;  2XXM A;  3G29 A; 
#chains in the Genus database with same CATH topology
 2BUO A;  1RNI A;  1IMP A;  3VRL C;  4XFY A;  4BPH A;  1AUM A;  2N50 A;  2MR8 A;  2CG5 B;  1F80 D;  5BS2 A;  2PEM A;  3WBH A;  2KG6 A;  1A8O A;  3GJN A;  1K73 Q;  4COC A;  1KD1 Q;  1GXH A;  1VQ8 P;  1VQO P;  3RG6 C;  3G26 A;  1KQS O;  5KP7 B;  1QVF O;  2L9F A;  1ZMB A;  2LPK A;  3CD6 P;  1KLP A;  3CCM P;  1E0H A;  4WYM A;  1UJZ A;  2PEQ A;  2KGA A;  4U0F A;  2FVE A;  3CCU P;  2M8L A;  4XFZ A;  1IMQ A;  1HQB A;  4MRT C;  3GZL A;  2PEN A;  2EHT A;  2XXM A;  4M0I A;  2JYL A;  2K94 A;  5EJD A;  1Z6M A;  1Q81 Q;  2K0X A;  2CGQ A;  1HY8 A;  2L22 A;  4PH1 A;  2MD9 A;  2ERH A;  3HYB A;  2X2B A;  3I56 P;  1EIA A;  2LTE A;  2KGC A;  2PNG A;  4U0C A;  4H2Y C;  3CCQ P;  4UHP B;  3EJB A;  2KGD A;  2KR5 A;  1VQL P;  2MY5 A;  3E2D A;  4DG9 A;  1NJI Q;  4PXH B;  5KP8 B;  1VHN A;  2JBG A;  1RO2 A;  2FHS C;  1GXG A;  3G6E P;  3H0D A;  2KW2 A;  2L4B A;  2FVA A;  2M5R A;  4XRO A;  3I55 P;  4F37 A;  2XZ0 D;  2KOO A;  1VQP P;  2AF8 A;  2N5H A;  3DPH A;  1D1D A;  5I4T G;  1VQ5 P;  2K0Y A;  1FR2 A;  1MZ8 A;  1K30 A;  1E6J P;  7CEI A;  4H2W C;  1NQ4 A;  4U0E A;  1K9M Q;  3GKL C;  2FVF A;  3H47 A;  4XFX A;  2K0D X;  1OR5 A;  1ZNV A;  2JGP A;  3CE7 A;  2KOD A;  2CQ8 A;  2GZI A;  2LOL A;  1JJ2 O;  1GPJ A;  2BHV A;  4PWV B;  2LF4 A;  2XV6 A;  5HVC A;  4QKO A;  1M6N A;  1BAJ A;  2GZE A;  1L0I A;  2GDX A;  1Q7Y Q;  2EG5 A;  2OTL P;  3EJD A;  2VLO A;  1M74 A;  1AF8 A;  2LKI A;  1YIJ P;  1K8A Q;  1M6E X;  2XZ1 C;  1YI2 P;  2ROQ A;  1A43 A;  1YJ9 P;  2QNW A;  3CC2 P;  2JAZ A;  2WPT A;  2Z44 A;  1M1K Q;  4IZ6 A;  2JU2 A;  1S72 P;  1VKU A;  2EFJ A;  3CCE P;  1M90 Q;  2K92 A;  2MVV A;  1ACP A;  2CWO A;  2N6Y A;  2LML A;  1DV5 A;  2N98 A;  2PY8 A;  2FQ0 A;  2DGY A;  5F2O A;  2KOP A;  3G0V A;  2Z46 A;  1N8R Q;  5F2N A;  2GDY A;  2K93 A;  2GZF A;  3CCS P;  3LRY A;  2OAR A;  3NTE A;  2AVA A;  5HGM A;  4BPF A;  1BXI A;  3GZM A;  1VQ7 P;  2LIW A;  2M8P A;  3M1M A;  3HZQ A;  2KG8 A;  1IUQ A;  5HV8 A;  1YJN P;  2VLP A;  3CPW O;  1VQ6 P;  3G29 A;  4COP A;  1CEI A;  4PH0 A;  3DS0 A;  2LL8 A;  2JYG A;  2GZG A;  4IPY A;  2GDW A;  3Q20 A;  3CCL P;  2JB0 A;  2P9X A;  3P05 A;  1KC8 Q;  2VLQ A;  1VQK P;  2FQ2 A;  1AYI A;  1Q82 Q;  5HGL A;  4HKG A;  2JU1 A;  2PEI A;  1YIT P;  2NO8 A;  2AFD A;  2FAC A;  4U0A A;  1VQM P;  2K5X A;  2LIU A;  4CA3 A;  3DS2 A;  2QA4 P;  3B5I A;  4QNB A;  3DS3 A;  2CNR A;  1DNY A;  3G1G A;  3EJE A;  2PEO A;  1T8K A;  2L0Q A;  2OTJ P;  2AFE A;  2JO0 A;  3G21 A;  1L0H A;  2M8N A;  4NEO A;  5JPA A;  2N5I A;  2QEX P;  4U0D A;  2Z45 A;  4BPG A;  4R0M A;  2JQ4 A;  1VQN P;  2GZJ A;  2N6Z A;  3CCV P;  5HGN A;  2L6E A;  2DNW A;  2ONT A;  3NY7 B;  2KG9 A;  3G71 P;  3CC4 P;  1YHQ P;  3RG2 A;  3G28 A;  3CCJ P;  1VQ4 P;  1Q86 Q;  1W2B O;  5HGO A;  2GYK A;  3OW2 O;  5EW5 E;  2EHS A;  2KOQ A;  1QVG O;  3DS5 A;  2PEK A;  2XT1 A;  2VSQ A;  3CMA P;  2FAE A;  2MVU A;  2FAD A;  3LMO A;  2MF4 A;  4U0B A;  2EIA A;  2KOR A;  1X3O A;  2PEJ A;  3U43 A;  1EMV A;  3CCR P;  1VQ9 P;  3CC7 P;  2KGE A;  3DS1 A;  2KWL A;  2MR7 A;  3DTJ A;  3DS4 A;  2K2Q A;  1UNK A;  5F2K A;  5CZD B;  1EOQ A;  3B4Q A;  3MGE A;  5DCK A;  1YJW P;  1QRJ A;  3CME P;  5KP6 B;  4H2X C;  3G4S P;  4GR2 A;  3G1I A;  4XRQ A;  5BS1 A;  2E1M A;  2KOS A;  2FQ1 A;  1RO0 A;  4GR6 A;  3H4E A;  3CXC O;  2VLN A; 
#chains in the Genus database with same CATH homology
 5F2N A;  4XRO A;  3I55 P;  3CCS P;  2BUO A;  3CCV P;  3LRY A;  1RNI A;  2OAR A;  3NTE A;  3VRL C;  2L6E A;  4XFY A;  5HGN A;  1VQP P;  5HGM A;  2ONT A;  1AUM A;  1VQ7 P;  3DPH A;  2M8P A;  3G71 P;  3CC4 P;  1D1D A;  1YHQ P;  5BS2 A;  2PEM A;  5I4T G;  1VQ5 P;  3M1M A;  3HZQ A;  3WBH A;  3G28 A;  3CCJ P;  1IUQ A;  1A8O A;  1K30 A;  1YJN P;  1K73 Q;  4COC A;  1KD1 Q;  1VQ4 P;  1Q86 Q;  1E6J P;  1W2B O;  5HGO A;  3OW2 O;  4U0E A;  1VQ8 P;  3CPW O;  1VQO P;  1K9M Q;  3RG6 C;  1VQ6 P;  3G29 A;  3G26 A;  4COP A;  4PH0 A;  3H47 A;  3DS0 A;  4XFX A;  1QVG O;  1KQS O;  1QVF O;  3DS5 A;  2PEK A;  1ZMB A;  2XT1 A;  2JYG A;  3CD6 P;  2KOD A;  3CMA P;  3CCM P;  4WYM A;  4IPY A;  2PEQ A;  1JJ2 O;  4U0F A;  2BHV A;  2LF4 A;  2XV6 A;  3Q20 A;  3CCL P;  4U0B A;  2EIA A;  1M6N A;  3CCU P;  1BAJ A;  2P9X A;  4XFZ A;  2M8L A;  1VQN P;  2PEJ A;  3P05 A;  1KC8 Q;  1VQK P;  2PEN A;  2XXM A;  1Q7Y Q;  2EG5 A;  1Q82 Q;  4M0I A;  5HGL A;  2JYL A;  2OTL P;  3CCR P;  1VQ9 P;  3CC7 P;  2PEI A;  1Q81 Q;  3DS1 A;  1M74 A;  1YIT P;  3DTJ A;  1YIJ P;  4U0A A;  3DS4 A;  1VQM P;  1K8A Q;  5F2K A;  3DS2 A;  1M6E X;  2QA4 P;  3B5I A;  4QNB A;  4PH1 A;  3DS3 A;  1EOQ A;  1YI2 P;  3G1G A;  3HYB A;  1A43 A;  3MGE A;  1YJ9 P;  3I56 P;  3CC2 P;  5DCK A;  1YJW P;  1EIA A;  2PEO A;  2Z44 A;  1QRJ A;  1M1K Q;  4U0C A;  3CME P;  1S72 P;  2OTJ P;  3CCQ P;  2JO0 A;  3G21 A;  3G4S P;  2EFJ A;  3CCE P;  1M90 Q;  1VQL P;  4GR2 A;  2M8N A;  3G1I A;  4XRQ A;  2CWO A;  5JPA A;  5BS1 A;  3E2D A;  2E1M A;  1NJI Q;  2QEX P;  4U0D A;  2PY8 A;  2DGY A;  2Z45 A;  5F2O A;  3G0V A;  2Z46 A;  1RO0 A;  4GR6 A;  1RO2 A;  3H4E A;  3CXC O;  3G6E P;  3H0D A;  1N8R Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...