4GR6A

Crystal structure of atrbcx2 from arabidopsis thaliana
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
104
structure length
104
Chain Sequence
TFGDVQKQIVNYFTYKAVRTVLHQLYEMNPPQYTWFYNHIITNRPTDGKRFLRALGKESQELAERVMITRLHLYGKWIKKADHGKIYQEISDENLALMRERLME
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into eukaryotic Rubisco assembly - Crystal structures of RbcX chaperones from Arabidopsis thaliana.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Chaperone
molecule keywords AtRbcX2
total genus 45
structure length 104
sequence length 104
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02341 RcbX RbcX protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.210 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 4gr6A00
2PEQA 5BS1A 2PENA 2PY8A 2Z46A 2Z45A 4GR2A 3RG6C 2PEIA 2PEOA 5BS2A 2PEJA 2PEKA 2PEMA 3Q20A 2Z44A 4GR6A 3HYBA
chains in the Genus database with same CATH superfamily
3RG6C 2MF4A 1DNYA 3CD6P 2KOOA 1VQ8P 3CC2P 1Q82Q 2CGQA 2GZJA 7CEIA 1NQ4A 2LF4A 5JPAA 3M1MA 1VQKP 3DS1A 2K0YA 1K73Q 1QRJA 4H2YC 4IZ6A 3G29A 5HGMA 2EFJA 2JQ4A 3CCEP 1VQLP 2PEOA 3G6EP 3E2DA 1X3OA 3CMAP 2CNRA 1K8AQ 3B5IA 3RG2A 1W2BO 3CC4P 2CG5B 2DNWA 3G0VA 3CCVP 2VLNA 3NY7B 1UNKA 3DS0A 4BPFA 4BPGA 2Z44A 2XT1A 1IUQA 2P9XA 1YJWP 2GDYA 3CXCO 3CCMP 2XXMA 1YHQP 2PEQA 1FR2A 2FQ1A 1M6EX 1VQ9P 2WPTA 3CMEP 1VQ4P 2JO0A 1BAJA 2CWOA 2QNWA 2FVFA 1T8KA 3EJDA 3G71P 3CCQP 1AYIA 4U0AA 2K93A 3G28A 2VLQA 2QEXP 1GPJA 1YITP 5HV8A 4U0FA 1Q7YQ 2L22A 3Q20A 1GXGA 2EHSA 4COCA 3P05A 2X2BA 1HY8A 1BXIA 3CCLP 1M74A 3DS4A 2Z45A 1RO0A 3CE7A 2KGEA 2L9FA 2MY5A 4PH1A 5HGLA 1QVFO 2BUOA 2FVEA 2VLPA 3VRLC 4U0CA 3DS3A 1IMQA 3CC7P 4U0DA 2L0QA 1RNIA 2LOLA 2M8PA 5BS1A 2PENA 2N6ZA 1MZ8A 2GDXA 1ZNVA 3CCRP 1UJZA 2N6YA 3LMOA 3CCJP 2MVUA 2AVAA 3WBHA 3I55P 1A8OA 4GR6A 2N98A 2MR8A 1OR5A 2JU2A 4R0MA 2GZEA 2K0XA 2PEIA 1KD1Q 1NJIQ 1M90Q 4UHPB 1IMPA 1KLPA 3MGEA 1E0HA 1VQMP 2FHSC 2KWLA 5KP8B 1Q81Q 2GDWA 3U43A 1VQ6P 3B4QA 4H2WC 1KQSO 1Q86Q 5HGOA 5EJDA 2XZ0D 1VQ7P 1A43A 1F80D 2M8NA 1JJ2O 4BPHA 4XRQA 1VHNA 5I4TG 2KGAA 3G1IA 4XFXA 1VKUA 3G21A 2GYKA 1M1KQ 2DGYA 4XFZA 2MR7A 2OARA 1K9MQ 2KG6A 2KG8A 3G26A 3GJNA 4U0BA 2QA4P 5F2OA 2KOSA 2JAZA 3G1GA 2N5IA 4PH0A 2FAEA 2MVVA 2KW2A 2N50A 1VQ5P 2KGDA 3NTEA 3CPWO 2Z46A 4F37A 3H4EA 2ERHA 5EW5E 2KODA 3CCSP 1K30A 1EOQA 1Z6MA 5HGNA 3OW2O 1VQNP 2FVAA 2GZFA 1S72P 1YI2P 2JU1A 3DPHA 5KP6B 3GZMA 1KC8Q 4WYMA 2JGPA 1L0HA 1QVGO 1AF8A 3H47A 4M0IA 2EIAA 2PNGA 1M6NA 3EJBA 1CEIA 2JYGA 4NEOA 2KGCA 1ACPA 1HQBA 2LL8A 2EG5A 1VQPP 3GKLC 1AUMA 2M8LA 3I56P 2KOPA 2LPKA 2KORA 2FQ0A 4QNBA 2MD9A 2JBGA 2GZGA 2K94A 3G4SP 2N5HA 1N8RQ 4HKGA 2LIWA 5CZDB 1YIJP 2KR5A 1DV5A 2JYLA 1YJNP 5BS2A 2LKIA 2KG9A 2XV6A 5DCKA 2VLOA 4PXHB 5KP7B 4GR2A 2FQ2A 4MRTC 2OTLP 2K0DX 2ROQA 1E6JP 3DS5A 2KOQA 4H2XC 3H0DA 4U0EA 2PEMA 2E1MA 3CCUP 3DS2A 1VQOP 1EMVA 1D1DA 2M5RA 2AFEA 1RO2A 4CA3A 2AF8A 1GXHA 2L6EA 2GZIA 1YJ9P 2LTEA 3LRYA 2LMLA 2XZ1C 2K92A 3HYBA 5F2KA 2PY8A 2NO8A 4QKOA 1ZMBA 3HZQA 2OTJP 2FACA 4PWVB 2JB0A 2L4BA 4XROA 2VSQA 4XFYA 3DTJA 2ONTA 2AFDA 4IPYA 2CQ8A 1L0IA 4COPA 5HVCA 1EIAA 2BHVA 2K5XA 2FADA 3GZLA 4DG9A 2EHTA 2LIUA 3EJEA 2PEJA 2K2QA 2PEKA 5F2NA
chains in the Genus database with same CATH topology
1AUMA 2M8LA 1KQSO 3RG6C 3I56P 1Q86Q 3CD6P 4COCA 5HGOA 3P05A 1VQ8P 3CCLP 1VQ7P 1A43A 1M74A 3DS4A 4QNBA 2Z45A 2M8NA 1Q82Q 3CC2P 1JJ2O 1RO0A 4XRQA 3G4SP 4PH1A 5HGLA 5I4TG 1QVFO 3G1IA 2BUOA 4XFXA 3G21A 1N8RQ 2LF4A 3VRLC 1M1KQ 4U0CA 2DGYA 3DS3A 4XFZA 5JPAA 2OARA 1K9MQ 3M1MA 1VQKP 1YIJP 3CC7P 3DS1A 4U0DA 1K73Q 1QRJA 1RNIA 2JYLA 3G29A 3G26A 1YJNP 5BS2A 5HGMA 2XV6A 5DCKA 2M8PA 2EFJA 4U0BA 3CCEP 5BS1A 2PENA 4GR2A 1VQLP 2QA4P 2PEOA 5F2OA 3G6EP 3E2DA 3CMAP 3G1GA 4PH0A 2OTLP 1K8AQ 3B5IA 3CCRP 1E6JP 3DS5A 3CCJP 1W2BO 3CC4P 3NTEA 3CPWO 1VQ5P 2Z46A 3H0DA 3WBHA 4U0EA 3H4EA 3I55P 2PEMA 2E1MA 2KODA 3G0VA 1A8OA 4GR6A 3CCSP 3CCUP 1K30A 3DS2A 3CCVP 1VQOP 1EOQA 1D1DA 5HGNA 3OW2O 1VQNP 3DS0A 1S72P 1RO2A 1YI2P 2L6EA 3DPHA 2Z44A 1YJ9P 2XT1A 1IUQA 3LRYA 2P9XA 1KC8Q 4WYMA 1YJWP 3HYBA 5F2KA 2PY8A 3CXCO 2PEIA 1KD1Q 1NJIQ 3CCMP 1M90Q 2XXMA 1ZMBA 1YHQP 3HZQA 2OTJP 2PEQA 1M6EX 1QVGO 1VQ9P 3H47A 3CMEP 1VQ4P 2JO0A 4M0IA 2EIAA 1BAJA 2CWOA 4XROA 3MGEA 4XFYA 1VQMP 3DTJA 2ONTA 1M6NA 3G71P 3CCQP 4IPYA 4U0AA 4COPA 3G28A 2JYGA 1EIAA 2BHVA 2QEXP 1YITP 1Q81Q 4U0FA 2EG5A 1VQPP 1Q7YQ 1VQ6P 2PEJA 2PEKA 5F2NA 3Q20A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PEQ A;  5BS1 A;  2PEN A;  2PY8 A;  2Z46 A;  2Z45 A;  4GR2 A;  3RG6 C;  2PEI A;  2PEO A;  5BS2 A;  2PEJ A;  2PEK A;  2PEM A;  3Q20 A;  2Z44 A;  4GR6 A;  3HYB A; 
#chains in the Genus database with same CATH topology
 3RG6 C;  2MF4 A;  1DNY A;  3CD6 P;  2KOO A;  1VQ8 P;  3CC2 P;  1Q82 Q;  2CGQ A;  2GZJ A;  7CEI A;  1NQ4 A;  2LF4 A;  5JPA A;  3M1M A;  1VQK P;  3DS1 A;  2K0Y A;  1K73 Q;  1QRJ A;  4H2Y C;  4IZ6 A;  3G29 A;  5HGM A;  2EFJ A;  2JQ4 A;  3CCE P;  1VQL P;  2PEO A;  3G6E P;  3E2D A;  1X3O A;  3CMA P;  2CNR A;  1K8A Q;  3B5I A;  3RG2 A;  1W2B O;  3CC4 P;  2CG5 B;  2DNW A;  3G0V A;  3CCV P;  2VLN A;  3NY7 B;  1UNK A;  3DS0 A;  4BPF A;  4BPG A;  2Z44 A;  2XT1 A;  1IUQ A;  2P9X A;  1YJW P;  2GDY A;  3CXC O;  3CCM P;  2XXM A;  1YHQ P;  2PEQ A;  1FR2 A;  2FQ1 A;  1M6E X;  1VQ9 P;  2WPT A;  3CME P;  1VQ4 P;  2JO0 A;  1BAJ A;  2CWO A;  2QNW A;  2FVF A;  1T8K A;  3EJD A;  3G71 P;  3CCQ P;  1AYI A;  4U0A A;  2K93 A;  3G28 A;  2VLQ A;  2QEX P;  1GPJ A;  1YIT P;  5HV8 A;  4U0F A;  1Q7Y Q;  2L22 A;  3Q20 A;  1GXG A;  2EHS A;  4COC A;  3P05 A;  2X2B A;  1HY8 A;  1BXI A;  3CCL P;  1M74 A;  3DS4 A;  2Z45 A;  1RO0 A;  3CE7 A;  2KGE A;  2L9F A;  2MY5 A;  4PH1 A;  5HGL A;  1QVF O;  2BUO A;  2FVE A;  2VLP A;  3VRL C;  4U0C A;  3DS3 A;  1IMQ A;  3CC7 P;  4U0D A;  2L0Q A;  1RNI A;  2LOL A;  2M8P A;  5BS1 A;  2PEN A;  2N6Z A;  1MZ8 A;  2GDX A;  1ZNV A;  3CCR P;  1UJZ A;  2N6Y A;  3LMO A;  3CCJ P;  2MVU A;  2AVA A;  3WBH A;  3I55 P;  1A8O A;  4GR6 A;  2N98 A;  2MR8 A;  1OR5 A;  2JU2 A;  4R0M A;  2GZE A;  2K0X A;  2PEI A;  1KD1 Q;  1NJI Q;  1M90 Q;  4UHP B;  1IMP A;  1KLP A;  3MGE A;  1E0H A;  1VQM P;  2FHS C;  2KWL A;  5KP8 B;  1Q81 Q;  2GDW A;  3U43 A;  1VQ6 P;  3B4Q A;  4H2W C;  1KQS O;  1Q86 Q;  5HGO A;  5EJD A;  2XZ0 D;  1VQ7 P;  1A43 A;  1F80 D;  2M8N A;  1JJ2 O;  4BPH A;  4XRQ A;  1VHN A;  5I4T G;  2KGA A;  3G1I A;  4XFX A;  1VKU A;  3G21 A;  2GYK A;  1M1K Q;  2DGY A;  4XFZ A;  2MR7 A;  2OAR A;  1K9M Q;  2KG6 A;  2KG8 A;  3G26 A;  3GJN A;  4U0B A;  2QA4 P;  5F2O A;  2KOS A;  2JAZ A;  3G1G A;  2N5I A;  4PH0 A;  2FAE A;  2MVV A;  2KW2 A;  2N50 A;  1VQ5 P;  2KGD A;  3NTE A;  3CPW O;  2Z46 A;  4F37 A;  3H4E A;  2ERH A;  5EW5 E;  2KOD A;  3CCS P;  1K30 A;  1EOQ A;  1Z6M A;  5HGN A;  3OW2 O;  1VQN P;  2FVA A;  2GZF A;  1S72 P;  1YI2 P;  2JU1 A;  3DPH A;  5KP6 B;  3GZM A;  1KC8 Q;  4WYM A;  2JGP A;  1L0H A;  1QVG O;  1AF8 A;  3H47 A;  4M0I A;  2EIA A;  2PNG A;  1M6N A;  3EJB A;  1CEI A;  2JYG A;  4NEO A;  2KGC A;  1ACP A;  1HQB A;  2LL8 A;  2EG5 A;  1VQP P;  3GKL C;  1AUM A;  2M8L A;  3I56 P;  2KOP A;  2LPK A;  2KOR A;  2FQ0 A;  4QNB A;  2MD9 A;  2JBG A;  2GZG A;  2K94 A;  3G4S P;  2N5H A;  1N8R Q;  4HKG A;  2LIW A;  5CZD B;  1YIJ P;  2KR5 A;  1DV5 A;  2JYL A;  1YJN P;  5BS2 A;  2LKI A;  2KG9 A;  2XV6 A;  5DCK A;  2VLO A;  4PXH B;  5KP7 B;  4GR2 A;  2FQ2 A;  4MRT C;  2OTL P;  2K0D X;  2ROQ A;  1E6J P;  3DS5 A;  2KOQ A;  4H2X C;  3H0D A;  4U0E A;  2PEM A;  2E1M A;  3CCU P;  3DS2 A;  1VQO P;  1EMV A;  1D1D A;  2M5R A;  2AFE A;  1RO2 A;  4CA3 A;  2AF8 A;  1GXH A;  2L6E A;  2GZI A;  1YJ9 P;  2LTE A;  3LRY A;  2LML A;  2XZ1 C;  2K92 A;  3HYB A;  5F2K A;  2PY8 A;  2NO8 A;  4QKO A;  1ZMB A;  3HZQ A;  2OTJ P;  2FAC A;  4PWV B;  2JB0 A;  2L4B A;  4XRO A;  2VSQ A;  4XFY A;  3DTJ A;  2ONT A;  2AFD A;  4IPY A;  2CQ8 A;  1L0I A;  4COP A;  5HVC A;  1EIA A;  2BHV A;  2K5X A;  2FAD A;  3GZL A;  4DG9 A;  2EHT A;  2LIU A;  3EJE A;  2PEJ A;  2K2Q A;  2PEK A;  5F2N A; 
#chains in the Genus database with same CATH homology
 1AUM A;  2M8L A;  1KQS O;  3RG6 C;  3I56 P;  1Q86 Q;  3CD6 P;  4COC A;  5HGO A;  3P05 A;  1VQ8 P;  3CCL P;  1VQ7 P;  1A43 A;  1M74 A;  3DS4 A;  4QNB A;  2Z45 A;  2M8N A;  1Q82 Q;  3CC2 P;  1JJ2 O;  1RO0 A;  4XRQ A;  3G4S P;  4PH1 A;  5HGL A;  5I4T G;  1QVF O;  3G1I A;  2BUO A;  4XFX A;  3G21 A;  1N8R Q;  2LF4 A;  3VRL C;  1M1K Q;  4U0C A;  2DGY A;  3DS3 A;  4XFZ A;  5JPA A;  2OAR A;  1K9M Q;  3M1M A;  1VQK P;  1YIJ P;  3CC7 P;  3DS1 A;  4U0D A;  1K73 Q;  1QRJ A;  1RNI A;  2JYL A;  3G29 A;  3G26 A;  1YJN P;  5BS2 A;  5HGM A;  2XV6 A;  5DCK A;  2M8P A;  2EFJ A;  4U0B A;  3CCE P;  5BS1 A;  2PEN A;  4GR2 A;  1VQL P;  2QA4 P;  2PEO A;  5F2O A;  3G6E P;  3E2D A;  3CMA P;  3G1G A;  4PH0 A;  2OTL P;  1K8A Q;  3B5I A;  3CCR P;  1E6J P;  3DS5 A;  3CCJ P;  1W2B O;  3CC4 P;  3NTE A;  3CPW O;  1VQ5 P;  2Z46 A;  3H0D A;  3WBH A;  4U0E A;  3H4E A;  3I55 P;  2PEM A;  2E1M A;  2KOD A;  3G0V A;  1A8O A;  4GR6 A;  3CCS P;  3CCU P;  1K30 A;  3DS2 A;  3CCV P;  1VQO P;  1EOQ A;  1D1D A;  5HGN A;  3OW2 O;  1VQN P;  3DS0 A;  1S72 P;  1RO2 A;  1YI2 P;  2L6E A;  3DPH A;  2Z44 A;  1YJ9 P;  2XT1 A;  1IUQ A;  3LRY A;  2P9X A;  1KC8 Q;  4WYM A;  1YJW P;  3HYB A;  5F2K A;  2PY8 A;  3CXC O;  2PEI A;  1KD1 Q;  1NJI Q;  3CCM P;  1M90 Q;  2XXM A;  1ZMB A;  1YHQ P;  3HZQ A;  2OTJ P;  2PEQ A;  1M6E X;  1QVG O;  1VQ9 P;  3H47 A;  3CME P;  1VQ4 P;  2JO0 A;  4M0I A;  2EIA A;  1BAJ A;  2CWO A;  4XRO A;  3MGE A;  4XFY A;  1VQM P;  3DTJ A;  2ONT A;  1M6N A;  3G71 P;  3CCQ P;  4IPY A;  4U0A A;  4COP A;  3G28 A;  2JYG A;  1EIA A;  2BHV A;  2QEX P;  1YIT P;  1Q81 Q;  4U0F A;  2EG5 A;  1VQP P;  1Q7Y Q;  1VQ6 P;  2PEJ A;  2PEK A;  5F2N A;  3Q20 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...