4GR6A

Crystal structure of atrbcx2 from arabidopsis thaliana
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
104
structure length
104
Chain Sequence
TFGDVQKQIVNYFTYKAVRTVLHQLYEMNPPQYTWFYNHIITNRPTDGKRFLRALGKESQELAERVMITRLHLYGKWIKKADHGKIYQEISDENLALMRERLME
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into eukaryotic Rubisco assembly - Crystal structures of RbcX chaperones from Arabidopsis thaliana.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Chaperone
molecule keywords AtRbcX2
total genus 45
structure length 104
sequence length 104
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02341 RcbX RbcX protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.210 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 4gr6A00
5BS2A 2PEKA 2PEQA 2Z46A 3RG6C 3Q20A 5BS1A 4GR2A 2PEMA 4GR6A 2PENA 3HYBA 2Z45A 2Z44A 2PEJA 2PEIA 2PEOA 2PY8A
chains in the Genus database with same CATH superfamily
2LL8A 4GR6A 1IMPA 4BPHA 1Q81Q 5DCKA 1NJIQ 2KGAA 3LMOA 3Q20A 3CPWO 2PEMA 2ONTA 5F2OA 1UNKA 2JBGA 3H4EA 1KQSO 1M74A 4U0AA 2EFJA 2FADA 2MR7A 2OTLP 2M5RA 2K0DX 2OARA 2ERHA 1QRJA 3MGEA 2KOSA 2XT1A 2FQ0A 2DNWA 5HGOA 3G71P 3HYBA 3I56P 1Q82Q 2LIUA 2GZEA 2P9XA 4XFYA 4XRQA 2PY8A 1EIAA 5KP7B 1ACPA 5BS2A 2GZJA 2CGQA 3P05A 1FR2A 2PEJA 2M8PA 4BPGA 3M1MA 1L0HA 3EJBA 2KW2A 1YITP 2LIWA 1KC8Q 2L6EA 3DS5A 1HQBA 1VQ4P 3CCLP 2GYKA 2GZFA 2Z44A 1BXIA 4U0DA 2KGCA 2XV6A 2KOOA 2LKIA 1OR5A 2FVAA 2PEKA 3G4SP 1KLPA 1VQ7P 1QVFO 2KOPA 2GZIA 3GKLC 4XFZA 4IPYA 2K0XA 4NEOA 2AF8A 5F2KA 1GPJA 3GZMA 2KGEA 5HVCA 3CCUP 4PH0A 2JQ4A 4PH1A 2PEIA 3G29A 4UHPB 3VRLC 1VQOP 3CC2P 3CC7P 5KP8B 4R0MA 2MY5A 2OTJP 4IZ6A 5EJDA 1F80D 3CCMP 5EW5E 2L22A 1Z6MA 2EHSA 4H2XC 3DS1A 1M90Q 1VQ6P 1YJNP 1E0HA 3H47A 1RO0A 3EJEA 1VQMP 1GXHA 2MVVA 3G28A 1K9MQ 1M1KQ 2K2QA 4U0CA 1MZ8A 4COCA 1UJZA 2CQ8A 1A43A 4XROA 3CC4P 1VHNA 1ZNVA 3CCEP 2EHTA 2N6YA 2EIAA 1A8OA 2KGDA 3G1IA 2DGYA 2L0QA 1HY8A 4H2YC 2K5XA 5HV8A 5F2NA 2KODA 1DNYA 2AVAA 2N5HA 2JAZA 4QNBA 5KP6B 1K73Q 1VQ8P 4GR2A 2CG5B 3G21A 2CNRA 2K93A 4QKOA 1YIJP 2K94A 7CEIA 2LTEA 1IUQA 1VQ9P 1YJWP 3NY7B 2E1MA 3CCRP 4U0EA 2N98A 2KORA 3DPHA 2AFDA 1NQ4A 3CMAP 2L9FA 2QNWA 2XZ1C 3B4QA 5HGNA 1GXGA 1DV5A 1Q7YQ 3GJNA 3GZLA 3B5IA 4PWVB 5HGLA 3CMEP 2KR5A 1BAJA 3CXCO 1QVGO 1VQPP 1K8AQ 1VQ5P 2N5IA 2PENA 2WPTA 3CCJP 3G26A 2JO0A 1M6NA 3EJDA 5I4TG 2XXMA 1IMQA 3CCQP 2AFEA 3H0DA 2VLNA 1YI2P 4CA3A 4PXHB 2LMLA 2M8NA 1EMVA 2VLPA 2VSQA 3RG2A 2MR8A 3RG6C 1Q86Q 5CZDB 2GDYA 2CWOA 1YJ9P 3HZQA 4U0BA 4XFXA 4BPFA 1K30A 3CE7A 2GZGA 3DTJA 1M6EX 4U0FA 2N6ZA 3DS2A 3NTEA 2M8LA 2BHVA 2LF4A 2LPKA 1E6JP 5HGMA 2KG6A 1X3OA 2VLOA 2JGPA 2K0YA 1S72P 3G0VA 4MRTC 4HKGA 3CCVP 2EG5A 2JYLA 2QA4P 1W2BO 1AYIA 2KOQA 3DS0A 2KG8A 2K92A 4M0IA 2PNGA 1L0IA 2JU1A 3OW2O 1N8RQ 2Z46A 3G6EP 2KWLA 2N50A 1VKUA 3DS4A 2NO8A 2FVFA 2MD9A 1EOQA 3G1GA 2LOLA 3I55P 2PEQA 2VLQA 1CEIA 4H2WC 2JU2A 1ZMBA 2FQ1A 1VQNP 2FVEA 4WYMA 2QEXP 4F37A 1AUMA 1T8KA 3U43A 2Z45A 1RNIA 1YHQP 1D1DA 2XZ0D 2BUOA 2L4BA 3LRYA 2MF4A 4COPA 2PEOA 5BS1A 1KD1Q 2ROQA 3WBHA 1RO2A 3CCSP 3DS3A 3CD6P 2JYGA 2FQ2A 2GDWA 1AF8A 5JPAA 2X2BA 2FACA 1VQLP 4DG9A 2JB0A 2MVUA 2GDXA 3E2DA 1JJ2O 1VQKP 2FHSC 2FAEA 2KG9A
chains in the Genus database with same CATH topology
2PEKA 1E6JP 5HGMA 4GR6A 3G4SP 1IUQA 1Q81Q 1VQ9P 5DCKA 1YJWP 1VQ7P 1QVFO 1S72P 1NJIQ 2E1MA 3CCRP 3G0VA 4U0EA 4XFZA 4IPYA 3DPHA 5F2KA 3Q20A 3CPWO 2PEMA 2ONTA 5F2OA 3H4EA 3CMAP 3CCUP 3CCVP 4PH0A 1KQSO 4PH1A 1M74A 5HGNA 2PEIA 3G29A 2EG5A 4U0AA 2JYLA 2EFJA 3VRLC 1VQOP 1Q7YQ 2QA4P 3CC2P 2OTLP 3CC7P 2OARA 1QRJA 1W2BO 3DS0A 3B5IA 3MGEA 5HGLA 3CMEP 2OTJP 1BAJA 4M0IA 3CXCO 1QVGO 1VQPP 1K8AQ 1VQ5P 2XT1A 3CCMP 3OW2O 1N8RQ 2Z46A 3G6EP 3DS1A 2PENA 5HGOA 3G71P 1M90Q 3CCJP 3HYBA 3G26A 3DS4A 2JO0A 1VQ6P 1YJNP 1EOQA 1M6NA 3G1GA 3I56P 3I55P 1Q82Q 3H47A 1RO0A 2PEQA 5I4TG 2P9XA 1VQMP 4XFYA 4XRQA 1K9MQ 2XXMA 3G28A 3CCQP 1ZMBA 4U0CA 3H0DA 1M1KQ 1YI2P 1VQNP 4WYMA 4COCA 2QEXP 2PY8A 1EIAA 1AUMA 2M8NA 1A43A 4XROA 5BS2A 3CC4P 3P05A 3CCEP 2Z45A 1RNIA 2PEJA 2EIAA 1A8OA 1YHQP 3RG6C 1D1DA 3G1IA 2M8PA 3M1MA 2DGYA 2BUOA 3LRYA 1Q86Q 5F2NA 2KODA 1YITP 2CWOA 1KC8Q 4COPA 2L6EA 2PEOA 1YJ9P 3DS5A 5BS1A 1KD1Q 3WBHA 1RO2A 3CCSP 4QNBA 3DS3A 3HZQA 1VQ4P 4U0BA 2JYGA 3CD6P 4XFXA 3CCLP 1K73Q 1K30A 5JPAA 1VQLP 1VQ8P 4GR2A 3DTJA 1M6EX 4U0FA 2Z44A 4U0DA 3G21A 3DS2A 3E2DA 1JJ2O 1VQKP 3NTEA 2M8LA 2BHVA 1YIJP 2LF4A 2XV6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BS2 A;  2PEK A;  2PEQ A;  2Z46 A;  3RG6 C;  3Q20 A;  5BS1 A;  4GR2 A;  2PEM A;  4GR6 A;  2PEN A;  3HYB A;  2Z45 A;  2Z44 A;  2PEJ A;  2PEI A;  2PEO A;  2PY8 A; 
#chains in the Genus database with same CATH topology
 2LL8 A;  4GR6 A;  1IMP A;  4BPH A;  1Q81 Q;  5DCK A;  1NJI Q;  2KGA A;  3LMO A;  3Q20 A;  3CPW O;  2PEM A;  2ONT A;  5F2O A;  1UNK A;  2JBG A;  3H4E A;  1KQS O;  1M74 A;  4U0A A;  2EFJ A;  2FAD A;  2MR7 A;  2OTL P;  2M5R A;  2K0D X;  2OAR A;  2ERH A;  1QRJ A;  3MGE A;  2KOS A;  2XT1 A;  2FQ0 A;  2DNW A;  5HGO A;  3G71 P;  3HYB A;  3I56 P;  1Q82 Q;  2LIU A;  2GZE A;  2P9X A;  4XFY A;  4XRQ A;  2PY8 A;  1EIA A;  5KP7 B;  1ACP A;  5BS2 A;  2GZJ A;  2CGQ A;  3P05 A;  1FR2 A;  2PEJ A;  2M8P A;  4BPG A;  3M1M A;  1L0H A;  3EJB A;  2KW2 A;  1YIT P;  2LIW A;  1KC8 Q;  2L6E A;  3DS5 A;  1HQB A;  1VQ4 P;  3CCL P;  2GYK A;  2GZF A;  2Z44 A;  1BXI A;  4U0D A;  2KGC A;  2XV6 A;  2KOO A;  2LKI A;  1OR5 A;  2FVA A;  2PEK A;  3G4S P;  1KLP A;  1VQ7 P;  1QVF O;  2KOP A;  2GZI A;  3GKL C;  4XFZ A;  4IPY A;  2K0X A;  4NEO A;  2AF8 A;  5F2K A;  1GPJ A;  3GZM A;  2KGE A;  5HVC A;  3CCU P;  4PH0 A;  2JQ4 A;  4PH1 A;  2PEI A;  3G29 A;  4UHP B;  3VRL C;  1VQO P;  3CC2 P;  3CC7 P;  5KP8 B;  4R0M A;  2MY5 A;  2OTJ P;  4IZ6 A;  5EJD A;  1F80 D;  3CCM P;  5EW5 E;  2L22 A;  1Z6M A;  2EHS A;  4H2X C;  3DS1 A;  1M90 Q;  1VQ6 P;  1YJN P;  1E0H A;  3H47 A;  1RO0 A;  3EJE A;  1VQM P;  1GXH A;  2MVV A;  3G28 A;  1K9M Q;  1M1K Q;  2K2Q A;  4U0C A;  1MZ8 A;  4COC A;  1UJZ A;  2CQ8 A;  1A43 A;  4XRO A;  3CC4 P;  1VHN A;  1ZNV A;  3CCE P;  2EHT A;  2N6Y A;  2EIA A;  1A8O A;  2KGD A;  3G1I A;  2DGY A;  2L0Q A;  1HY8 A;  4H2Y C;  2K5X A;  5HV8 A;  5F2N A;  2KOD A;  1DNY A;  2AVA A;  2N5H A;  2JAZ A;  4QNB A;  5KP6 B;  1K73 Q;  1VQ8 P;  4GR2 A;  2CG5 B;  3G21 A;  2CNR A;  2K93 A;  4QKO A;  1YIJ P;  2K94 A;  7CEI A;  2LTE A;  1IUQ A;  1VQ9 P;  1YJW P;  3NY7 B;  2E1M A;  3CCR P;  4U0E A;  2N98 A;  2KOR A;  3DPH A;  2AFD A;  1NQ4 A;  3CMA P;  2L9F A;  2QNW A;  2XZ1 C;  3B4Q A;  5HGN A;  1GXG A;  1DV5 A;  1Q7Y Q;  3GJN A;  3GZL A;  3B5I A;  4PWV B;  5HGL A;  3CME P;  2KR5 A;  1BAJ A;  3CXC O;  1QVG O;  1VQP P;  1K8A Q;  1VQ5 P;  2N5I A;  2PEN A;  2WPT A;  3CCJ P;  3G26 A;  2JO0 A;  1M6N A;  3EJD A;  5I4T G;  2XXM A;  1IMQ A;  3CCQ P;  2AFE A;  3H0D A;  2VLN A;  1YI2 P;  4CA3 A;  4PXH B;  2LML A;  2M8N A;  1EMV A;  2VLP A;  2VSQ A;  3RG2 A;  2MR8 A;  3RG6 C;  1Q86 Q;  5CZD B;  2GDY A;  2CWO A;  1YJ9 P;  3HZQ A;  4U0B A;  4XFX A;  4BPF A;  1K30 A;  3CE7 A;  2GZG A;  3DTJ A;  1M6E X;  4U0F A;  2N6Z A;  3DS2 A;  3NTE A;  2M8L A;  2BHV A;  2LF4 A;  2LPK A;  1E6J P;  5HGM A;  2KG6 A;  1X3O A;  2VLO A;  2JGP A;  2K0Y A;  1S72 P;  3G0V A;  4MRT C;  4HKG A;  3CCV P;  2EG5 A;  2JYL A;  2QA4 P;  1W2B O;  1AYI A;  2KOQ A;  3DS0 A;  2KG8 A;  2K92 A;  4M0I A;  2PNG A;  1L0I A;  2JU1 A;  3OW2 O;  1N8R Q;  2Z46 A;  3G6E P;  2KWL A;  2N50 A;  1VKU A;  3DS4 A;  2NO8 A;  2FVF A;  2MD9 A;  1EOQ A;  3G1G A;  2LOL A;  3I55 P;  2PEQ A;  2VLQ A;  1CEI A;  4H2W C;  2JU2 A;  1ZMB A;  2FQ1 A;  1VQN P;  2FVE A;  4WYM A;  2QEX P;  4F37 A;  1AUM A;  1T8K A;  3U43 A;  2Z45 A;  1RNI A;  1YHQ P;  1D1D A;  2XZ0 D;  2BUO A;  2L4B A;  3LRY A;  2MF4 A;  4COP A;  2PEO A;  5BS1 A;  1KD1 Q;  2ROQ A;  3WBH A;  1RO2 A;  3CCS P;  3DS3 A;  3CD6 P;  2JYG A;  2FQ2 A;  2GDW A;  1AF8 A;  5JPA A;  2X2B A;  2FAC A;  1VQL P;  4DG9 A;  2JB0 A;  2MVU A;  2GDX A;  3E2D A;  1JJ2 O;  1VQK P;  2FHS C;  2FAE A;  2KG9 A; 
#chains in the Genus database with same CATH homology
 2PEK A;  1E6J P;  5HGM A;  4GR6 A;  3G4S P;  1IUQ A;  1Q81 Q;  1VQ9 P;  5DCK A;  1YJW P;  1VQ7 P;  1QVF O;  1S72 P;  1NJI Q;  2E1M A;  3CCR P;  3G0V A;  4U0E A;  4XFZ A;  4IPY A;  3DPH A;  5F2K A;  3Q20 A;  3CPW O;  2PEM A;  2ONT A;  5F2O A;  3H4E A;  3CMA P;  3CCU P;  3CCV P;  4PH0 A;  1KQS O;  4PH1 A;  1M74 A;  5HGN A;  2PEI A;  3G29 A;  2EG5 A;  4U0A A;  2JYL A;  2EFJ A;  3VRL C;  1VQO P;  1Q7Y Q;  2QA4 P;  3CC2 P;  2OTL P;  3CC7 P;  2OAR A;  1QRJ A;  1W2B O;  3DS0 A;  3B5I A;  3MGE A;  5HGL A;  3CME P;  2OTJ P;  1BAJ A;  4M0I A;  3CXC O;  1QVG O;  1VQP P;  1K8A Q;  1VQ5 P;  2XT1 A;  3CCM P;  3OW2 O;  1N8R Q;  2Z46 A;  3G6E P;  3DS1 A;  2PEN A;  5HGO A;  3G71 P;  1M90 Q;  3CCJ P;  3HYB A;  3G26 A;  3DS4 A;  2JO0 A;  1VQ6 P;  1YJN P;  1EOQ A;  1M6N A;  3G1G A;  3I56 P;  3I55 P;  1Q82 Q;  3H47 A;  1RO0 A;  2PEQ A;  5I4T G;  2P9X A;  1VQM P;  4XFY A;  4XRQ A;  1K9M Q;  2XXM A;  3G28 A;  3CCQ P;  1ZMB A;  4U0C A;  3H0D A;  1M1K Q;  1YI2 P;  1VQN P;  4WYM A;  4COC A;  2QEX P;  2PY8 A;  1EIA A;  1AUM A;  2M8N A;  1A43 A;  4XRO A;  5BS2 A;  3CC4 P;  3P05 A;  3CCE P;  2Z45 A;  1RNI A;  2PEJ A;  2EIA A;  1A8O A;  1YHQ P;  3RG6 C;  1D1D A;  3G1I A;  2M8P A;  3M1M A;  2DGY A;  2BUO A;  3LRY A;  1Q86 Q;  5F2N A;  2KOD A;  1YIT P;  2CWO A;  1KC8 Q;  4COP A;  2L6E A;  2PEO A;  1YJ9 P;  3DS5 A;  5BS1 A;  1KD1 Q;  3WBH A;  1RO2 A;  3CCS P;  4QNB A;  3DS3 A;  3HZQ A;  1VQ4 P;  4U0B A;  2JYG A;  3CD6 P;  4XFX A;  3CCL P;  1K73 Q;  1K30 A;  5JPA A;  1VQL P;  1VQ8 P;  4GR2 A;  3DTJ A;  1M6E X;  4U0F A;  2Z44 A;  4U0D A;  3G21 A;  3DS2 A;  3E2D A;  1JJ2 O;  1VQK P;  3NTE A;  2M8L A;  2BHV A;  1YIJ P;  2LF4 A;  2XV6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...