2FQ2A

Solution structure of minor conformation of holo-acyl carrier protein from malaria parasite plasmodium falciparum
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
79
structure length
79
Chain Sequence
LKSTFDDIKKIISKQLSVEEDKIQMNSNFTKDLGADSLDLVELIMALEEKFNVTISDQDALKINTVQDAIDYIEKNNKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords acyl carrier protein
publication title Solution structures of conformationally equilibrium forms of holo-acyl carrier protein (PfACP) from Plasmodium falciparum provides insight into the mechanism of activation of ACPs
pubmed doi rcsb
source organism Plasmodium falciparum 3d7
molecule tags Lipid transport
total genus 15
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2006-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2fq2A00
2FVEA 2N6YA 2N6ZA 2GDWA 2EHSA 2K92A 2AFDA 2KOPA 2KW2A 5HV8A 3CE7A 2JU2A 2MF4A 5EJDA 2KR5A 2K2QA 2JU1A 2N5HA 2JQ4A 3GZMA 2K93A 2GDXA 1OR5A 2GDYA 2FQ1A 2FQ2A 2L9FA 4BPGA 4H2XC 2QNWA 2FACA 2LMLA 2MY5A 4BPFA 3RG2A 3LMOA 2CQ8A 2KGDA 2LOLA 2FHSC 2LKIA 2XZ0D 3EJDA 1AF8A 2L22A 2L0QA 2FVAA 1ACPA 2KGEA 3GZLA 2KOSA 4HKGA 2KWLA 2N50A 2L4BA 2EHTA 2KG9A 3EJBA 2LTEA 2KG6A 2CG5B 4MRTC 1X3OA 2VSQA 4PXHB 2LL8A 2MR7A 2AVAA 2K94A 2CNRA 2K0YA 1HY8A 2KGCA 2KGAA 2LIWA 5KP6B 1L0HA 2FVFA 4CA3A 1F80D 2CGQA 4IZ6A 1DNYA 2KOOA 1KLPA 4R0MA 2ROQA 5HVCA 2X2BA 2DNWA 2M5RA 1HQBA 2K0XA 2MD9A 1T8KA 2JGPA 2N98A 1NQ4A 1VKUA 2KG8A 4PWVB 5CZDB 4BPHA 2FQ0A 4H2WC 2MVVA 4DG9A 2LIUA 1L0IA 5KP7B 2N5IA 2AF8A 2FADA 3EJEA 5KP8B 2XZ1C 2FAEA 2KOQA 4NEOA 1DV5A 2PNGA 2KORA 4H2YC 3NY7B 2MR8A 2AFEA 2LPKA 2MVUA
chains in the Genus database with same CATH superfamily
2GZJA 2GDWA 2EHSA 2K92A 5I4TG 2KW2A 1Z6MA 5HV8A 1D1DA 2JU2A 7CEIA 5F2NA 3RG6C 4QKOA 2FQ1A 1VQ4P 1IUQA 2L9FA 4F37A 1M90Q 1BXIA 4BPFA 3RG2A 2QA4P 3HYBA 2KGDA 2LKIA 5BS2A 5BS1A 1M1KQ 1M6NA 2GZFA 3G6EP 2FVAA 3CCRP 2WPTA 5HGNA 3B4QA 2M8NA 2L4BA 3G26A 2KG6A 5JPAA 1ZMBA 4UHPB 3CCSP 4XROA 2GZEA 3G4SP 3M1MA 1M74A 3DPHA 2KGCA 2P9XA 4WYMA 2LF4A 2NO8A 4M0IA 4XFYA 2CWOA 2EIAA 1F80D 2PEIA 1NJIQ 4R0MA 4PH0A 2QEXP 1IMQA 1YITP 1YHQP 2JB0A 2FQ0A 3LRYA 2N5IA 2PEJA 4XRQA 2FADA 2EG5A 3G29A 1FR2A 3H47A 3CC4P 5HGOA 2XXMA 2KORA 3G28A 2MR8A 3CCVP 1RO0A 3HZQA 2LPKA 2PENA 2N6YA 2JO0A 4QNBA 3CE7A 1YJNP 1K8AQ 2K93A 2M8PA 1K30A 3G0VA 1VQ6P 2FACA 4COCA 3NTEA 1AF8A 2XZ0D 1VQ8P 3DTJA 1UJZA 3I55P 3EJBA 4U0CA 4PXHB 3WBHA 2LL8A 2MR7A 3DS4A 2Z46A 3CCEP 2DGYA 4CA3A 2CGQA 3I56P 3E2DA 4IZ6A 1DNYA 1EIAA 1M6EX 2PEMA 2VLPA 5HVCA 1K73Q 2GZIA 2MD9A 1T8KA 2PY8A 2PEOA 2JAZA 4BPHA 3Q20A 1VQPP 2LIUA 2Z44A 1L0IA 3G21A 2AF8A 3DS3A 5KP8B 3EJEA 5EW5E 3CCMP 4NEOA 3CCJP 2VLOA 4PH1A 1YI2P 2PNGA 4H2YC 1VQNP 2JYLA 2BHVA 2N6ZA 3DS5A 2AFDA 3CCLP 1RNIA 2MF4A 3CXCO 2KR5A 1VHNA 3MGEA 1S72P 1VQOP 1OR5A 2GDYA 2FQ2A 4GR6A 4XFXA 1QVFO 3H4EA 2MY5A 2PEQA 2CQ8A 4IPYA 4COPA 2L22A 1VQ7P 2VLQA 3B5IA 1ACPA 3GZLA 4HKGA 2KWLA 2N50A 1GXHA 2EHTA 2L6EA 2KG9A 2LTEA 1ZNVA 3CD6P 4U0EA 4MRTC 1EOQA 1X3OA 1VQMP 2PEKA 4XFZA 2K94A 2GYKA 3CMAP 2XT1A 1W2BO 2KGAA 1VQKP 5DCKA 1EMVA 4U0DA 2VLNA 1YIJP 5KP6B 1UNKA 1BAJA 1A8OA 2OTLP 4U0BA 3CCUP 2ROQA 2X2BA 1JJ2O 1HQBA 3U43A 2JGPA 2N98A 1NQ4A 3VRLC 2KG8A 2XV6A 2ONTA 1QRJA 5CZDB 2JBGA 3DS1A 1K9MQ 4U0FA 2JYGA 4H2WC 2Z45A 5F2KA 5KP7B 2XZ1C 2FAEA 3DS0A 1DV5A 1IMPA 3NY7B 1QVGO 2AFEA 3GKLC 5HGMA 3GJNA 3G1IA 1N8RQ 2FVEA 2KOPA 1Q81Q 2GZGA 5EJDA 2K2QA 2JU1A 2N5HA 1AYIA 3H0DA 2JQ4A 4GR2A 3GZMA 2GDXA 3CC2P 3G71P 1RO2A 1E6JP 4BPGA 4H2XC 2QNWA 2ERHA 2LMLA 1MZ8A 3LMOA 2EFJA 2LOLA 2FHSC 3EJDA 2L0QA 3CMEP 2KGEA 2KOSA 3CCQP 2CG5B 2VSQA 1Q82Q 5F2OA 2OARA 1A43A 3CPWO 1E0HA 1KC8Q 2BUOA 2AVAA 2CNRA 2K0YA 3DS2A 1CEIA 1HY8A 3OW2O 1Q86Q 1YJ9P 3P05A 2LIWA 1KQSO 1L0HA 2FVFA 5HGLA 2K5XA 2KOOA 1KLPA 1VQ5P 2OTJP 2DNWA 2M5RA 2M8LA 2K0XA 1VKUA 1YJWP 4PWVB 3G1GA 4DG9A 2MVVA 1GPJA 2E1MA 1VQLP 1AUMA 2K0DX 1GXGA 2KOQA 2KODA 1KD1Q 3CC7P 1VQ9P 1Q7YQ 4U0AA 2MVUA
chains in the Genus database with same CATH topology
2FVEA 2N6YA 2N6ZA 2GDWA 2EHSA 2K92A 2AFDA 2KOPA 2KW2A 5HV8A 3CE7A 2JU2A 2MF4A 5EJDA 2KR5A 2K2QA 2JU1A 2N5HA 2JQ4A 3GZMA 2K93A 2GDXA 1OR5A 2GDYA 2FQ1A 2FQ2A 2L9FA 4BPGA 4H2XC 2QNWA 2FACA 2LMLA 2MY5A 4BPFA 3RG2A 3LMOA 2CQ8A 2KGDA 2LOLA 2FHSC 2LKIA 2XZ0D 3EJDA 1AF8A 2L22A 2L0QA 2FVAA 1ACPA 2KGEA 3GZLA 2KOSA 4HKGA 2KWLA 2N50A 2L4BA 2EHTA 2KG9A 3EJBA 2LTEA 2KG6A 2CG5B 4MRTC 1X3OA 2VSQA 4PXHB 2LL8A 2MR7A 2AVAA 2K94A 2CNRA 2K0YA 1HY8A 2KGCA 2KGAA 2LIWA 5KP6B 1L0HA 2FVFA 4CA3A 1F80D 2CGQA 4IZ6A 1DNYA 2KOOA 1KLPA 4R0MA 2ROQA 5HVCA 2X2BA 2DNWA 2M5RA 1HQBA 2K0XA 2MD9A 1T8KA 2JGPA 2N98A 1NQ4A 1VKUA 2KG8A 4PWVB 5CZDB 4BPHA 2FQ0A 4H2WC 2MVVA 4DG9A 2LIUA 1L0IA 5KP7B 2N5IA 2AF8A 2FADA 3EJEA 5KP8B 2XZ1C 2FAEA 2KOQA 4NEOA 1DV5A 2PNGA 2KORA 4H2YC 3NY7B 2MR8A 2AFEA 2LPKA 2MVUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FVE A;  2N6Y A;  2N6Z A;  2GDW A;  2EHS A;  2K92 A;  2AFD A;  2KOP A;  2KW2 A;  5HV8 A;  3CE7 A;  2JU2 A;  2MF4 A;  5EJD A;  2KR5 A;  2K2Q A;  2JU1 A;  2N5H A;  2JQ4 A;  3GZM A;  2K93 A;  2GDX A;  1OR5 A;  2GDY A;  2FQ1 A;  2FQ2 A;  2L9F A;  4BPG A;  4H2X C;  2QNW A;  2FAC A;  2LML A;  2MY5 A;  4BPF A;  3RG2 A;  3LMO A;  2CQ8 A;  2KGD A;  2LOL A;  2FHS C;  2LKI A;  2XZ0 D;  3EJD A;  1AF8 A;  2L22 A;  2L0Q A;  2FVA A;  1ACP A;  2KGE A;  3GZL A;  2KOS A;  4HKG A;  2KWL A;  2N50 A;  2L4B A;  2EHT A;  2KG9 A;  3EJB A;  2LTE A;  2KG6 A;  2CG5 B;  4MRT C;  1X3O A;  2VSQ A;  4PXH B;  2LL8 A;  2MR7 A;  2AVA A;  2K94 A;  2CNR A;  2K0Y A;  1HY8 A;  2KGC A;  2KGA A;  2LIW A;  5KP6 B;  1L0H A;  2FVF A;  4CA3 A;  1F80 D;  2CGQ A;  4IZ6 A;  1DNY A;  2KOO A;  1KLP A;  4R0M A;  2ROQ A;  5HVC A;  2X2B A;  2DNW A;  2M5R A;  1HQB A;  2K0X A;  2MD9 A;  1T8K A;  2JGP A;  2N98 A;  1NQ4 A;  1VKU A;  2KG8 A;  4PWV B;  5CZD B;  4BPH A;  2FQ0 A;  4H2W C;  2MVV A;  4DG9 A;  2LIU A;  1L0I A;  5KP7 B;  2N5I A;  2AF8 A;  2FAD A;  3EJE A;  5KP8 B;  2XZ1 C;  2FAE A;  2KOQ A;  4NEO A;  1DV5 A;  2PNG A;  2KOR A;  4H2Y C;  3NY7 B;  2MR8 A;  2AFE A;  2LPK A;  2MVU A; 
#chains in the Genus database with same CATH topology
 2GZJ A;  2GDW A;  2EHS A;  2K92 A;  5I4T G;  2KW2 A;  1Z6M A;  5HV8 A;  1D1D A;  2JU2 A;  7CEI A;  5F2N A;  3RG6 C;  4QKO A;  2FQ1 A;  1VQ4 P;  1IUQ A;  2L9F A;  4F37 A;  1M90 Q;  1BXI A;  4BPF A;  3RG2 A;  2QA4 P;  3HYB A;  2KGD A;  2LKI A;  5BS2 A;  5BS1 A;  1M1K Q;  1M6N A;  2GZF A;  3G6E P;  2FVA A;  3CCR P;  2WPT A;  5HGN A;  3B4Q A;  2M8N A;  2L4B A;  3G26 A;  2KG6 A;  5JPA A;  1ZMB A;  4UHP B;  3CCS P;  4XRO A;  2GZE A;  3G4S P;  3M1M A;  1M74 A;  3DPH A;  2KGC A;  2P9X A;  4WYM A;  2LF4 A;  2NO8 A;  4M0I A;  4XFY A;  2CWO A;  2EIA A;  1F80 D;  2PEI A;  1NJI Q;  4R0M A;  4PH0 A;  2QEX P;  1IMQ A;  1YIT P;  1YHQ P;  2JB0 A;  2FQ0 A;  3LRY A;  2N5I A;  2PEJ A;  4XRQ A;  2FAD A;  2EG5 A;  3G29 A;  1FR2 A;  3H47 A;  3CC4 P;  5HGO A;  2XXM A;  2KOR A;  3G28 A;  2MR8 A;  3CCV P;  1RO0 A;  3HZQ A;  2LPK A;  2PEN A;  2N6Y A;  2JO0 A;  4QNB A;  3CE7 A;  1YJN P;  1K8A Q;  2K93 A;  2M8P A;  1K30 A;  3G0V A;  1VQ6 P;  2FAC A;  4COC A;  3NTE A;  1AF8 A;  2XZ0 D;  1VQ8 P;  3DTJ A;  1UJZ A;  3I55 P;  3EJB A;  4U0C A;  4PXH B;  3WBH A;  2LL8 A;  2MR7 A;  3DS4 A;  2Z46 A;  3CCE P;  2DGY A;  4CA3 A;  2CGQ A;  3I56 P;  3E2D A;  4IZ6 A;  1DNY A;  1EIA A;  1M6E X;  2PEM A;  2VLP A;  5HVC A;  1K73 Q;  2GZI A;  2MD9 A;  1T8K A;  2PY8 A;  2PEO A;  2JAZ A;  4BPH A;  3Q20 A;  1VQP P;  2LIU A;  2Z44 A;  1L0I A;  3G21 A;  2AF8 A;  3DS3 A;  5KP8 B;  3EJE A;  5EW5 E;  3CCM P;  4NEO A;  3CCJ P;  2VLO A;  4PH1 A;  1YI2 P;  2PNG A;  4H2Y C;  1VQN P;  2JYL A;  2BHV A;  2N6Z A;  3DS5 A;  2AFD A;  3CCL P;  1RNI A;  2MF4 A;  3CXC O;  2KR5 A;  1VHN A;  3MGE A;  1S72 P;  1VQO P;  1OR5 A;  2GDY A;  2FQ2 A;  4GR6 A;  4XFX A;  1QVF O;  3H4E A;  2MY5 A;  2PEQ A;  2CQ8 A;  4IPY A;  4COP A;  2L22 A;  1VQ7 P;  2VLQ A;  3B5I A;  1ACP A;  3GZL A;  4HKG A;  2KWL A;  2N50 A;  1GXH A;  2EHT A;  2L6E A;  2KG9 A;  2LTE A;  1ZNV A;  3CD6 P;  4U0E A;  4MRT C;  1EOQ A;  1X3O A;  1VQM P;  2PEK A;  4XFZ A;  2K94 A;  2GYK A;  3CMA P;  2XT1 A;  1W2B O;  2KGA A;  1VQK P;  5DCK A;  1EMV A;  4U0D A;  2VLN A;  1YIJ P;  5KP6 B;  1UNK A;  1BAJ A;  1A8O A;  2OTL P;  4U0B A;  3CCU P;  2ROQ A;  2X2B A;  1JJ2 O;  1HQB A;  3U43 A;  2JGP A;  2N98 A;  1NQ4 A;  3VRL C;  2KG8 A;  2XV6 A;  2ONT A;  1QRJ A;  5CZD B;  2JBG A;  3DS1 A;  1K9M Q;  4U0F A;  2JYG A;  4H2W C;  2Z45 A;  5F2K A;  5KP7 B;  2XZ1 C;  2FAE A;  3DS0 A;  1DV5 A;  1IMP A;  3NY7 B;  1QVG O;  2AFE A;  3GKL C;  5HGM A;  3GJN A;  3G1I A;  1N8R Q;  2FVE A;  2KOP A;  1Q81 Q;  2GZG A;  5EJD A;  2K2Q A;  2JU1 A;  2N5H A;  1AYI A;  3H0D A;  2JQ4 A;  4GR2 A;  3GZM A;  2GDX A;  3CC2 P;  3G71 P;  1RO2 A;  1E6J P;  4BPG A;  4H2X C;  2QNW A;  2ERH A;  2LML A;  1MZ8 A;  3LMO A;  2EFJ A;  2LOL A;  2FHS C;  3EJD A;  2L0Q A;  3CME P;  2KGE A;  2KOS A;  3CCQ P;  2CG5 B;  2VSQ A;  1Q82 Q;  5F2O A;  2OAR A;  1A43 A;  3CPW O;  1E0H A;  1KC8 Q;  2BUO A;  2AVA A;  2CNR A;  2K0Y A;  3DS2 A;  1CEI A;  1HY8 A;  3OW2 O;  1Q86 Q;  1YJ9 P;  3P05 A;  2LIW A;  1KQS O;  1L0H A;  2FVF A;  5HGL A;  2K5X A;  2KOO A;  1KLP A;  1VQ5 P;  2OTJ P;  2DNW A;  2M5R A;  2M8L A;  2K0X A;  1VKU A;  1YJW P;  4PWV B;  3G1G A;  4DG9 A;  2MVV A;  1GPJ A;  2E1M A;  1VQL P;  1AUM A;  2K0D X;  1GXG A;  2KOQ A;  2KOD A;  1KD1 Q;  3CC7 P;  1VQ9 P;  1Q7Y Q;  4U0A A;  2MVU A; 
#chains in the Genus database with same CATH homology
 2FVE A;  2N6Y A;  2N6Z A;  2GDW A;  2EHS A;  2K92 A;  2AFD A;  2KOP A;  2KW2 A;  5HV8 A;  3CE7 A;  2JU2 A;  2MF4 A;  5EJD A;  2KR5 A;  2K2Q A;  2JU1 A;  2N5H A;  2JQ4 A;  3GZM A;  2K93 A;  2GDX A;  1OR5 A;  2GDY A;  2FQ1 A;  2FQ2 A;  2L9F A;  4BPG A;  4H2X C;  2QNW A;  2FAC A;  2LML A;  2MY5 A;  4BPF A;  3RG2 A;  3LMO A;  2CQ8 A;  2KGD A;  2LOL A;  2FHS C;  2LKI A;  2XZ0 D;  3EJD A;  1AF8 A;  2L22 A;  2L0Q A;  2FVA A;  1ACP A;  2KGE A;  3GZL A;  2KOS A;  4HKG A;  2KWL A;  2N50 A;  2L4B A;  2EHT A;  2KG9 A;  3EJB A;  2LTE A;  2KG6 A;  2CG5 B;  4MRT C;  1X3O A;  2VSQ A;  4PXH B;  2LL8 A;  2MR7 A;  2AVA A;  2K94 A;  2CNR A;  2K0Y A;  1HY8 A;  2KGC A;  2KGA A;  2LIW A;  5KP6 B;  1L0H A;  2FVF A;  4CA3 A;  1F80 D;  2CGQ A;  4IZ6 A;  1DNY A;  2KOO A;  1KLP A;  4R0M A;  2ROQ A;  5HVC A;  2X2B A;  2DNW A;  2M5R A;  1HQB A;  2K0X A;  2MD9 A;  1T8K A;  2JGP A;  2N98 A;  1NQ4 A;  1VKU A;  2KG8 A;  4PWV B;  5CZD B;  4BPH A;  2FQ0 A;  4H2W C;  2MVV A;  4DG9 A;  2LIU A;  1L0I A;  5KP7 B;  2N5I A;  2AF8 A;  2FAD A;  3EJE A;  5KP8 B;  2XZ1 C;  2FAE A;  2KOQ A;  4NEO A;  1DV5 A;  2PNG A;  2KOR A;  4H2Y C;  3NY7 B;  2MR8 A;  2AFE A;  2LPK A;  2MVU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...