4GR6A

Crystal structure of atrbcx2 from arabidopsis thaliana
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
104
structure length
104
Chain Sequence
TFGDVQKQIVNYFTYKAVRTVLHQLYEMNPPQYTWFYNHIITNRPTDGKRFLRALGKESQELAERVMITRLHLYGKWIKKADHGKIYQEISDENLALMRERLME
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AtRbcX2
publication title Insights into eukaryotic Rubisco assembly - Crystal structures of RbcX chaperones from Arabidopsis thaliana.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Chaperone
total genus 45
structure length 104
sequence length 104
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02341 RcbX RbcX protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.210 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 4gr6A00
3HYBA 2PEIA 2PY8A 3Q20A 4GR6A 2Z44A 2PEKA 4GR2A 2Z45A 3RG6C 2PEOA 5BS2A 5BS1A 2Z46A 2PENA 2PEMA 2PEQA 2PEJA
chains in the Genus database with same CATH superfamily
3CCRP 1Q7YQ 1EIAA 2KODA 5HGNA 3G21A 2N5IA 5BS1A 1HQBA 4U0AA 5F2NA 1CEIA 1M74A 4R0MA 1AYIA 3DS3A 4IPYA 2K93A 4H2WC 3CD6P 3H4EA 2L22A 2XXMA 2KG6A 1DV5A 2N5HA 1K30A 1UNKA 2JGPA 2KORA 2Z46A 1YHQP 3CC2P 1A43A 2WPTA 3EJEA 3CMAP 3LMOA 2Z45A 5EJDA 2KGCA 4H2XC 2JBGA 1KD1Q 2KOSA 3CCSP 5I4TG 2GZIA 1M6EX 2FAEA 1VQPP 3P05A 3CCEP 2EFJA 2VLOA 1VQ6P 5CZDB 1FR2A 4GR6A 5F2KA 2DNWA 2OTJP 2JYLA 2KOOA 2GZJA 2JB0A 2XZ1C 3CCUP 1K73Q 1K8AQ 2PNGA 3H0DA 1YJWP 2KWLA 2LF4A 3G4SP 1VQ7P 2L0QA 3CCJP 2P9XA 2JO0A 2VLQA 4F37A 1VQMP 1RO2A 3G6EP 2MR8A 2CG5B 3I56P 2EHSA 2GDYA 5F2OA 2AFDA 4UHPB 2LIUA 2DGYA 3OW2O 2M8PA 4XFYA 2K0XA 1YITP 2L9FA 1Q81Q 2K2QA 3G26A 2K92A 2MR7A 1YJNP 5KP6B 1D1DA 4GR2A 4M0IA 1L0HA 2BHVA 2LKIA 2VLNA 4IZ6A 1VHNA 2M8NA 3U43A 3EJBA 1MZ8A 4DG9A 2N98A 1QVFO 4XFZA 1GXHA 2GZFA 2LOLA 2MVVA 5KP8B 2LMLA 1VQ9P 2JQ4A 3CCQP 2ERHA 5EW5E 2PENA 4U0BA 1AF8A 1HY8A 2GZEA 1M90Q 2N6ZA 1VQ8P 3G1GA 1N8RQ 2LL8A 3LRYA 4U0DA 1VQ4P 1IMPA 1QRJA 2PEIA 5HGOA 1AUMA 4MRTC 2EIAA 1ZMBA 1GPJA 2ROQA 2GDWA 2FQ2A 1VQKP 3DTJA 2VLPA 5JPAA 1W2BO 7CEIA 5HV8A 2AFEA 1IUQA 2K0YA 2K94A 1E0HA 1L0IA 2FVEA 3DPHA 2VSQA 4COCA 3G0VA 2CNRA 4WYMA 2PY8A 2FQ0A 3M1MA 1YIJP 4BPGA 2X2BA 2KGEA 3DS0A 1KQSO 3H47A 3MGEA 2FVAA 2PEMA 4U0EA 2PEKA 5BS2A 1Z6MA 2K5XA 2XZ0D 3CXCO 2OTLP 3DS5A 2FADA 2XV6A 4XRQA 2QEXP 2CQ8A 2EHTA 2JU2A 1T8KA 4QKOA 5KP7B 1QVGO 2L6EA 5HGMA 2QNWA 2XT1A 3G28A 1YI2P 1YJ9P 1ACPA 3Q20A 3G1IA 1M1KQ 4U0FA 2FACA 2EG5A 3B4QA 4QNBA 3CPWO 1A8OA 1UJZA 2Z44A 1BXIA 1GXGA 3RG2A 4CA3A 1NQ4A 1X3OA 5DCKA 1EMVA 4XFXA 2FVFA 1ZNVA 2KGAA 4NEOA 1BAJA 3HYBA 2CWOA 2KW2A 1OR5A 2KOPA 4U0CA 5HGLA 3B5IA 3DS1A 2OARA 2M8LA 3G71P 3CC7P 2LIWA 3EJDA 1Q86Q 1JJ2O 2N50A 3VRLC 3CCMP 2MF4A 2LPKA 2BUOA 1Q82Q 2KR5A 2CGQA 2M5RA 3NY7B 2JYGA 2PEOA 1F80D 3CE7A 2JU1A 1M6NA 5HVCA 2KG8A 4XROA 2N6YA 3RG6C 3WBHA 3I55P 1VQLP 1IMQA 4COPA 1RO0A 2AVAA 1KC8Q 1S72P 3GKLC 3HZQA 2NO8A 2PEJA 1EOQA 2ONTA 3CCLP 1VKUA 2GYKA 2GZGA 1KLPA 2FQ1A 2GDXA 1NJIQ 2L4BA 3DS4A 3E2DA 3GZLA 3CMEP 4H2YC 1VQNP 2JAZA 2KOQA 2KGDA 4BPHA 3GZMA 2LTEA 2MD9A 1E6JP 4PWVB 4PH0A 2KG9A 2K0DX 2FHSC 2E1MA 1RNIA 3CC4P 3G29A 2PEQA 4PH1A 2AF8A 2QA4P 2MVUA 3GJNA 3DS2A 1VQ5P 1K9MQ 4HKGA 2MY5A 1VQOP 4PXHB 3CCVP 4BPFA 1DNYA 3NTEA
chains in the Genus database with same CATH topology
2M8LA 3CCRP 3G71P 1Q7YQ 1EIAA 2KODA 3I56P 3CC7P 3G0VA 5HGNA 3G21A 4WYMA 2PY8A 3M1MA 1Q86Q 1JJ2O 5BS1A 1YIJP 5F2OA 3VRLC 3CCMP 3DS0A 4U0AA 1KQSO 5F2NA 3H47A 1M74A 3MGEA 2BUOA 1Q82Q 3DS3A 4IPYA 2DGYA 3OW2O 3CD6P 3H4EA 2PEMA 2M8PA 2XXMA 4XFYA 4U0EA 1YITP 2PEKA 2JYGA 5BS2A 2PEOA 1Q81Q 1K30A 1M6NA 3G26A 4XROA 3RG6C 3CXCO 3WBHA 2OTLP 1YHQP 2Z46A 1YJNP 3DS5A 2XV6A 4XRQA 3I55P 1VQLP 3CC2P 2QEXP 1A43A 1D1DA 4COPA 1RO0A 4GR2A 1KC8Q 4M0IA 1S72P 2BHVA 3CMAP 3HZQA 2Z45A 2PEJA 1EOQA 2M8NA 2ONTA 1VQMP 3CCLP 1QVGO 2L6EA 5HGMA 1KD1Q 3G6EP 3CCSP 5I4TG 3DS4A 3E2DA 1NJIQ 3G28A 2XT1A 3CMEP 1QVFO 1VQNP 1M6EX 4XFZA 1YI2P 1VQPP 3P05A 3CCEP 2EFJA 1YJ9P 1VQ6P 4GR6A 5F2KA 3Q20A 3G1IA 1E6JP 1VQ9P 1M1KQ 4PH0A 4U0FA 3CCQP 2OTJP 2EG5A 2PENA 4QNBA 4U0BA 3CPWO 1A8OA 2JYLA 1M90Q 1VQ8P 2E1MA 1RNIA 3G1GA 1N8RQ 3CCUP 3CC4P 3LRYA 3G29A 4U0DA 1K73Q 1K8AQ 2PEQA 4PH1A 2Z44A 1QRJA 2PEIA 5HGOA 1AUMA 2EIAA 3H0DA 1YJWP 2LF4A 2QA4P 3G4SP 1ZMBA 3DS2A 1VQ5P 1K9MQ 1VQ7P 5DCKA 1VQKP 3DTJA 4XFXA 5JPAA 1VQOP 1W2BO 1BAJA 1VQ4P 3HYBA 3CCJP 2CWOA 2P9XA 4U0CA 2JO0A 5HGLA 1IUQA 3CCVP 3DPHA 3B5IA 4COCA 3NTEA 1RO2A 3DS1A 2OARA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HYB A;  2PEI A;  2PY8 A;  3Q20 A;  4GR6 A;  2Z44 A;  2PEK A;  4GR2 A;  2Z45 A;  3RG6 C;  2PEO A;  5BS2 A;  5BS1 A;  2Z46 A;  2PEN A;  2PEM A;  2PEQ A;  2PEJ A; 
#chains in the Genus database with same CATH topology
 3CCR P;  1Q7Y Q;  1EIA A;  2KOD A;  5HGN A;  3G21 A;  2N5I A;  5BS1 A;  1HQB A;  4U0A A;  5F2N A;  1CEI A;  1M74 A;  4R0M A;  1AYI A;  3DS3 A;  4IPY A;  2K93 A;  4H2W C;  3CD6 P;  3H4E A;  2L22 A;  2XXM A;  2KG6 A;  1DV5 A;  2N5H A;  1K30 A;  1UNK A;  2JGP A;  2KOR A;  2Z46 A;  1YHQ P;  3CC2 P;  1A43 A;  2WPT A;  3EJE A;  3CMA P;  3LMO A;  2Z45 A;  5EJD A;  2KGC A;  4H2X C;  2JBG A;  1KD1 Q;  2KOS A;  3CCS P;  5I4T G;  2GZI A;  1M6E X;  2FAE A;  1VQP P;  3P05 A;  3CCE P;  2EFJ A;  2VLO A;  1VQ6 P;  5CZD B;  1FR2 A;  4GR6 A;  5F2K A;  2DNW A;  2OTJ P;  2JYL A;  2KOO A;  2GZJ A;  2JB0 A;  2XZ1 C;  3CCU P;  1K73 Q;  1K8A Q;  2PNG A;  3H0D A;  1YJW P;  2KWL A;  2LF4 A;  3G4S P;  1VQ7 P;  2L0Q A;  3CCJ P;  2P9X A;  2JO0 A;  2VLQ A;  4F37 A;  1VQM P;  1RO2 A;  3G6E P;  2MR8 A;  2CG5 B;  3I56 P;  2EHS A;  2GDY A;  5F2O A;  2AFD A;  4UHP B;  2LIU A;  2DGY A;  3OW2 O;  2M8P A;  4XFY A;  2K0X A;  1YIT P;  2L9F A;  1Q81 Q;  2K2Q A;  3G26 A;  2K92 A;  2MR7 A;  1YJN P;  5KP6 B;  1D1D A;  4GR2 A;  4M0I A;  1L0H A;  2BHV A;  2LKI A;  2VLN A;  4IZ6 A;  1VHN A;  2M8N A;  3U43 A;  3EJB A;  1MZ8 A;  4DG9 A;  2N98 A;  1QVF O;  4XFZ A;  1GXH A;  2GZF A;  2LOL A;  2MVV A;  5KP8 B;  2LML A;  1VQ9 P;  2JQ4 A;  3CCQ P;  2ERH A;  5EW5 E;  2PEN A;  4U0B A;  1AF8 A;  1HY8 A;  2GZE A;  1M90 Q;  2N6Z A;  1VQ8 P;  3G1G A;  1N8R Q;  2LL8 A;  3LRY A;  4U0D A;  1VQ4 P;  1IMP A;  1QRJ A;  2PEI A;  5HGO A;  1AUM A;  4MRT C;  2EIA A;  1ZMB A;  1GPJ A;  2ROQ A;  2GDW A;  2FQ2 A;  1VQK P;  3DTJ A;  2VLP A;  5JPA A;  1W2B O;  7CEI A;  5HV8 A;  2AFE A;  1IUQ A;  2K0Y A;  2K94 A;  1E0H A;  1L0I A;  2FVE A;  3DPH A;  2VSQ A;  4COC A;  3G0V A;  2CNR A;  4WYM A;  2PY8 A;  2FQ0 A;  3M1M A;  1YIJ P;  4BPG A;  2X2B A;  2KGE A;  3DS0 A;  1KQS O;  3H47 A;  3MGE A;  2FVA A;  2PEM A;  4U0E A;  2PEK A;  5BS2 A;  1Z6M A;  2K5X A;  2XZ0 D;  3CXC O;  2OTL P;  3DS5 A;  2FAD A;  2XV6 A;  4XRQ A;  2QEX P;  2CQ8 A;  2EHT A;  2JU2 A;  1T8K A;  4QKO A;  5KP7 B;  1QVG O;  2L6E A;  5HGM A;  2QNW A;  2XT1 A;  3G28 A;  1YI2 P;  1YJ9 P;  1ACP A;  3Q20 A;  3G1I A;  1M1K Q;  4U0F A;  2FAC A;  2EG5 A;  3B4Q A;  4QNB A;  3CPW O;  1A8O A;  1UJZ A;  2Z44 A;  1BXI A;  1GXG A;  3RG2 A;  4CA3 A;  1NQ4 A;  1X3O A;  5DCK A;  1EMV A;  4XFX A;  2FVF A;  1ZNV A;  2KGA A;  4NEO A;  1BAJ A;  3HYB A;  2CWO A;  2KW2 A;  1OR5 A;  2KOP A;  4U0C A;  5HGL A;  3B5I A;  3DS1 A;  2OAR A;  2M8L A;  3G71 P;  3CC7 P;  2LIW A;  3EJD A;  1Q86 Q;  1JJ2 O;  2N50 A;  3VRL C;  3CCM P;  2MF4 A;  2LPK A;  2BUO A;  1Q82 Q;  2KR5 A;  2CGQ A;  2M5R A;  3NY7 B;  2JYG A;  2PEO A;  1F80 D;  3CE7 A;  2JU1 A;  1M6N A;  5HVC A;  2KG8 A;  4XRO A;  2N6Y A;  3RG6 C;  3WBH A;  3I55 P;  1VQL P;  1IMQ A;  4COP A;  1RO0 A;  2AVA A;  1KC8 Q;  1S72 P;  3GKL C;  3HZQ A;  2NO8 A;  2PEJ A;  1EOQ A;  2ONT A;  3CCL P;  1VKU A;  2GYK A;  2GZG A;  1KLP A;  2FQ1 A;  2GDX A;  1NJI Q;  2L4B A;  3DS4 A;  3E2D A;  3GZL A;  3CME P;  4H2Y C;  1VQN P;  2JAZ A;  2KOQ A;  2KGD A;  4BPH A;  3GZM A;  2LTE A;  2MD9 A;  1E6J P;  4PWV B;  4PH0 A;  2KG9 A;  2K0D X;  2FHS C;  2E1M A;  1RNI A;  3CC4 P;  3G29 A;  2PEQ A;  4PH1 A;  2AF8 A;  2QA4 P;  2MVU A;  3GJN A;  3DS2 A;  1VQ5 P;  1K9M Q;  4HKG A;  2MY5 A;  1VQO P;  4PXH B;  3CCV P;  4BPF A;  1DNY A;  3NTE A; 
#chains in the Genus database with same CATH homology
 2M8L A;  3CCR P;  3G71 P;  1Q7Y Q;  1EIA A;  2KOD A;  3I56 P;  3CC7 P;  3G0V A;  5HGN A;  3G21 A;  4WYM A;  2PY8 A;  3M1M A;  1Q86 Q;  1JJ2 O;  5BS1 A;  1YIJ P;  5F2O A;  3VRL C;  3CCM P;  3DS0 A;  4U0A A;  1KQS O;  5F2N A;  3H47 A;  1M74 A;  3MGE A;  2BUO A;  1Q82 Q;  3DS3 A;  4IPY A;  2DGY A;  3OW2 O;  3CD6 P;  3H4E A;  2PEM A;  2M8P A;  2XXM A;  4XFY A;  4U0E A;  1YIT P;  2PEK A;  2JYG A;  5BS2 A;  2PEO A;  1Q81 Q;  1K30 A;  1M6N A;  3G26 A;  4XRO A;  3RG6 C;  3CXC O;  3WBH A;  2OTL P;  1YHQ P;  2Z46 A;  1YJN P;  3DS5 A;  2XV6 A;  4XRQ A;  3I55 P;  1VQL P;  3CC2 P;  2QEX P;  1A43 A;  1D1D A;  4COP A;  1RO0 A;  4GR2 A;  1KC8 Q;  4M0I A;  1S72 P;  2BHV A;  3CMA P;  3HZQ A;  2Z45 A;  2PEJ A;  1EOQ A;  2M8N A;  2ONT A;  1VQM P;  3CCL P;  1QVG O;  2L6E A;  5HGM A;  1KD1 Q;  3G6E P;  3CCS P;  5I4T G;  3DS4 A;  3E2D A;  1NJI Q;  3G28 A;  2XT1 A;  3CME P;  1QVF O;  1VQN P;  1M6E X;  4XFZ A;  1YI2 P;  1VQP P;  3P05 A;  3CCE P;  2EFJ A;  1YJ9 P;  1VQ6 P;  4GR6 A;  5F2K A;  3Q20 A;  3G1I A;  1E6J P;  1VQ9 P;  1M1K Q;  4PH0 A;  4U0F A;  3CCQ P;  2OTJ P;  2EG5 A;  2PEN A;  4QNB A;  4U0B A;  3CPW O;  1A8O A;  2JYL A;  1M90 Q;  1VQ8 P;  2E1M A;  1RNI A;  3G1G A;  1N8R Q;  3CCU P;  3CC4 P;  3LRY A;  3G29 A;  4U0D A;  1K73 Q;  1K8A Q;  2PEQ A;  4PH1 A;  2Z44 A;  1QRJ A;  2PEI A;  5HGO A;  1AUM A;  2EIA A;  3H0D A;  1YJW P;  2LF4 A;  2QA4 P;  3G4S P;  1ZMB A;  3DS2 A;  1VQ5 P;  1K9M Q;  1VQ7 P;  5DCK A;  1VQK P;  3DTJ A;  4XFX A;  5JPA A;  1VQO P;  1W2B O;  1BAJ A;  1VQ4 P;  3HYB A;  3CCJ P;  2CWO A;  2P9X A;  4U0C A;  2JO0 A;  5HGL A;  1IUQ A;  3CCV P;  3DPH A;  3B5I A;  4COC A;  3NTE A;  1RO2 A;  3DS1 A;  2OAR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...