4GR6A

Crystal structure of atrbcx2 from arabidopsis thaliana
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
104
structure length
104
Chain Sequence
TFGDVQKQIVNYFTYKAVRTVLHQLYEMNPPQYTWFYNHIITNRPTDGKRFLRALGKESQELAERVMITRLHLYGKWIKKADHGKIYQEISDENLALMRERLME
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords AtRbcX2
publication title Insights into eukaryotic Rubisco assembly - Crystal structures of RbcX chaperones from Arabidopsis thaliana.
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 45
structure length 104
sequence length 104
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02341 RcbX RbcX protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.210 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 4gr6A00
2PEIA 2PEOA 2Z45A 4GR6A 4GR2A 3Q20A 2PEMA 2PEJA 5BS1A 2PEKA 2PEQA 2PY8A 2Z44A 3RG6C 2PENA 3HYBA 2Z46A 5BS2A
chains in the Genus database with same CATH superfamily
2K2QA 3VRLC 2EHSA 4BPGA 2KGAA 1KLPA 3H47A 2KR5A 2XZ1C 4H2XC 4U0BA 4BPFA 4CA3A 5HVCA 4HKGA 2KG8A 2EG5A 1EMVA 2MR8A 1YJNP 2CG5B 5HGMA 3HYBA 2M8NA 1VQ4P 3CE7A 4R0MA 2MD9A 3CCSP 1K8AQ 2XZ0D 2K0DX 2K93A 3G21A 2PEJA 1RO2A 1K30A 2JYLA 1AUMA 3GKLC 4U0CA 3DTJA 3GZLA 4UHPB 3CCMP 1YJ9P 1QVFO 4F37A 1QVGO 2QNWA 1VQ6P 1E0HA 2JO0A 1VQ8P 2MF4A 1M90Q 2OTLP 4MRTC 5BS1A 5HGNA 2BHVA 5DCKA 1K73Q 2PEOA 4U0AA 4PH1A 3NY7B 2KWLA 4XFYA 2E1MA 5F2NA 4GR2A 3CCEP 3H4EA 1E6JP 2EIAA 1ZNVA 2MVVA 1EIAA 1DV5A 3CCRP 1M6EX 1ZMBA 1ACPA 4IZ6A 1HQBA 1T8KA 4U0EA 1VQNP 3MGEA 2CNRA 3M1MA 3E2DA 4DG9A 2JAZA 2LMLA 1YI2P 2DNWA 3G71P 2VLQA 3LMOA 3CC7P 3DS1A 5HGLA 1DNYA 2XXMA 3DS5A 4GR6A 4PXHB 3B5IA 2ERHA 2KOQA 3CD6P 1FR2A 1L0IA 1Z6MA 2LPKA 3CCVP 1W2BO 2LTEA 3HZQA 1JJ2O 2K94A 1VHNA 1KC8Q 3CCUP 3GZMA 5F2OA 2JB0A 5KP7B 1UJZA 2JYGA 3B4QA 1M74A 3CC4P 3GJNA 2KGCA 1VQKP 2LKIA 2OTJP 2KORA 1NQ4A 2EFJA 1A43A 2AFEA 3G0VA 5EW5E 4H2YC 2FADA 2VLNA 1VQPP 2KGDA 2MY5A 1CEIA 3EJEA 1YJWP 2LF4A 1HY8A 2AFDA 2Z46A 4XROA 3CXCO 3DS3A 4H2WC 3RG6C 1S72P 2GZFA 2L22A 4QKOA 3G28A 5EJDA 1GPJA 5F2KA 1Q82Q 2KW2A 3G4SP 2GZJA 2FQ2A 3DPHA 3LRYA 3DS4A 1QRJA 2GDYA 5KP8B 2KODA 4COCA 2KG9A 2GYKA 1AYIA 2ONTA 1Q7YQ 1X3OA 2JGPA 3CMEP 3CCQP 3OW2O 2KGEA 4M0IA 3DS2A 1VQOP 5KP6B 1RNIA 2X2BA 4XRQA 1UNKA 1L0HA 1YIJP 2N5HA 1IMPA 2P9XA 5JPAA 5BS2A 3I55P 1GXGA 3G29A 2CQ8A 2BUOA 1K9MQ 2EHTA 2PY8A 1KQSO 4PWVB 2CWOA 4QNBA 2FACA 1M1KQ 2WPTA 2VSQA 2FHSC 1YHQP 2KG6A 3CMAP 1NJIQ 3CPWO 2PEMA 1Q86Q 3U43A 2PEKA 2KOOA 2AF8A 4U0FA 2GZGA 3DS0A 2JBGA 1BAJA 2FQ1A 2XT1A 2GZEA 2FVAA 2ROQA 7CEIA 2FQ0A 1VQLP 2Z44A 2CGQA 2GDXA 5I4TG 2FAEA 1IMQA 1VQ5P 2M5RA 4COPA 1M6NA 5HV8A 2GDWA 3WBHA 2M8PA 1MZ8A 3G1IA 2N6ZA 2AVAA 2K0YA 4BPHA 2M8LA 2LOLA 1AF8A 2LIWA 3EJDA 5HGOA 4XFZA 1D1DA 4WYMA 3P05A 2NO8A 2N50A 2L9FA 1F80D 2JQ4A 2N98A 2FVEA 1GXHA 2PENA 2K92A 3Q20A 1N8RQ 2MVUA 4PH0A 2JU1A 2L6EA 3CCLP 2LL8A 2OARA 3RG2A 2XV6A 1KD1Q 1Q81Q 2DGYA 2QEXP 3CC2P 2K5XA 3G1GA 3CCJP 2QA4P 1YITP 1VKUA 2FVFA 2VLPA 3I56P 2PEIA 1VQ9P 2JU2A 1VQ7P 2KOPA 2K0XA 2MR7A 2N6YA 2LIUA 3G6EP 1VQMP 1A8OA 2L0QA 4XFXA 2GZIA 1IUQA 3G26A 4IPYA 1RO0A 1BXIA 1OR5A 3EJBA 1EOQA 2KOSA 4NEOA 2Z45A 2VLOA 2PNGA 2PEQA 5CZDB 3NTEA 3H0DA 2L4BA 2N5IA 4U0DA
chains in the Genus database with same CATH topology
3CCRP 1M6EX 3DS4A 1QRJA 3G1IA 3VRLC 1ZMBA 3H47A 2KODA 2M8LA 4U0EA 1VQNP 4COCA 3MGEA 3M1MA 4U0BA 3E2DA 5HGOA 2ONTA 4XFZA 1D1DA 1Q7YQ 1YI2P 4WYMA 3CMEP 2EG5A 3G71P 3CC7P 3CCQP 3DS1A 5HGLA 3P05A 2XXMA 3DS5A 4GR6A 3OW2O 1YJNP 4M0IA 3B5IA 3DS2A 1VQOP 3CD6P 5HGMA 3HYBA 1RNIA 3CCVP 1W2BO 4XRQA 2PENA 1YIJP 3Q20A 2M8NA 3HZQA 1N8RQ 1VQ4P 4PH0A 2P9XA 5JPAA 5BS2A 2L6EA 1JJ2O 3CCLP 3I55P 2OARA 3G29A 3CCSP 2XV6A 1K8AQ 1KD1Q 1KC8Q 1Q81Q 3CCUP 2DGYA 2BUOA 5F2OA 1K9MQ 2QEXP 2JYGA 3CC2P 2PY8A 3G1GA 1M74A 3G21A 1KQSO 3CC4P 2PEJA 3CCJP 2CWOA 1VQKP 4QNBA 1RO2A 2QA4P 1K30A 1YITP 2OTJP 1M1KQ 2JYLA 1AUMA 4U0CA 3DTJA 2EFJA 3I56P 1YHQP 3CMAP 1A43A 3G0VA 2PEIA 1NJIQ 3CCMP 3CPWO 2PEMA 1YJ9P 1Q86Q 1VQ9P 1QVFO 2PEKA 1VQ7P 4U0FA 1QVGO 1VQ6P 1VQPP 3G6EP 1VQMP 2JO0A 1A8OA 3DS0A 4XFXA 2LF4A 1YJWP 1BAJA 1IUQA 3G26A 1VQ8P 2XT1A 2Z46A 4IPYA 1RO0A 4XROA 3CXCO 1M90Q 2OTLP 3DS3A 1EOQA 1VQLP 5BS1A 5HGNA 2Z44A 2BHVA 3RG6C 5DCKA 1S72P 1K73Q 2PEOA 2Z45A 4U0AA 4PH1A 5I4TG 2PEQA 3G28A 5F2KA 4XFYA 2E1MA 1Q82Q 3NTEA 3H0DA 3G4SP 1VQ5P 5F2NA 4GR2A 4COPA 3H4EA 1M6NA 1E6JP 2EIAA 3CCEP 3WBHA 3DPHA 3LRYA 1EIAA 4U0DA 2M8PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PEI A;  2PEO A;  2Z45 A;  4GR6 A;  4GR2 A;  3Q20 A;  2PEM A;  2PEJ A;  5BS1 A;  2PEK A;  2PEQ A;  2PY8 A;  2Z44 A;  3RG6 C;  2PEN A;  3HYB A;  2Z46 A;  5BS2 A; 
#chains in the Genus database with same CATH topology
 2K2Q A;  3VRL C;  2EHS A;  4BPG A;  2KGA A;  1KLP A;  3H47 A;  2KR5 A;  2XZ1 C;  4H2X C;  4U0B A;  4BPF A;  4CA3 A;  5HVC A;  4HKG A;  2KG8 A;  2EG5 A;  1EMV A;  2MR8 A;  1YJN P;  2CG5 B;  5HGM A;  3HYB A;  2M8N A;  1VQ4 P;  3CE7 A;  4R0M A;  2MD9 A;  3CCS P;  1K8A Q;  2XZ0 D;  2K0D X;  2K93 A;  3G21 A;  2PEJ A;  1RO2 A;  1K30 A;  2JYL A;  1AUM A;  3GKL C;  4U0C A;  3DTJ A;  3GZL A;  4UHP B;  3CCM P;  1YJ9 P;  1QVF O;  4F37 A;  1QVG O;  2QNW A;  1VQ6 P;  1E0H A;  2JO0 A;  1VQ8 P;  2MF4 A;  1M90 Q;  2OTL P;  4MRT C;  5BS1 A;  5HGN A;  2BHV A;  5DCK A;  1K73 Q;  2PEO A;  4U0A A;  4PH1 A;  3NY7 B;  2KWL A;  4XFY A;  2E1M A;  5F2N A;  4GR2 A;  3CCE P;  3H4E A;  1E6J P;  2EIA A;  1ZNV A;  2MVV A;  1EIA A;  1DV5 A;  3CCR P;  1M6E X;  1ZMB A;  1ACP A;  4IZ6 A;  1HQB A;  1T8K A;  4U0E A;  1VQN P;  3MGE A;  2CNR A;  3M1M A;  3E2D A;  4DG9 A;  2JAZ A;  2LML A;  1YI2 P;  2DNW A;  3G71 P;  2VLQ A;  3LMO A;  3CC7 P;  3DS1 A;  5HGL A;  1DNY A;  2XXM A;  3DS5 A;  4GR6 A;  4PXH B;  3B5I A;  2ERH A;  2KOQ A;  3CD6 P;  1FR2 A;  1L0I A;  1Z6M A;  2LPK A;  3CCV P;  1W2B O;  2LTE A;  3HZQ A;  1JJ2 O;  2K94 A;  1VHN A;  1KC8 Q;  3CCU P;  3GZM A;  5F2O A;  2JB0 A;  5KP7 B;  1UJZ A;  2JYG A;  3B4Q A;  1M74 A;  3CC4 P;  3GJN A;  2KGC A;  1VQK P;  2LKI A;  2OTJ P;  2KOR A;  1NQ4 A;  2EFJ A;  1A43 A;  2AFE A;  3G0V A;  5EW5 E;  4H2Y C;  2FAD A;  2VLN A;  1VQP P;  2KGD A;  2MY5 A;  1CEI A;  3EJE A;  1YJW P;  2LF4 A;  1HY8 A;  2AFD A;  2Z46 A;  4XRO A;  3CXC O;  3DS3 A;  4H2W C;  3RG6 C;  1S72 P;  2GZF A;  2L22 A;  4QKO A;  3G28 A;  5EJD A;  1GPJ A;  5F2K A;  1Q82 Q;  2KW2 A;  3G4S P;  2GZJ A;  2FQ2 A;  3DPH A;  3LRY A;  3DS4 A;  1QRJ A;  2GDY A;  5KP8 B;  2KOD A;  4COC A;  2KG9 A;  2GYK A;  1AYI A;  2ONT A;  1Q7Y Q;  1X3O A;  2JGP A;  3CME P;  3CCQ P;  3OW2 O;  2KGE A;  4M0I A;  3DS2 A;  1VQO P;  5KP6 B;  1RNI A;  2X2B A;  4XRQ A;  1UNK A;  1L0H A;  1YIJ P;  2N5H A;  1IMP A;  2P9X A;  5JPA A;  5BS2 A;  3I55 P;  1GXG A;  3G29 A;  2CQ8 A;  2BUO A;  1K9M Q;  2EHT A;  2PY8 A;  1KQS O;  4PWV B;  2CWO A;  4QNB A;  2FAC A;  1M1K Q;  2WPT A;  2VSQ A;  2FHS C;  1YHQ P;  2KG6 A;  3CMA P;  1NJI Q;  3CPW O;  2PEM A;  1Q86 Q;  3U43 A;  2PEK A;  2KOO A;  2AF8 A;  4U0F A;  2GZG A;  3DS0 A;  2JBG A;  1BAJ A;  2FQ1 A;  2XT1 A;  2GZE A;  2FVA A;  2ROQ A;  7CEI A;  2FQ0 A;  1VQL P;  2Z44 A;  2CGQ A;  2GDX A;  5I4T G;  2FAE A;  1IMQ A;  1VQ5 P;  2M5R A;  4COP A;  1M6N A;  5HV8 A;  2GDW A;  3WBH A;  2M8P A;  1MZ8 A;  3G1I A;  2N6Z A;  2AVA A;  2K0Y A;  4BPH A;  2M8L A;  2LOL A;  1AF8 A;  2LIW A;  3EJD A;  5HGO A;  4XFZ A;  1D1D A;  4WYM A;  3P05 A;  2NO8 A;  2N50 A;  2L9F A;  1F80 D;  2JQ4 A;  2N98 A;  2FVE A;  1GXH A;  2PEN A;  2K92 A;  3Q20 A;  1N8R Q;  2MVU A;  4PH0 A;  2JU1 A;  2L6E A;  3CCL P;  2LL8 A;  2OAR A;  3RG2 A;  2XV6 A;  1KD1 Q;  1Q81 Q;  2DGY A;  2QEX P;  3CC2 P;  2K5X A;  3G1G A;  3CCJ P;  2QA4 P;  1YIT P;  1VKU A;  2FVF A;  2VLP A;  3I56 P;  2PEI A;  1VQ9 P;  2JU2 A;  1VQ7 P;  2KOP A;  2K0X A;  2MR7 A;  2N6Y A;  2LIU A;  3G6E P;  1VQM P;  1A8O A;  2L0Q A;  4XFX A;  2GZI A;  1IUQ A;  3G26 A;  4IPY A;  1RO0 A;  1BXI A;  1OR5 A;  3EJB A;  1EOQ A;  2KOS A;  4NEO A;  2Z45 A;  2VLO A;  2PNG A;  2PEQ A;  5CZD B;  3NTE A;  3H0D A;  2L4B A;  2N5I A;  4U0D A; 
#chains in the Genus database with same CATH homology
 3CCR P;  1M6E X;  3DS4 A;  1QRJ A;  3G1I A;  3VRL C;  1ZMB A;  3H47 A;  2KOD A;  2M8L A;  4U0E A;  1VQN P;  4COC A;  3MGE A;  3M1M A;  4U0B A;  3E2D A;  5HGO A;  2ONT A;  4XFZ A;  1D1D A;  1Q7Y Q;  1YI2 P;  4WYM A;  3CME P;  2EG5 A;  3G71 P;  3CC7 P;  3CCQ P;  3DS1 A;  5HGL A;  3P05 A;  2XXM A;  3DS5 A;  4GR6 A;  3OW2 O;  1YJN P;  4M0I A;  3B5I A;  3DS2 A;  1VQO P;  3CD6 P;  5HGM A;  3HYB A;  1RNI A;  3CCV P;  1W2B O;  4XRQ A;  2PEN A;  1YIJ P;  3Q20 A;  2M8N A;  3HZQ A;  1N8R Q;  1VQ4 P;  4PH0 A;  2P9X A;  5JPA A;  5BS2 A;  2L6E A;  1JJ2 O;  3CCL P;  3I55 P;  2OAR A;  3G29 A;  3CCS P;  2XV6 A;  1K8A Q;  1KD1 Q;  1KC8 Q;  1Q81 Q;  3CCU P;  2DGY A;  2BUO A;  5F2O A;  1K9M Q;  2QEX P;  2JYG A;  3CC2 P;  2PY8 A;  3G1G A;  1M74 A;  3G21 A;  1KQS O;  3CC4 P;  2PEJ A;  3CCJ P;  2CWO A;  1VQK P;  4QNB A;  1RO2 A;  2QA4 P;  1K30 A;  1YIT P;  2OTJ P;  1M1K Q;  2JYL A;  1AUM A;  4U0C A;  3DTJ A;  2EFJ A;  3I56 P;  1YHQ P;  3CMA P;  1A43 A;  3G0V A;  2PEI A;  1NJI Q;  3CCM P;  3CPW O;  2PEM A;  1YJ9 P;  1Q86 Q;  1VQ9 P;  1QVF O;  2PEK A;  1VQ7 P;  4U0F A;  1QVG O;  1VQ6 P;  1VQP P;  3G6E P;  1VQM P;  2JO0 A;  1A8O A;  3DS0 A;  4XFX A;  2LF4 A;  1YJW P;  1BAJ A;  1IUQ A;  3G26 A;  1VQ8 P;  2XT1 A;  2Z46 A;  4IPY A;  1RO0 A;  4XRO A;  3CXC O;  1M90 Q;  2OTL P;  3DS3 A;  1EOQ A;  1VQL P;  5BS1 A;  5HGN A;  2Z44 A;  2BHV A;  3RG6 C;  5DCK A;  1S72 P;  1K73 Q;  2PEO A;  2Z45 A;  4U0A A;  4PH1 A;  5I4T G;  2PEQ A;  3G28 A;  5F2K A;  4XFY A;  2E1M A;  1Q82 Q;  3NTE A;  3H0D A;  3G4S P;  1VQ5 P;  5F2N A;  4GR2 A;  4COP A;  3H4E A;  1M6N A;  1E6J P;  2EIA A;  3CCE P;  3WBH A;  3DPH A;  3LRY A;  1EIA A;  4U0D A;  2M8P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...