2FQ2A

Solution structure of minor conformation of holo-acyl carrier protein from malaria parasite plasmodium falciparum
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
79
structure length
79
Chain Sequence
LKSTFDDIKKIISKQLSVEEDKIQMNSNFTKDLGADSLDLVELIMALEEKFNVTISDQDALKINTVQDAIDYIEKNNKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords acyl carrier protein
publication title Solution structures of conformationally equilibrium forms of holo-acyl carrier protein (PfACP) from Plasmodium falciparum provides insight into the mechanism of activation of ACPs
pubmed doi rcsb
source organism Plasmodium falciparum 3d7
molecule tags Lipid transport
total genus 15
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2006-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2fq2A00
2DNWA 4H2YC 2MR8A 2KGAA 2FAEA 2K92A 5EJDA 2AVAA 2KR5A 5CZDB 2KGDA 1HQBA 2EHTA 2LIUA 2KOOA 2JU1A 4MRTC 2N5IA 1VKUA 2CNRA 2AFEA 4CA3A 2FACA 3GZMA 3NY7B 2FVAA 4H2WC 2KG9A 2KORA 2KGEA 2JQ4A 2CGQA 2L0QA 2X2BA 2N98A 2JGPA 5KP8B 2FVFA 2FHSC 2XZ0D 1ACPA 2KOQA 5HV8A 2N6YA 2VSQA 1KLPA 3LMOA 5KP7B 1HY8A 2XZ1C 2MR7A 2JU2A 1AF8A 2CQ8A 2LIWA 2LMLA 2FVEA 2MY5A 5HVCA 1OR5A 2GDYA 2MD9A 4BPGA 4BPHA 2GDWA 2AF8A 1NQ4A 2L4BA 2QNWA 2M5RA 2KOSA 4PXHB 2N50A 2MVVA 2L22A 4BPFA 1L0HA 2N5HA 1DNYA 4H2XC 4DG9A 2KG6A 2FQ1A 2KOPA 2LOLA 2FADA 2GDXA 2LTEA 3RG2A 3EJBA 1L0IA 2KG8A 3CE7A 2EHSA 4NEOA 2CG5B 2K2QA 2MVUA 2LKIA 2AFDA 1DV5A 2PNGA 1X3OA 2KW2A 5KP6B 2ROQA 2LPKA 4IZ6A 4HKGA 2K94A 1F80D 3EJDA 4R0MA 2KWLA 2FQ2A 2K93A 4PWVB 2MF4A 2LL8A 1T8KA 2K0XA 2FQ0A 2KGCA 2K0YA 2N6ZA 2L9FA 3GZLA 3EJEA
chains in the Genus database with same CATH superfamily
1QRJA 4H2YC 1Z6MA 2K92A 1K30A 2AVAA 2KR5A 2JO0A 3DS2A 1HQBA 2PEQA 3CCVP 3CMEP 3G28A 1QVGO 2EIAA 3WBHA 1VKUA 2CNRA 2FVAA 1AYIA 1E0HA 1EOQA 2KG9A 2KORA 3CPWO 4GR2A 3H47A 4F37A 2N98A 2JGPA 2E1MA 2XZ0D 2KOQA 5HV8A 1VQ6P 2DGYA 2VLNA 1AF8A 2LMLA 5HVCA 2BHVA 2GDYA 2M8LA 3DS5A 1JJ2O 4COPA 4XFXA 2XXMA 2L4BA 1M90Q 2M5RA 4BPFA 2N5HA 4H2XC 2KG6A 3VRLC 3G29A 2FADA 2GZJA 5HGOA 2GDXA 2LTEA 4XROA 3RG2A 3CC4P 1A8OA 2VLOA 2CG5B 1BXIA 2LKIA 3CCEP 2AFDA 1X3OA 3CCSP 2KODA 2ROQA 2LPKA 3GKLC 4IZ6A 2K94A 1KD1Q 2PEJA 1M6EX 3EJDA 1N8RQ 3E2DA 2M8PA 2K93A 4COCA 3MGEA 2BUOA 2FQ0A 2K0YA 3EJEA 2DNWA 5DCKA 2KGDA 1GPJA 1VQ7P 1YJWP 1FR2A 2JU1A 4U0BA 3M1MA 5JPAA 3CD6P 1AUMA 1YJNP 1RNIA 3G6EP 1K73Q 2AFEA 2Z46A 2FACA 3GZMA 3NY7B 2ERHA 3CCLP 2CWOA 2PEOA 4IPYA 2JAZA 2JQ4A 1Q82Q 2K0DX 3OW2O 2X2BA 1RO2A 2FVFA 2FHSC 5HGLA 2GZGA 2GZEA 1Q86Q 2XZ1C 1YITP 2MR7A 1IMPA 1OR5A 4BPHA 2Z45A 4PXHB 2N50A 2MVVA 4U0AA 2EG5A 2PEMA 4PH1A 2KOPA 1VQPP 1ZMBA 2KG8A 2EHSA 5EW5E 1VQOP 1DV5A 1IUQA 3Q20A 1VQKP 3G4SP 3B5IA 4R0MA 2FQ2A 2LL8A 3CC7P 3H4EA 2JB0A 4WYMA 2KGCA 3G21A 2N6ZA 2L9FA 1YHQP 3DS4A 5CZDB 3CCMP 5F2KA 4U0CA 2KOOA 4UHPB 2JBGA 1VQ9P 4XFYA 1A43A 4MRTC 3DTJA 1VQ5P 2QA4P 1M1KQ 2KGEA 1Q7YQ 2L0QA 2M8NA 3G71P 1CEIA 2GZFA 3CXCO 1K9MQ 1UJZA 3DS3A 2JYLA 4U0EA 2JU2A 2CQ8A 5BS2A 1VHNA 4BPGA 2VLQA 2K5XA 2GDWA 2AF8A 2LF4A 1KC8Q 1QVFO 1YIJP 2L22A 1VQ8P 1IMQA 3DS1A 1L0HA 1DNYA 4DG9A 2FQ1A 7CEIA 3EJBA 3DPHA 5F2OA 4NEOA 2P9XA 4PH0A 2MVUA 2KW2A 5KP6B 1F80D 1ZNVA 5BS1A 1VQNP 1S72P 3HZQA 4PWVB 1D1DA 1T8KA 2K0XA 2PEIA 3NTEA 3U43A 2PENA 2VLPA 4M0IA 3G0VA 3GZLA 2MR8A 2KGAA 1M74A 2FAEA 5EJDA 1YI2P 3CCJP 3G26A 2XT1A 4U0DA 1K8AQ 2EHTA 1KQSO 2LIUA 1VQ4P 2OTJP 3LRYA 3P05A 3RG6C 1RO0A 5HGMA 1UNKA 2N5IA 3G1IA 4CA3A 1W2BO 4H2WC 2CGQA 1Q81Q 1BAJA 3CCUP 4GR6A 5I4TG 2PEKA 5KP8B 2ONTA 1ACPA 2N6YA 2VSQA 1KLPA 3LMOA 2OARA 5KP7B 2NO8A 1HY8A 1NJIQ 3G1GA 2LIWA 2L6EA 2FVEA 2MY5A 3GJNA 2WPTA 3B4QA 2MD9A 2QEXP 4QNBA 2JYGA 1NQ4A 2QNWA 2KOSA 3I56P 3HYBA 1EIAA 1VQLP 2GZIA 2LOLA 1GXGA 3CCQP 1E6JP 2Z44A 5F2NA 4QKOA 2EFJA 1MZ8A 1L0IA 3CE7A 2K2QA 5HGNA 2PNGA 3CMAP 2GYKA 4HKGA 2PY8A 1M6NA 4XFZA 3I55P 2KWLA 2MF4A 4XRQA 2XV6A 1EMVA 3CC2P 4U0FA 3CCRP 1VQMP 3DS0A 2OTLP 3H0DA 1YJ9P 1GXHA
chains in the Genus database with same CATH topology
2DNWA 4H2YC 2MR8A 2KGAA 2FAEA 2K92A 5EJDA 2AVAA 2KR5A 5CZDB 2KGDA 1HQBA 2EHTA 2LIUA 2KOOA 2JU1A 4MRTC 2N5IA 1VKUA 2CNRA 2AFEA 4CA3A 2FACA 3GZMA 3NY7B 2FVAA 4H2WC 2KG9A 2KORA 2KGEA 2JQ4A 2CGQA 2L0QA 2X2BA 2N98A 2JGPA 5KP8B 2FVFA 2FHSC 2XZ0D 1ACPA 2KOQA 5HV8A 2N6YA 2VSQA 1KLPA 3LMOA 5KP7B 1HY8A 2XZ1C 2MR7A 2JU2A 1AF8A 2CQ8A 2LIWA 2LMLA 2FVEA 2MY5A 5HVCA 1OR5A 2GDYA 2MD9A 4BPGA 4BPHA 2GDWA 2AF8A 1NQ4A 2L4BA 2QNWA 2M5RA 2KOSA 4PXHB 2N50A 2MVVA 2L22A 4BPFA 1L0HA 2N5HA 1DNYA 4H2XC 4DG9A 2KG6A 2FQ1A 2KOPA 2LOLA 2FADA 2GDXA 2LTEA 3RG2A 3EJBA 1L0IA 2KG8A 3CE7A 2EHSA 4NEOA 2CG5B 2K2QA 2MVUA 2LKIA 2AFDA 1DV5A 2PNGA 1X3OA 2KW2A 5KP6B 2ROQA 2LPKA 4IZ6A 4HKGA 2K94A 1F80D 3EJDA 4R0MA 2KWLA 2FQ2A 2K93A 4PWVB 2MF4A 2LL8A 1T8KA 2K0XA 2FQ0A 2KGCA 2K0YA 2N6ZA 2L9FA 3GZLA 3EJEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DNW A;  4H2Y C;  2MR8 A;  2KGA A;  2FAE A;  2K92 A;  5EJD A;  2AVA A;  2KR5 A;  5CZD B;  2KGD A;  1HQB A;  2EHT A;  2LIU A;  2KOO A;  2JU1 A;  4MRT C;  2N5I A;  1VKU A;  2CNR A;  2AFE A;  4CA3 A;  2FAC A;  3GZM A;  3NY7 B;  2FVA A;  4H2W C;  2KG9 A;  2KOR A;  2KGE A;  2JQ4 A;  2CGQ A;  2L0Q A;  2X2B A;  2N98 A;  2JGP A;  5KP8 B;  2FVF A;  2FHS C;  2XZ0 D;  1ACP A;  2KOQ A;  5HV8 A;  2N6Y A;  2VSQ A;  1KLP A;  3LMO A;  5KP7 B;  1HY8 A;  2XZ1 C;  2MR7 A;  2JU2 A;  1AF8 A;  2CQ8 A;  2LIW A;  2LML A;  2FVE A;  2MY5 A;  5HVC A;  1OR5 A;  2GDY A;  2MD9 A;  4BPG A;  4BPH A;  2GDW A;  2AF8 A;  1NQ4 A;  2L4B A;  2QNW A;  2M5R A;  2KOS A;  4PXH B;  2N50 A;  2MVV A;  2L22 A;  4BPF A;  1L0H A;  2N5H A;  1DNY A;  4H2X C;  4DG9 A;  2KG6 A;  2FQ1 A;  2KOP A;  2LOL A;  2FAD A;  2GDX A;  2LTE A;  3RG2 A;  3EJB A;  1L0I A;  2KG8 A;  3CE7 A;  2EHS A;  4NEO A;  2CG5 B;  2K2Q A;  2MVU A;  2LKI A;  2AFD A;  1DV5 A;  2PNG A;  1X3O A;  2KW2 A;  5KP6 B;  2ROQ A;  2LPK A;  4IZ6 A;  4HKG A;  2K94 A;  1F80 D;  3EJD A;  4R0M A;  2KWL A;  2FQ2 A;  2K93 A;  4PWV B;  2MF4 A;  2LL8 A;  1T8K A;  2K0X A;  2FQ0 A;  2KGC A;  2K0Y A;  2N6Z A;  2L9F A;  3GZL A;  3EJE A; 
#chains in the Genus database with same CATH topology
 1QRJ A;  4H2Y C;  1Z6M A;  2K92 A;  1K30 A;  2AVA A;  2KR5 A;  2JO0 A;  3DS2 A;  1HQB A;  2PEQ A;  3CCV P;  3CME P;  3G28 A;  1QVG O;  2EIA A;  3WBH A;  1VKU A;  2CNR A;  2FVA A;  1AYI A;  1E0H A;  1EOQ A;  2KG9 A;  2KOR A;  3CPW O;  4GR2 A;  3H47 A;  4F37 A;  2N98 A;  2JGP A;  2E1M A;  2XZ0 D;  2KOQ A;  5HV8 A;  1VQ6 P;  2DGY A;  2VLN A;  1AF8 A;  2LML A;  5HVC A;  2BHV A;  2GDY A;  2M8L A;  3DS5 A;  1JJ2 O;  4COP A;  4XFX A;  2XXM A;  2L4B A;  1M90 Q;  2M5R A;  4BPF A;  2N5H A;  4H2X C;  2KG6 A;  3VRL C;  3G29 A;  2FAD A;  2GZJ A;  5HGO A;  2GDX A;  2LTE A;  4XRO A;  3RG2 A;  3CC4 P;  1A8O A;  2VLO A;  2CG5 B;  1BXI A;  2LKI A;  3CCE P;  2AFD A;  1X3O A;  3CCS P;  2KOD A;  2ROQ A;  2LPK A;  3GKL C;  4IZ6 A;  2K94 A;  1KD1 Q;  2PEJ A;  1M6E X;  3EJD A;  1N8R Q;  3E2D A;  2M8P A;  2K93 A;  4COC A;  3MGE A;  2BUO A;  2FQ0 A;  2K0Y A;  3EJE A;  2DNW A;  5DCK A;  2KGD A;  1GPJ A;  1VQ7 P;  1YJW P;  1FR2 A;  2JU1 A;  4U0B A;  3M1M A;  5JPA A;  3CD6 P;  1AUM A;  1YJN P;  1RNI A;  3G6E P;  1K73 Q;  2AFE A;  2Z46 A;  2FAC A;  3GZM A;  3NY7 B;  2ERH A;  3CCL P;  2CWO A;  2PEO A;  4IPY A;  2JAZ A;  2JQ4 A;  1Q82 Q;  2K0D X;  3OW2 O;  2X2B A;  1RO2 A;  2FVF A;  2FHS C;  5HGL A;  2GZG A;  2GZE A;  1Q86 Q;  2XZ1 C;  1YIT P;  2MR7 A;  1IMP A;  1OR5 A;  4BPH A;  2Z45 A;  4PXH B;  2N50 A;  2MVV A;  4U0A A;  2EG5 A;  2PEM A;  4PH1 A;  2KOP A;  1VQP P;  1ZMB A;  2KG8 A;  2EHS A;  5EW5 E;  1VQO P;  1DV5 A;  1IUQ A;  3Q20 A;  1VQK P;  3G4S P;  3B5I A;  4R0M A;  2FQ2 A;  2LL8 A;  3CC7 P;  3H4E A;  2JB0 A;  4WYM A;  2KGC A;  3G21 A;  2N6Z A;  2L9F A;  1YHQ P;  3DS4 A;  5CZD B;  3CCM P;  5F2K A;  4U0C A;  2KOO A;  4UHP B;  2JBG A;  1VQ9 P;  4XFY A;  1A43 A;  4MRT C;  3DTJ A;  1VQ5 P;  2QA4 P;  1M1K Q;  2KGE A;  1Q7Y Q;  2L0Q A;  2M8N A;  3G71 P;  1CEI A;  2GZF A;  3CXC O;  1K9M Q;  1UJZ A;  3DS3 A;  2JYL A;  4U0E A;  2JU2 A;  2CQ8 A;  5BS2 A;  1VHN A;  4BPG A;  2VLQ A;  2K5X A;  2GDW A;  2AF8 A;  2LF4 A;  1KC8 Q;  1QVF O;  1YIJ P;  2L22 A;  1VQ8 P;  1IMQ A;  3DS1 A;  1L0H A;  1DNY A;  4DG9 A;  2FQ1 A;  7CEI A;  3EJB A;  3DPH A;  5F2O A;  4NEO A;  2P9X A;  4PH0 A;  2MVU A;  2KW2 A;  5KP6 B;  1F80 D;  1ZNV A;  5BS1 A;  1VQN P;  1S72 P;  3HZQ A;  4PWV B;  1D1D A;  1T8K A;  2K0X A;  2PEI A;  3NTE A;  3U43 A;  2PEN A;  2VLP A;  4M0I A;  3G0V A;  3GZL A;  2MR8 A;  2KGA A;  1M74 A;  2FAE A;  5EJD A;  1YI2 P;  3CCJ P;  3G26 A;  2XT1 A;  4U0D A;  1K8A Q;  2EHT A;  1KQS O;  2LIU A;  1VQ4 P;  2OTJ P;  3LRY A;  3P05 A;  3RG6 C;  1RO0 A;  5HGM A;  1UNK A;  2N5I A;  3G1I A;  4CA3 A;  1W2B O;  4H2W C;  2CGQ A;  1Q81 Q;  1BAJ A;  3CCU P;  4GR6 A;  5I4T G;  2PEK A;  5KP8 B;  2ONT A;  1ACP A;  2N6Y A;  2VSQ A;  1KLP A;  3LMO A;  2OAR A;  5KP7 B;  2NO8 A;  1HY8 A;  1NJI Q;  3G1G A;  2LIW A;  2L6E A;  2FVE A;  2MY5 A;  3GJN A;  2WPT A;  3B4Q A;  2MD9 A;  2QEX P;  4QNB A;  2JYG A;  1NQ4 A;  2QNW A;  2KOS A;  3I56 P;  3HYB A;  1EIA A;  1VQL P;  2GZI A;  2LOL A;  1GXG A;  3CCQ P;  1E6J P;  2Z44 A;  5F2N A;  4QKO A;  2EFJ A;  1MZ8 A;  1L0I A;  3CE7 A;  2K2Q A;  5HGN A;  2PNG A;  3CMA P;  2GYK A;  4HKG A;  2PY8 A;  1M6N A;  4XFZ A;  3I55 P;  2KWL A;  2MF4 A;  4XRQ A;  2XV6 A;  1EMV A;  3CC2 P;  4U0F A;  3CCR P;  1VQM P;  3DS0 A;  2OTL P;  3H0D A;  1YJ9 P;  1GXH A; 
#chains in the Genus database with same CATH homology
 2DNW A;  4H2Y C;  2MR8 A;  2KGA A;  2FAE A;  2K92 A;  5EJD A;  2AVA A;  2KR5 A;  5CZD B;  2KGD A;  1HQB A;  2EHT A;  2LIU A;  2KOO A;  2JU1 A;  4MRT C;  2N5I A;  1VKU A;  2CNR A;  2AFE A;  4CA3 A;  2FAC A;  3GZM A;  3NY7 B;  2FVA A;  4H2W C;  2KG9 A;  2KOR A;  2KGE A;  2JQ4 A;  2CGQ A;  2L0Q A;  2X2B A;  2N98 A;  2JGP A;  5KP8 B;  2FVF A;  2FHS C;  2XZ0 D;  1ACP A;  2KOQ A;  5HV8 A;  2N6Y A;  2VSQ A;  1KLP A;  3LMO A;  5KP7 B;  1HY8 A;  2XZ1 C;  2MR7 A;  2JU2 A;  1AF8 A;  2CQ8 A;  2LIW A;  2LML A;  2FVE A;  2MY5 A;  5HVC A;  1OR5 A;  2GDY A;  2MD9 A;  4BPG A;  4BPH A;  2GDW A;  2AF8 A;  1NQ4 A;  2L4B A;  2QNW A;  2M5R A;  2KOS A;  4PXH B;  2N50 A;  2MVV A;  2L22 A;  4BPF A;  1L0H A;  2N5H A;  1DNY A;  4H2X C;  4DG9 A;  2KG6 A;  2FQ1 A;  2KOP A;  2LOL A;  2FAD A;  2GDX A;  2LTE A;  3RG2 A;  3EJB A;  1L0I A;  2KG8 A;  3CE7 A;  2EHS A;  4NEO A;  2CG5 B;  2K2Q A;  2MVU A;  2LKI A;  2AFD A;  1DV5 A;  2PNG A;  1X3O A;  2KW2 A;  5KP6 B;  2ROQ A;  2LPK A;  4IZ6 A;  4HKG A;  2K94 A;  1F80 D;  3EJD A;  4R0M A;  2KWL A;  2FQ2 A;  2K93 A;  4PWV B;  2MF4 A;  2LL8 A;  1T8K A;  2K0X A;  2FQ0 A;  2KGC A;  2K0Y A;  2N6Z A;  2L9F A;  3GZL A;  3EJE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...