4IPYA

Hiv capsid c-terminal domain
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
85
structure length
85
Chain Sequence
b'PTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPGATLEEMMTACQGVGGPGHKARVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Capsid protein p24
publication title A triclinic crystal structure of the carboxy-terminal domain of HIV-1 capsid protein with four molecules in the asymmetric unit reveals a novel packing interface.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Viral protein
total genus 28
structure length 85
sequence length 85
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-01-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 4ipyA00
2JO0A 5HGMA 4WYMA 4PH0A 3DS4A 1EOQA 4XFXA 5HGNA 4U0FA 4COPA 3G29A 2L6EA 4PH1A 2JYGA 2M8NA 3DS5A 2XV6A 3G26A 1EIAA 2BUOA 5JPAA 3MGEA 2EIAA 2ONTA 3LRYA 2M8PA 4M0IA 5I4TG 2KODA 3H4EA 3NTEA 3G0VA 4U0EA 3H47A 1A8OA 4U0CA 1D1DA 4IPYA 2JYLA 2XXMA 4U0AA 2M8LA 5HGOA 1BAJA 1E6JP 4XFZA 2LF4A 3DPHA 3DS3A 2XT1A 5HGLA 1QRJA 4QNBA 1AUMA 4XRQA 3G1GA 4COCA 5DCKA 3G28A 3P05A 4XROA 1A43A 4U0DA 3DS0A 4U0BA 3G1IA 3DS1A 3DS2A 4XFYA 3G21A 3DTJA 3VRLC
chains in the Genus database with same CATH superfamily
5HGMA 1BXIA 1VKUA 2VSQA 3DS5A 4F37A 1AYIA 4U0EA 2LTEA 1YI2P 1F80D 3CXCO 2PEIA 1S72P 1A43A 5F2OA 2JU1A 2JO0A 1N8RQ 2KR5A 1Z6MA 2KGEA 3RG6C 1RNIA 1KLPA 4GR2A 4H2YC 2KODA 4BPHA 2JYLA 1KC8Q 1YJWP 3CMEP 2KG6A 1HY8A 2LKIA 3M1MA 1VQ9P 4U0BA 2KGCA 3DS2A 2XZ1C 2FVEA 4UHPB 1QVGO 2ONTA 3GZMA 5I4TG 1VHNA 3Q20A 1K8AQ 2KG9A 1K30A 2GZGA 2XXMA 2DNWA 2K93A 2AFDA 3DPHA 3HZQA 1YHQP 2LMLA 2QNWA 1Q86Q 5EW5E 3GJNA 2PENA 1IUQA 2QA4P 2EG5A 2FAEA 2PY8A 1EIAA 3B5IA 2LOLA 4U0CA 2LIUA 5KP8B 1NQ4A 3CCVP 2DGYA 2EHSA 2PEQA 3CPWO 5BS2A 3GKLC 3RG2A 2QEXP 2CNRA 2MF4A 2L4BA 2JU2A 2GZFA 2JQ4A 1VQ5P 1YJNP 2PNGA 2L9FA 2ERHA 2EIAA 3EJEA 3EJDA 1M6EX 2LL8A 2K2QA 2MVVA 1YITP 2KGAA 1K73Q 4COCA 3P05A 3DS0A 4U0DA 3VRLC 3G4SP 1VQOP 2MD9A 2KOPA 2Z44A 2Z45A 1YIJP 3LRYA 1VQMP 2FACA 2CGQA 1AF8A 1EMVA 1A8OA 4H2WC 3CE7A 1W2BO 3CCJP 1ACPA 1QRJA 4PXHB 5KP7B 3HYBA 3CCEP 2MVUA 3OW2O 4WYMA 3GZLA 2WPTA 1M1KQ 2N6YA 2K0DX 2N50A 2Z46A 1UJZA 2GDWA 2PEJA 5HV8A 2N98A 1GXHA 4U0AA 5HGOA 2GDYA 2AF8A 1CEIA 2XT1A 1ZMBA 4IZ6A 2JGPA 1K9MQ 2L22A 2PEMA 2PEOA 2XV6A 3G26A 2BUOA 2VLNA 3EJBA 3B4QA 3I55P 3H47A 3CCLP 3CC7P 5HGLA 4XROA 4MRTC 3G21A 2FQ0A 1UNKA 3DS4A 4U0FA 4PH1A 2AFEA 2N5HA 2GDXA 1IMPA 3G6EP 1GPJA 2CWOA 3DS3A 3G71P 2E1MA 3G28A 1MZ8A 3G1IA 2K0YA 4XFYA 3H0DA 2FVFA 3E2DA 1VQLP 2L6EA 2M8NA 2KOQA 2EFJA 2VLOA 4GR6A 4IPYA 4QKOA 1E6JP 2MR7A 1Q82Q 4BPGA 1ZNVA 2LF4A 1VQPP 4QNBA 1AUMA 5HVCA 1VQ7P 2FVAA 2GYKA 2GZEA 1X3OA 5F2KA 2MY5A 2VLQA 1RO0A 1IMQA 5F2NA 4PWVB 1Q81Q 1DV5A 7CEIA 2OTLP 2VLPA 2KGDA 2M8LA 1E0HA 5HGNA 2L0QA 5KP6B 2KG8A 1M74A 2K5XA 1M6NA 1KQSO 4H2XC 4M0IA 1L0IA 2X2BA 1GXGA 4XFZA 2OTJP 1Q7YQ 1HQBA 2M5RA 2MR8A 2P9XA 5DCKA 3WBHA 4NEOA 1VQ6P 5CZDB 4CA3A 1T8KA 4XRQA 3DTJA 1JJ2O 1EOQA 2JAZA 3CCSP 4HKGA 3NY7B 2K0XA 1DNYA 3LMOA 2CQ8A 1VQNP 1VQKP 3G0VA 3CCQP 3I56P 1VQ8P 2EHTA 1QVFO 3G1GA 2FHSC 1VQ4P 2LPKA 4PH0A 2N6ZA 1NJIQ 2JYGA 3CCUP 5JPAA 1FR2A 2AVAA 2KOOA 3NTEA 1D1DA 2PEKA 4DG9A 2BHVA 2KW2A 2K92A 4R0MA 2GZJA 1RO2A 4XFXA 2FQ2A 4COPA 3G29A 2GZIA 4BPFA 1M90Q 3CC4P 3H4EA 3CD6P 1L0HA 2NO8A 2CG5B 1KD1Q 3CC2P 3DS1A 2FQ1A 3CCRP 2KWLA 5BS1A 3MGEA 2M8PA 2JB0A 1YJ9P 3U43A 2LIWA 2JBGA 2XZ0D 1BAJA 1OR5A 2FADA 2N5IA 2KORA 2KOSA 2OARA 3CCMP 5EJDA 3CMAP 2K94A 2ROQA
chains in the Genus database with same CATH topology
5HGMA 1JJ2O 3DS4A 1EOQA 3CCSP 4U0FA 4PH1A 1VQ5P 1YJNP 3DS5A 2EIAA 1VQNP 4U0EA 1VQKP 3G0VA 1M6EX 3G6EP 3CCQP 3I56P 1VQ8P 2CWOA 1YI2P 1YITP 3DS3A 3G71P 3CXCO 1K73Q 4COCA 2E1MA 3G1GA 2PEIA 1S72P 3G28A 1QVFO 3P05A 1A43A 5F2OA 3DS0A 1VQ4P 3G1IA 4U0DA 4XFYA 3VRLC 2JO0A 3H0DA 4PH0A 3G4SP 1N8RQ 3E2DA 1VQOP 1NJIQ 1VQLP 2L6EA 3RG6C 1RNIA 2JYGA 2Z44A 2M8NA 2Z45A 1YIJP 3CCUP 4GR2A 5JPAA 3LRYA 1VQMP 2KODA 3NTEA 2EFJA 1A8OA 4GR6A 1D1DA 4IPYA 2JYLA 1KC8Q 1YJWP 2PEKA 3CMEP 1W2BO 1E6JP 1Q82Q 2LF4A 3CCJP 1VQPP 3M1MA 1QRJA 1VQ9P 4QNBA 1AUMA 2BHVA 4XRQA 3HYBA 1VQ7P 4U0BA 3DS2A 3CCEP 1RO2A 4WYMA 3OW2O 4XFXA 4COPA 3G29A 1M1KQ 5F2KA 2Z46A 2ONTA 1QVGO 1RO0A 1M90Q 5F2NA 5I4TG 3CC4P 3H4EA 3CD6P 3Q20A 1K8AQ 2PEJA 1K30A 2XXMA 4U0AA 1Q81Q 5HGOA 3DPHA 3HZQA 2XT1A 1YHQP 1ZMBA 1KD1Q 2OTLP 1Q86Q 3CC2P 3DS1A 2M8LA 1K9MQ 5HGNA 2PENA 1IUQA 3CCRP 2QA4P 2PEMA 2EG5A 2PEOA 5BS1A 2PY8A 2XV6A 3G26A 1EIAA 1M74A 2BUOA 3B5IA 3MGEA 1M6NA 1KQSO 2M8PA 4M0IA 3I55P 1YJ9P 3H47A 4U0CA 3CCLP 1BAJA 4XFZA 2OTJP 3CC7P 1Q7YQ 2DGYA 5HGLA 3CCVP 2PEQA 3CPWO 5BS2A 2OARA 2P9XA 5DCKA 3WBHA 3CCMP 1VQ6P 4XROA 3CMAP 2QEXP 3G21A 3DTJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JO0 A;  5HGM A;  4WYM A;  4PH0 A;  3DS4 A;  1EOQ A;  4XFX A;  5HGN A;  4U0F A;  4COP A;  3G29 A;  2L6E A;  4PH1 A;  2JYG A;  2M8N A;  3DS5 A;  2XV6 A;  3G26 A;  1EIA A;  2BUO A;  5JPA A;  3MGE A;  2EIA A;  2ONT A;  3LRY A;  2M8P A;  4M0I A;  5I4T G;  2KOD A;  3H4E A;  3NTE A;  3G0V A;  4U0E A;  3H47 A;  1A8O A;  4U0C A;  1D1D A;  4IPY A;  2JYL A;  2XXM A;  4U0A A;  2M8L A;  5HGO A;  1BAJ A;  1E6J P;  4XFZ A;  2LF4 A;  3DPH A;  3DS3 A;  2XT1 A;  5HGL A;  1QRJ A;  4QNB A;  1AUM A;  4XRQ A;  3G1G A;  4COC A;  5DCK A;  3G28 A;  3P05 A;  4XRO A;  1A43 A;  4U0D A;  3DS0 A;  4U0B A;  3G1I A;  3DS1 A;  3DS2 A;  4XFY A;  3G21 A;  3DTJ A;  3VRL C; 
#chains in the Genus database with same CATH topology
 5HGM A;  1BXI A;  1VKU A;  2VSQ A;  3DS5 A;  4F37 A;  1AYI A;  4U0E A;  2LTE A;  1YI2 P;  1F80 D;  3CXC O;  2PEI A;  1S72 P;  1A43 A;  5F2O A;  2JU1 A;  2JO0 A;  1N8R Q;  2KR5 A;  1Z6M A;  2KGE A;  3RG6 C;  1RNI A;  1KLP A;  4GR2 A;  4H2Y C;  2KOD A;  4BPH A;  2JYL A;  1KC8 Q;  1YJW P;  3CME P;  2KG6 A;  1HY8 A;  2LKI A;  3M1M A;  1VQ9 P;  4U0B A;  2KGC A;  3DS2 A;  2XZ1 C;  2FVE A;  4UHP B;  1QVG O;  2ONT A;  3GZM A;  5I4T G;  1VHN A;  3Q20 A;  1K8A Q;  2KG9 A;  1K30 A;  2GZG A;  2XXM A;  2DNW A;  2K93 A;  2AFD A;  3DPH A;  3HZQ A;  1YHQ P;  2LML A;  2QNW A;  1Q86 Q;  5EW5 E;  3GJN A;  2PEN A;  1IUQ A;  2QA4 P;  2EG5 A;  2FAE A;  2PY8 A;  1EIA A;  3B5I A;  2LOL A;  4U0C A;  2LIU A;  5KP8 B;  1NQ4 A;  3CCV P;  2DGY A;  2EHS A;  2PEQ A;  3CPW O;  5BS2 A;  3GKL C;  3RG2 A;  2QEX P;  2CNR A;  2MF4 A;  2L4B A;  2JU2 A;  2GZF A;  2JQ4 A;  1VQ5 P;  1YJN P;  2PNG A;  2L9F A;  2ERH A;  2EIA A;  3EJE A;  3EJD A;  1M6E X;  2LL8 A;  2K2Q A;  2MVV A;  1YIT P;  2KGA A;  1K73 Q;  4COC A;  3P05 A;  3DS0 A;  4U0D A;  3VRL C;  3G4S P;  1VQO P;  2MD9 A;  2KOP A;  2Z44 A;  2Z45 A;  1YIJ P;  3LRY A;  1VQM P;  2FAC A;  2CGQ A;  1AF8 A;  1EMV A;  1A8O A;  4H2W C;  3CE7 A;  1W2B O;  3CCJ P;  1ACP A;  1QRJ A;  4PXH B;  5KP7 B;  3HYB A;  3CCE P;  2MVU A;  3OW2 O;  4WYM A;  3GZL A;  2WPT A;  1M1K Q;  2N6Y A;  2K0D X;  2N50 A;  2Z46 A;  1UJZ A;  2GDW A;  2PEJ A;  5HV8 A;  2N98 A;  1GXH A;  4U0A A;  5HGO A;  2GDY A;  2AF8 A;  1CEI A;  2XT1 A;  1ZMB A;  4IZ6 A;  2JGP A;  1K9M Q;  2L22 A;  2PEM A;  2PEO A;  2XV6 A;  3G26 A;  2BUO A;  2VLN A;  3EJB A;  3B4Q A;  3I55 P;  3H47 A;  3CCL P;  3CC7 P;  5HGL A;  4XRO A;  4MRT C;  3G21 A;  2FQ0 A;  1UNK A;  3DS4 A;  4U0F A;  4PH1 A;  2AFE A;  2N5H A;  2GDX A;  1IMP A;  3G6E P;  1GPJ A;  2CWO A;  3DS3 A;  3G71 P;  2E1M A;  3G28 A;  1MZ8 A;  3G1I A;  2K0Y A;  4XFY A;  3H0D A;  2FVF A;  3E2D A;  1VQL P;  2L6E A;  2M8N A;  2KOQ A;  2EFJ A;  2VLO A;  4GR6 A;  4IPY A;  4QKO A;  1E6J P;  2MR7 A;  1Q82 Q;  4BPG A;  1ZNV A;  2LF4 A;  1VQP P;  4QNB A;  1AUM A;  5HVC A;  1VQ7 P;  2FVA A;  2GYK A;  2GZE A;  1X3O A;  5F2K A;  2MY5 A;  2VLQ A;  1RO0 A;  1IMQ A;  5F2N A;  4PWV B;  1Q81 Q;  1DV5 A;  7CEI A;  2OTL P;  2VLP A;  2KGD A;  2M8L A;  1E0H A;  5HGN A;  2L0Q A;  5KP6 B;  2KG8 A;  1M74 A;  2K5X A;  1M6N A;  1KQS O;  4H2X C;  4M0I A;  1L0I A;  2X2B A;  1GXG A;  4XFZ A;  2OTJ P;  1Q7Y Q;  1HQB A;  2M5R A;  2MR8 A;  2P9X A;  5DCK A;  3WBH A;  4NEO A;  1VQ6 P;  5CZD B;  4CA3 A;  1T8K A;  4XRQ A;  3DTJ A;  1JJ2 O;  1EOQ A;  2JAZ A;  3CCS P;  4HKG A;  3NY7 B;  2K0X A;  1DNY A;  3LMO A;  2CQ8 A;  1VQN P;  1VQK P;  3G0V A;  3CCQ P;  3I56 P;  1VQ8 P;  2EHT A;  1QVF O;  3G1G A;  2FHS C;  1VQ4 P;  2LPK A;  4PH0 A;  2N6Z A;  1NJI Q;  2JYG A;  3CCU P;  5JPA A;  1FR2 A;  2AVA A;  2KOO A;  3NTE A;  1D1D A;  2PEK A;  4DG9 A;  2BHV A;  2KW2 A;  2K92 A;  4R0M A;  2GZJ A;  1RO2 A;  4XFX A;  2FQ2 A;  4COP A;  3G29 A;  2GZI A;  4BPF A;  1M90 Q;  3CC4 P;  3H4E A;  3CD6 P;  1L0H A;  2NO8 A;  2CG5 B;  1KD1 Q;  3CC2 P;  3DS1 A;  2FQ1 A;  3CCR P;  2KWL A;  5BS1 A;  3MGE A;  2M8P A;  2JB0 A;  1YJ9 P;  3U43 A;  2LIW A;  2JBG A;  2XZ0 D;  1BAJ A;  1OR5 A;  2FAD A;  2N5I A;  2KOR A;  2KOS A;  2OAR A;  3CCM P;  5EJD A;  3CMA P;  2K94 A;  2ROQ A; 
#chains in the Genus database with same CATH homology
 5HGM A;  1JJ2 O;  3DS4 A;  1EOQ A;  3CCS P;  4U0F A;  4PH1 A;  1VQ5 P;  1YJN P;  3DS5 A;  2EIA A;  1VQN P;  4U0E A;  1VQK P;  3G0V A;  1M6E X;  3G6E P;  3CCQ P;  3I56 P;  1VQ8 P;  2CWO A;  1YI2 P;  1YIT P;  3DS3 A;  3G71 P;  3CXC O;  1K73 Q;  4COC A;  2E1M A;  3G1G A;  2PEI A;  1S72 P;  3G28 A;  1QVF O;  3P05 A;  1A43 A;  5F2O A;  3DS0 A;  1VQ4 P;  3G1I A;  4U0D A;  4XFY A;  3VRL C;  2JO0 A;  3H0D A;  4PH0 A;  3G4S P;  1N8R Q;  3E2D A;  1VQO P;  1NJI Q;  1VQL P;  2L6E A;  3RG6 C;  1RNI A;  2JYG A;  2Z44 A;  2M8N A;  2Z45 A;  1YIJ P;  3CCU P;  4GR2 A;  5JPA A;  3LRY A;  1VQM P;  2KOD A;  3NTE A;  2EFJ A;  1A8O A;  4GR6 A;  1D1D A;  4IPY A;  2JYL A;  1KC8 Q;  1YJW P;  2PEK A;  3CME P;  1W2B O;  1E6J P;  1Q82 Q;  2LF4 A;  3CCJ P;  1VQP P;  3M1M A;  1QRJ A;  1VQ9 P;  4QNB A;  1AUM A;  2BHV A;  4XRQ A;  3HYB A;  1VQ7 P;  4U0B A;  3DS2 A;  3CCE P;  1RO2 A;  4WYM A;  3OW2 O;  4XFX A;  4COP A;  3G29 A;  1M1K Q;  5F2K A;  2Z46 A;  2ONT A;  1QVG O;  1RO0 A;  1M90 Q;  5F2N A;  5I4T G;  3CC4 P;  3H4E A;  3CD6 P;  3Q20 A;  1K8A Q;  2PEJ A;  1K30 A;  2XXM A;  4U0A A;  1Q81 Q;  5HGO A;  3DPH A;  3HZQ A;  2XT1 A;  1YHQ P;  1ZMB A;  1KD1 Q;  2OTL P;  1Q86 Q;  3CC2 P;  3DS1 A;  2M8L A;  1K9M Q;  5HGN A;  2PEN A;  1IUQ A;  3CCR P;  2QA4 P;  2PEM A;  2EG5 A;  2PEO A;  5BS1 A;  2PY8 A;  2XV6 A;  3G26 A;  1EIA A;  1M74 A;  2BUO A;  3B5I A;  3MGE A;  1M6N A;  1KQS O;  2M8P A;  4M0I A;  3I55 P;  1YJ9 P;  3H47 A;  4U0C A;  3CCL P;  1BAJ A;  4XFZ A;  2OTJ P;  3CC7 P;  1Q7Y Q;  2DGY A;  5HGL A;  3CCV P;  2PEQ A;  3CPW O;  5BS2 A;  2OAR A;  2P9X A;  5DCK A;  3WBH A;  3CCM P;  1VQ6 P;  4XRO A;  3CMA P;  2QEX P;  3G21 A;  3DTJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...