1K8AQ

Co-crystal structure of carbomycin a bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAKGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S RRNA
publication title The structures of four macrolide antibiotics bound to the large ribosomal subunit.
pubmed doi rcsb
total genus 47
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2001-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1k8aQ02
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1k8aQ01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1k8aQ03
3CCRP 1VQ9P 3CC2P 3CMEP 3CC7P 3CMAP 3CD6P 1KQSO 3CCVP 3CCSP 1VQOP 1YJWP 1NJIQ 3CCMP 2QA4P 1Q81Q 3CCUP 1K73Q 1VQ6P 3CPWO 1YITP 2QEXP 1Q7YQ 1Q86Q 1VQMP 1VQ7P 3CC4P 1Q82Q 1VQNP 3OW2O 3CCQP 1K8AQ 1N8RQ 3CXCO 1K9MQ 1VQ8P 2OTLP 1W2BO 3CCLP 1VQLP 3G4SP 1M1KQ 1M90Q 2OTJP 1VQ5P 1QVGO 3G6EP 1VQPP 1KC8Q 1QVFO 1JJ2O 1YIJP 1YJ9P 1YI2P 3G71P 1YJNP 3CCJP 1YHQP 1KD1Q 1VQ4P 3I56P 1VQKP 3CCEP 1S72P 3I55P
chains in the Genus database with same CATH superfamily
3CC2P 2E76B 2JQ4A 2MY5A 5GTHE 1NTKJ 1VHNA 4H44B 1SQQD 3EFGA 1WRGA 5AW0B 1SFCC 1QVFO 4AUWA 3QH9A 1IFMA 3S1KA 3G9RA 1G2CA 5CJ0A 1NVOA 2AEJA 4HB1A 4N6JA 1MZ8A 1RE3C 1MKMA 2PRRA 3AE5C 4Y28J 1IMQA 3IFMA 3ITKA 1SQXE 1KILD 2LMLA 1GL2A 3L71E 3CWBE 1S72P 1RF1C 1R5SA 4XROA 1OVUA 2LF4A 3V2PA 2XZ0D 2K3RA 2V7QJ 2QA4P 3V4WA 3WMM0 3GZLA 3B71A 2FQ0A 2MD9A 3H1IE 1LGHB 3BCCJ 2QJPC 3O6QB 3H1LJ 2FYUK 1QLED 5BVZA 1FZGA 5KAIE 3RK3D 4CPGA 4GT1A 1BE3J 4BWNA 1FC2C 2IZ1A 2GDXA 1NU1E 1JY2O 3AE8C 2FYUJ 3GHGB 2K94A 1PPJD 1IMPA 3G6EP 2FXOA 4JF7A 1GU5A 3NFQA 4L75A 1NWQA 3L72E 1J1EB 4OVNF 4YXWH 5BS1A 1RE4A 2WSCH 3H1JE 4COCA 1ZNVA 1X0TA 4TT3H 3JC22 4JQ0D 1URQA 5BU8B 3CXCO 1AVYA 2JR8A 1QVGO 2WSFH 1RY3A 1IUQA 3RGUA 1YIJP 1E5WA 3PH0A 1LTAC 3NY7B 1T3JA 2OYOA 1ZRTE 1E0HA 4D6TJ 4WB4A 3L71D 1HBWA 3CX5I 2JJLA 1SQBG 2LKIA 3M91A 2KGCA 3CWBD 3EWKA 1HF9A 4AYCA 2P9XA 2ZAEB 1OZHA 2Y9YA 3TGUJ 1KQSO 2VLPA 2N50A 3E7KA 1LTJC 2FAEA 5HGLA 3H1ID 1BCCG 1S2EA 2KOOA 2JO1A 5KJ7D 3IN6A 2Z5HA 1FZBA 4ASWA 2HPCB 5AW4B 4JBZA 1N7SC 1KFMA 5APYA 3L74D 1SQQK 2ZYDA 2CNRA 2AEMA 4GR2A 2KK7A 3PLNA 5KP6B 3E2DA 3H4EA 2FYNB 3L75G 3V5BA 3LW5J 3VTPC 1NOHA 2IFNA 1SQQJ 1YI2P 4NPFX 2X2BA 4OWFA 5KLVJ 1LP1B 2OQQA 2I8DA 5KP7B 4GODA 4IZ6A 2BEZF 2MR7A 3D6YA 2N6ZA 2PP6A 5AVRB 3KZIH 1YQ4C 4GR6A 2HPCA 3H1KG 1ZRTD 1Y47A 1M7LA 2GDWA 1S9KD 2N6YA 3HE5B 2OGUA 1Q86Q 2RH0A 4XA4A 4H0LC 1VQ8P 1OW8A 1PZQA 1J1DC 1G1IA 3F89A 5GTHH 1SQBE 1EDKA 1KORA 4WYMA 2P67A 1RO0A 1LP1A 1VQ9P 3V4QA 2KORA 4OGQD 1PGQA 3MUDA 2IZ0A 1P84E 3RL0B 1RF0A 1OVRA 3MTUE 2C0XA 3R4YA 1LTGC 1BCCE 2B87B 1RNIA 2N9YB 1L4AC 3BVHA 1UNKA 3WU2E 1LWUB 3HE5A 2FVAA 5KKZC 1LT9C 1PGJA 1JO5A 2ZFCA 2OTLP 2Y9ZA 1DEBA 1EDLA 5APVA 2H88C 5K5GB 1DD4A 3L75E 2YO2A 3O8ZA 2E75D 2JEEA 3AE6C 2ZT9B 3B5ND 4EOTA 2OYIB 5HGNA 1USEA 2KODA 2KNCB 4U0DA 2N1TD 1AYIA 2B87A 1QEXA 2Q1KA 3U1AA 2KG9A 3PP5A 1FDIA 2LXCB 1LWUA 2KS1A 1K05A 1L0NG 2C9NY 3G3ZA 2PEKA 1SQBD 3KXDA 5AVXB 1PV3A 2W8ZA 1X9VA 3CCLP 2NPSD 3B4SA 3CX5D 3IF4A 3S4RA 2AFEA 3RK2C 1KILB 5HVCA 4I6MC 3FX0A 1ZMBA 2YXRB 1BCCD 4QNBA 1GW3A 2XKMA 2PAJA 1CEIA 4PH1A 1W2EA 3L74J 1GL2C 3A5TA 3TYYA 3I56P 1IZNB 1L0LE 2E76C 4U0FA 1ZOYC 4H44C 4U7JA 3RK3B 3L75D 4HJGH 4LC1A 1L2PA 2BCCG 1SQPJ 1NTMD 4WBAA 1SS1A 1KILA 3P8MC 2YMYA 3R2PA 1SFCD 4PJ0E 1NTZK 4O9BA 1PEMA 2BUOA 3GKLC 2M0BA 1HTLC 1FS0E 2P2UA 3H1KD 2GYKA 3CMAP 2GUSA 2ITAA 1KMIZ 1T3UA 1NTZJ 5TISE 1RE4C 1M56D 5AW6B 3DTJA 1CW5A 4RKUJ 3H0DA 1L0NE 1URQC 3NMDA 1HUCA 1IK7A 1U7MA 2KP8A 3G21A 1BAJA 3AE4C 2FXMA 4PD4E 2Q3EA 1BXIA 3A0HE 3Q5PA 4Y99C 2DGYA 1Q7YQ 1Q2NA 2HODB 1OR5A 2LIUA 1SVFA 1JY2N 2A06G 3T97B 3CLQA 1FAVA 2HR3A 5AW7B 2JYLA 2QNWA 1M6NA 2LPKA 1HJ0A 1M1JA 3EJBA 2XV6A 3NTNA 4PH0A 1FZCB 1LTSC 5BU5A 2BCCE 5KP8B 2L22A 1P84H 1GK4A 1FZEA 1HH0A 5AW9B 2GZIA 5KLIB 1D1DA 3G1IA 3VYIA 1HGZA 1GK6A 4Z1MH 5CCGA 4BPHA 1VQLP 3T97A 3WU2H 4EIJA 2OYHA 4GOEA 5KJ7A 2J5UA 1EDJA 3FXEA 3W68A 3Q2YA 3H1JG 1OVVA 2PEIA 1OFCX 2B88A 3AE1C 4H13D 4GIFA 2WZ7A 1NO4A 2E74B 2JO0A 1FZCA 2CWOA 4ZKUA 2QG4A 2NO8A 1Y9BA 1VPCA 2W83C 4R4LA 1IFNA 5GTIE 1BCCJ 4L74A 2JKVA 1MFTA 2W6AA 3HTKA 1M8OB 2R5BA 5KTBA 1YTZI 1A43A 2PEJA 3CCUP 3HYBA 2FYNC 4OGQB 1NTMK 2G3AA 1OW7A 1K9MQ 4EYYQ 2FFDB 3MIWA 3A2AA 2UWJE 2A06E 3LIEA 2IYPA 1ZW0A 1NTMJ 2C9LY 1IK9A 2KGDA 3M0DA 3MUDC 1GMJA 1ZN5A 2BCCD 1FZAA 4GKGA 1EC5A 3DS5A 2PFXA 1RF0C 1BGYD 1YJ9P 3A0BE 2HYNA 2N5IA 5APSA 5CCHD 1ZV8A 2AEFA 3SFDC 3P7KA 2JAZA 4HKZH 2K0DX 3JSVC 3OA7A 2E75B 3HUSB 3H1KJ 3B5NB 3KQGA 2FFDA 3VOPA 2KOQA 1KTMA 5AW1B 3L70D 3PRJA 1EXIA 2Y0DA 2L91A 3G1GA 2N1TB 4MRTC 2M3EA 1IFPA 1FR2A 1AV1A 4H0LD 4BPFA 4I7ZC 3HZQA 1IO4A 2O01H 2H8PD 1Z56A 1OXZA 4NPDA 1VQ7P 3TDKA 3ZDMA 3AEFC 2MR8A 2XZ1C 2OTKE 5B5EE 5AW8B 3O6QA 1GZLA 3M9QA 4PJ0H 2I1KA 3EQ2A 5EFWB 3DS3A 2O1JA 4IFFA 1SQVG 2H7HA 2KOSA 2NPSB 4YTPC 2IPPA 3VP8A 1UJZA 1LWUC 2WSEH 1BSNA 3V2RA 3C9IA 5APQA 1KQLA 1SQXD 2RN0A 3IR9A 1BSHA 2IX7C 2KGEA 2KUBA 1K8AQ 4PWVB 2VLNA 3GHGA 4BRYB 1L4AD 2CG5B 2A06D 1FOSE 1VQPP 2FKWB 2N1TA 2W90A 1JJ2O 5TISH 1P84I 1QL1A 2GA1A 4WVZA 1VF5D 2WSCJ 1TU3F 1HWTC 3Q3DA 1VDFA 3AEBC 2R3CA 2KZIA 2KOPA 4K3AA 2FQ2A 3N7NA 1EDIA 5AVWB 2WSFJ 4PD4H 2KZJA 2POHA 3A0HH 1NTKG 2Z44A 1GXHA 1KN7A 2NPSA 2Y0EA 1BDDA 2Q7CA 1X79B 5HV8A 1NU1D 2PEOA 2PEMA 1NAYA 3RBXA 3VMAA 1T6AA 2JP3A 2MVUA 4U3FG 1H0TB 4BRYA 1QRJA 1SFCB 5HGOA 1GD2E 1EZVE 4ZKPA 2GZEA 2CGQA 3L72D 2LKMA 4WY4D 2Q5UA 1KILC 2QM8A 3H1JD 4PV1D 3G0VA 4IPYA 1LJ2A 4U0EA 3BASA 2KGAA 1JNMA 4A7PA 1NH4A 2FQ1A 3DS0A 2EFJA 2YKPA 2WQYC 3RK2D 4XFYA 3AEAC 3G4SP 1JCDA 3P8CE 4UB8E 1HJBA 2Y0CA 3LMOA 1T2KD 2R3SA 2WPTA 3I55P 1RF1B 3CCRP 2KSEA 2M5AB 2QJKC 2YKOA 3C8VA 3FGAD 3L73G 2E43A 1SQVE 1FE6A 3B8EB 3BCCG 3RK3C 1RO2A 3H1LG 4XFXA 1H0TA 1Z6MA 4XFZA 2YIUC 5AVUB 1JEKA 4XRQA 2FHSC 1BE3G 3MZWB 1CZQA 1IJDB 4H44D 1EMVA 1AFOA 3BATA 2BCCJ 4IFDK 1HGVA 1R8EA 2EHSA 4QKOA 4C7RA 1BGYJ 4M0IA 1AF8A 5B66H 3VRLC 1KFNA 5GTIH 3DPHA 4H2WC 4NPEA 2L6EA 3C1LA 4WWIA 2EIAA 1L0LG 1NTKE 2RMZA 5DJUB 2C0WA 2WT7B 1JB0J 3L70J 3H6PA 1NGMB 4W7ZA 1AVOA 3I5CA 2YNYA 1JTHB 2K0XA 5CBNA 2QSIA 1M1JC 1KQGB 1VL2A 2RKLA 1IFIA 4U3FE 1KC8Q 1FDOA 2PNGA 1MUUA 2LOLA 4D6TG 3DS1A 4IFMA 2KI7B 3JCUE 3GF3A 3M1MA 2KLUA 1URQD 1SQXK 5AVVB 3G28A 2O1KA 3A0BH 1FOSF 3OW2O 2BHVA 4JPZB 5CCGC 2GDYA 3VP9A 4H13B 3GF7A 2M8PA 3GZMA 3CE7A 5KAFE 3SSUA 1SQVD 4N3YB 2OYHC 1SQXJ 2WT7A 3HD7D 5KJ7C 5APWA 2JYGA 3L71J 1F80D 3CWBJ 2D2CD 4QMAA 3L73E 5M1BA 3CXHE 4PD4I 1LTJB 1R5LA 4IOIH 2ZVOB 3BCCE 1KLPA 1FZCC 3H1LE 4U0CA 3SWYA 1BE3E 4KJMA 2PEQA 2E5TA 1NAFA 1ZR4A 3H1IJ 1P84D 2KXPB 1NU1K 4GDOA 3CL3D 5B5EH 4I2LC 2OYIA 2LXBA 3AE9C 2KNCA 2FADA 1PEQA 5KLVG 5H2FE 1PP9G 2ZXXA 3RL0g 4TLFA 2QIWA 3E1RA 4DJGA 3WBHA 1HVVA 1NU1J 2QJYB 3MGEA 4W7YA 4BPGA 1NKZB 1M6EX 2XXMA 3M0AA 2R44A 3FWLA 1JOCA 2KYVA 4U3FD 3L72J 3M0DC 1GPJA 2E74C 3S9OA 3H1JJ 2E42A 1KYOE 2V4HA 1E79H 3M9BA 3MGNA 1L0HA 3SWKA 4D6TE 1H88A 3DS4A 3GW6A 3D6ZA 1PFIA 2PGDA 1VQOP 1RHZB 2K1AA 4OGQC 4H0LB 2FFDC 4ASVA 3TGUE 1DV5A 2FXPA 2FVEA 2LIWA 3H1HG 3L73D 3CC7P 3CXHD 2LL8A 3BCCD 5CCHA 2L4BA 1PL5A 2IFMA 2YMKA 5F2KA 3U59A 4MN4C 1BE3D 1X8YA 3GMAA 1N73B 3N4XA 5F2OA 1OW6A 1N2DC 3P32A 3M06A 3H32B 1KZUB 5CJ4A 1QX8A 1H8AA 4DCKA 2IDBA 1KB9E 1L4AB 2A45G 2IBZG 2M8RA 5AW3B 2K2QA 3ABVC 3AEGC 3KDPB 4XFJA 4B86A 3B4QA 4U0AA 1CSBA 1PIXA 3KHUA 1LT9B 1VF5B 4UB8H 3H25A 2W27A 4DZOA 3Q20A 1W2BO 3GHGC 2P10A 3NTEA 1L0LD 5KLVE 1PP9E 2N1TC 4AQRD 3Q1MA 2EG5A 2QM7A 2SPZA 2KIKA 5AVZB 1YTZT 3TNUB 1J1EC 3CCVP 2VLQA 1Q81Q 1KYOD 1RH5B 3KPEA 3PTZA 1G1JA 4C7NB 5HGMA 1N73A 1IC2A 3CC4P 3AEEC 1K04A 1DX7A 2Z45A 3H32A 4N78E 3BRVB 1UIXA 1EOQA 2NPSC 2O01N 1E6JP 4WY4B 3SFEC 5APUA 1ZMEC 4U0BA 1SQBK 4PV1B 4LLHA 1YITP 2HODA 1IFJA 4DT0A 2E1MA 4GOFA 2DW3A 2MF4A 1FBMA 3RK2B 1G2CB 3QWOC 2DNWA 1SQBJ 2GZJA 1RQUA 1GXGA 2WSSH 3B5IA 1L0ND 3H1HE 3CCSP 2AF8A 4C7NA 3RK3E 2JWAA 4HH2A 2FYZA 4UB6H 2XNDH 5DJTB 1M74A 3JCUH 4PD4D 2WPQA 2L9FA 1KD1Q 1PPJE 4COPA 5B66E 2HLOA 1SQPG 2WITA 4WY4A 2MVVA 2AXTH 2IBZE 5CMZA 5KAFH 4LGDE 5KLVD 2QEXP 1PP9D 3DS2A 4ZMDA 1A8OA 2V7QH 2FVFA 2OTJP 3A3YB 1N7SD 3HE4B 2K0YA 3CCEP 3CXHH 4U3FJ 3L75J 4IL6E 1Q90D 3VMYA 2ZJSE 5I4TG 2K5XA 4N78D 2XNXA 3L36A 2G8YA 3V2NA 1LTIC 1NTZG 3V2QA 2NRGA 2GUVA 2H89C 1EZVI 5H2FH 2CPBA 4ZNCA 3BRTB 1VKUA 1EZVG 1URQB 2Q9IA 3L73J 3HE4A 1M90Q 3USSA 1OIPA 1YJNP 5C39A 1JY3O 3H1HD 1S1CX 3WUTA 1KYOH 4EDFA 3HD7B 2ONTA 5BS2A 3L74E 4Y99B 1PGOA 2IYOA 3RL0C 1VQNP 3HRNA 1DNYA 1L0LK 2BASA 2J58A 2D2CB 2W6BA 2IBZD 2ZVNB 1FU1A 2ZYAA 2XZRA 3A7OA 3HUSA 1SQPE 1L0LJ 2K9JB 3Q5RA 1GDTA 3B5NA 4PXHB 2E5YA 2Z5IA 5APXA 3P05A 3GG2A 2ZT9C 1S4XA 2O01J 3HD7A 1YYCA 3VMXA 2OYIC 2Z4EA 1VQMP 1S9KE 1KB9H 4H13C 2Q3IA 3M9HA 1S5LE 3LW5H 2AFDA 3CCJP 5TJHA 4JYCA 1NTZE 2M3BA 2QE7H 2WSEJ 3U43A 1L0NK 1D7MA 1YBKA 1AA0A 2K9JA 4DOJA 2W6JH 5CCGD 3VMZA 2K9YA 5AW5B 1LNQA 2B89A 2ZXEB 1NYHA 5CHXA 1N7LA 1L0NJ 1U7JA 4W80A 1OX3A 5F2NA 2N98A 1QGKB 5L8RJ 3CI9A 3PJSK 2JGPA 3F5HA 5KLVK 3CCMP 1A02F 2M8LA 1X3OA 1FJPA 4XE5B 1DH3A 2CPSA 5E79H 2ZYGA 3FXDA 1YQ3C 1NTMG 1SLQA 2PY8A 3CXHI 2QJYC 3EFFK 2KG6A 1ZR2A 1SQPD 1PP9J 2NZ2A 2HFED 5AW2B 1CI6B 2K93A 2YO3A 5CCHC 2GZFA 3AE3C 1GL2D 2BQ1E 2J59M 3AECC 1SFCA 1GU4A 1VQ5P 3G26A 2E76D 2PENA 3LIDA 4I1LA 4IL6X 3RBZA 3G71P 1Y8AA 1OMIA 2QJPB 2KW2A 2E74D 2FYUG 3MD0A 1RE3A 3H47A 2MKVA 2M8NA 1T8ZA 2WTYA 3CCQP 1NTZD 2HG5D 2WWWA 1X22A 3K5BA 2A45H 2JWDA 1RF1A 2M5AA 2WPSA 1OWAA 1CI6A 3CX5E 1KYOI 4I7ZB 5AVSB 2Q6QA 3VN0A 2K37A 1EZVD 1N73C 3H1HJ 4HKGA 3II6A 4IL6H 2VSQA 2FY8A 1HY8A 4UB6E 3MHVA 2BEQD 2GM4A 4H2YC 3KYQA 5CZDB 1DEEG 1PGPA 3AEDC 3G29A 2KS1B 3TSIA 1VF5C 1NJIQ 2WVRA 1H89A 2ROQA 3P8CD 1XTGB 4KT0J 2YXQB 3TGUG 5DCKA 2AXTE 1A02J 4YXDC 2VRSA 3WUVA 4H2XC 1NTME 2KWLA 4RJTA 2R5DA 4C46A 3Q5SA 1K30A 1GTWA 4NEOA 1GW4A 1JTHA 1KB9I 3CPWO 2I1JA 3FWNA 3RG2A 5KAIH 2FACA 1NKNA 1MV8A 5EW5E 2XT1A 1ZP0C 2P58A 4M3LA 3GLMA 1USDA 2JDIH 1DD3A 2N9BA 2JU1A 1N7SB 3H1KE 3AE7C 4WY4C 5KLIC 2P1JA 4PV1C 1PEUA 2FYUE 1SQQG 3LRYA 1S5LX 3U1CA 1NTKD 1QL2A 2JU2A 2H43A 3L35A 3TK1A 1JUNA 1JMMA 1YHQP 1SP4A 1U57A 3GJNA 2CK3H 3NXSA 1N86A 1T2KC 1LTJA 4DG9A 1VQ6P 4RESB 1ZLLA 1LTTC 1IFDA 5APTA 2LTEA 5EJDA 1NHLA 1AUMA 1EXJA 2XV5A 1SQPK 1FJKA 1VQKP 1N7SA 2QJKB 4UHPB 3CD6P 1S5LH 2MJZA 3W67A 1WMKA 2YIUB 4L73A 4R4MA 1J1DB 2KR5A 5AVYB 4F37A 2M5RA 1BGYG 5CBOA 2VLOA 2AVAA 1RQVA 1LTBC 3TF5A 3OAKA 2O3JA 4K35A 3L4FA 2KG8A 2N5HA 1AQTA 1JMBA 1YJWP 4R0MA 3H1LD 1NQ4A 2KOGA 1K73Q 2P7JA 2Z46A 2YKQA 4EI2A 1EQ7A 1N8RQ 2WMMA 2XDJA 1UIIA 1M1KQ 2A45I 2IBZI 3L70G 1PPJG 2ERHA 1ACPA 1XTCC 1VQ4P 2K88A 1KQFB 2FYUD 2OARA 2QRXA 1AQ5A 1BDCA 2E75C 3HUSC 3L37A 5KKZB 1FDMA 1W5CE 3B5NC 2LR2A 3AE2C 1Q82Q 2K92A 1MZ9A 1M1JB 1SQQE 1S3JA 3SWFA 3MP7B 3IAOA 1HQBA 3EJEA 1JY3P 2AXCA 2R32A 3OJAB 3RG6C 1JCCA 1JY3N 2FBWC 2XU6A 3HD7C 2L0QA 3UIAA 3EJDA 1SQXG 3E1IA 4OH8B 1KV4A 5JPAA 1ZXGA 3WUUA 2KB7P 3L71G 2D2CC 2EHTA 1JY2P 2WPRA 3CWBG 7CEIA 1SQVK 4JYBA 4D6TD 2OYHB 1KILE 1L4AA 3CMEP 2KSJA 5E79E 2WPVB 1WT6A 1FZFA 3V6IA 2L5GB 3RL0D 1JM0A 1EIAA 2QVAA 1LT9A 3D70A 4L76A 4KHXA 1SQVJ 1L0IA 1PEOA 2JBGA 3TGUD 5AVTB 4CA3A 1DIPA 3H1IG 3CX5H 4YPCA 1M57D 3D71A 3TNUA 3PHLA 2B9BA 2JB0A 1BGYE 3KZIE 5AVQB 3HTKB 3L74G 4RO0A 1NU1G 4BXLA 1AJYA 1NTKK 1LT1A 2CQ8A 2GZGA 2KLVA 1KB9D 2ZT9D 1GL2B 1J2JB 3L72G 1T8KA 4HYTB 1MFZA 3L70E
chains in the Genus database with same CATH topology
1M6EX 2XXMA 3P05A 3CC2P 2OARA 5BS1A 3H47A 1D1DA 2M8NA 3CCVP 5I4TG 4COCA 2PEOA 3G1IA 2PEMA 1Q81Q 1PEUA 3LRYA 5HGMA 5HGNA 2KODA 3CC4P 1VQMP 4U0DA 2Z45A 1Q82Q 3CCQP 3CXCO 1QRJA 1VQLP 5HGOA 1PEMA 2BUOA 1QVGO 1QVFO 1KC8Q 1IUQA 4GR6A 1YIJP 3G1GA 3CCJP 1YHQP 1EOQA 3DS1A 3G0VA 4IPYA 3CMAP 4U0EA 3M1MA 3RG6C 1E6JP 3DS4A 3HZQA 1VQOP 3G28A 2PEIA 3DS0A 3DTJA 4U0BA 2EFJA 3H0DA 2PEKA 1VQ6P 1Q86Q 1YITP 1VQ7P 5JPAA 2JO0A 3OW2O 2CWOA 2BHVA 4XFYA 1VQ8P 3CCLP 3G4SP 1M90Q 3G21A 1AUMA 2E1MA 1BAJA 2M8PA 4WYMA 1YJNP 1VQKP 1RO0A 3DS3A 2P9XA 3I55P 1S72P 3CCRP 1VQ9P 3CMEP 5F2NA 3CC7P 2JYGA 4XROA 3CD6P 1KQSO 3B5IA 1EIAA 2LF4A 3G29A 1ZMBA 3CCSP 1NJIQ 1A43A 3CCMP 2ONTA 2PEJA 2QA4P 5BS2A 2M8LA 3CCUP 1RO2A 4XFXA 5HGLA 2DGYA 3HYBA 4XFZA 5F2KA 1Q7YQ 1PEOA 4QNBA 1M74A 1VQNP 1K8AQ 4XRQA 1K9MQ 5F2OA 4PH1A 4U0CA 5DCKA 1VQPP 2PY8A 1JJ2O 1RNIA 1KD1Q 3I56P 4COPA 2PEQA 4U0FA 1K30A 4U0AA 1YJWP 2JYLA 4GR2A 1K73Q 1M6NA 4M0IA 2Z46A 3CPWO 2QEXP 1PEQA 3DS2A 3E2DA 1A8OA 3VRLC 3H4EA 2BQ1E 3DPHA 2OTLP 3Q20A 2XV6A 3DS5A 1N8RQ 1W2BO 4PH0A 1M1KQ 2OTJP 1VQ5P 3NTEA 3G26A 3G6EP 2L6EA 2PENA 2XT1A 2Z44A 1YJ9P 2EIAA 3WBHA 1YI2P 3G71P 3CCEP 1VQ4P 3MGEA 2EG5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCR P;  1VQ9 P;  3CC2 P;  3CME P;  3CC7 P;  3CMA P;  3CD6 P;  1KQS O;  3CCV P;  3CCS P;  1VQO P;  1YJW P;  1NJI Q;  3CCM P;  2QA4 P;  1Q81 Q;  3CCU P;  1K73 Q;  1VQ6 P;  3CPW O;  1YIT P;  2QEX P;  1Q7Y Q;  1Q86 Q;  1VQM P;  1VQ7 P;  3CC4 P;  1Q82 Q;  1VQN P;  3OW2 O;  3CCQ P;  1K8A Q;  1N8R Q;  3CXC O;  1K9M Q;  1VQ8 P;  2OTL P;  1W2B O;  3CCL P;  1VQL P;  3G4S P;  1M1K Q;  1M90 Q;  2OTJ P;  1VQ5 P;  1QVG O;  3G6E P;  1VQP P;  1KC8 Q;  1QVF O;  1JJ2 O;  1YIJ P;  1YJ9 P;  1YI2 P;  3G71 P;  1YJN P;  3CCJ P;  1YHQ P;  1KD1 Q;  1VQ4 P;  3I56 P;  1VQK P;  3CCE P;  1S72 P;  3I55 P; 
#chains in the Genus database with same CATH topology
 3CC2 P;  2E76 B;  2JQ4 A;  2MY5 A;  5GTH E;  1NTK J;  1VHN A;  4H44 B;  1SQQ D;  3EFG A;  1WRG A;  5AW0 B;  1SFC C;  1QVF O;  4AUW A;  3QH9 A;  1IFM A;  3S1K A;  3G9R A;  1G2C A;  5CJ0 A;  1NVO A;  2AEJ A;  4HB1 A;  4N6J A;  1MZ8 A;  1RE3 C;  1MKM A;  2PRR A;  3AE5 C;  4Y28 J;  1IMQ A;  3IFM A;  3ITK A;  1SQX E;  1KIL D;  2LML A;  1GL2 A;  3L71 E;  3CWB E;  1S72 P;  1RF1 C;  1R5S A;  4XRO A;  1OVU A;  2LF4 A;  3V2P A;  2XZ0 D;  2K3R A;  2V7Q J;  2QA4 P;  3V4W A;  3WMM 0;  3GZL A;  3B71 A;  2FQ0 A;  2MD9 A;  3H1I E;  1LGH B;  3BCC J;  2QJP C;  3O6Q B;  3H1L J;  2FYU K;  1QLE D;  5BVZ A;  1FZG A;  5KAI E;  3RK3 D;  4CPG A;  4GT1 A;  1BE3 J;  4BWN A;  1FC2 C;  2IZ1 A;  2GDX A;  1NU1 E;  1JY2 O;  3AE8 C;  2FYU J;  3GHG B;  2K94 A;  1PPJ D;  1IMP A;  3G6E P;  2FXO A;  4JF7 A;  1GU5 A;  3NFQ A;  4L75 A;  1NWQ A;  3L72 E;  1J1E B;  4OVN F;  4YXW H;  5BS1 A;  1RE4 A;  2WSC H;  3H1J E;  4COC A;  1ZNV A;  1X0T A;  4TT3 H;  3JC2 2;  4JQ0 D;  1URQ A;  5BU8 B;  3CXC O;  1AVY A;  2JR8 A;  1QVG O;  2WSF H;  1RY3 A;  1IUQ A;  3RGU A;  1YIJ P;  1E5W A;  3PH0 A;  1LTA C;  3NY7 B;  1T3J A;  2OYO A;  1ZRT E;  1E0H A;  4D6T J;  4WB4 A;  3L71 D;  1HBW A;  3CX5 I;  2JJL A;  1SQB G;  2LKI A;  3M91 A;  2KGC A;  3CWB D;  3EWK A;  1HF9 A;  4AYC A;  2P9X A;  2ZAE B;  1OZH A;  2Y9Y A;  3TGU J;  1KQS O;  2VLP A;  2N50 A;  3E7K A;  1LTJ C;  2FAE A;  5HGL A;  3H1I D;  1BCC G;  1S2E A;  2KOO A;  2JO1 A;  5KJ7 D;  3IN6 A;  2Z5H A;  1FZB A;  4ASW A;  2HPC B;  5AW4 B;  4JBZ A;  1N7S C;  1KFM A;  5APY A;  3L74 D;  1SQQ K;  2ZYD A;  2CNR A;  2AEM A;  4GR2 A;  2KK7 A;  3PLN A;  5KP6 B;  3E2D A;  3H4E A;  2FYN B;  3L75 G;  3V5B A;  3LW5 J;  3VTP C;  1NOH A;  2IFN A;  1SQQ J;  1YI2 P;  4NPF X;  2X2B A;  4OWF A;  5KLV J;  1LP1 B;  2OQQ A;  2I8D A;  5KP7 B;  4GOD A;  4IZ6 A;  2BEZ F;  2MR7 A;  3D6Y A;  2N6Z A;  2PP6 A;  5AVR B;  3KZI H;  1YQ4 C;  4GR6 A;  2HPC A;  3H1K G;  1ZRT D;  1Y47 A;  1M7L A;  2GDW A;  1S9K D;  2N6Y A;  3HE5 B;  2OGU A;  1Q86 Q;  2RH0 A;  4XA4 A;  4H0L C;  1VQ8 P;  1OW8 A;  1PZQ A;  1J1D C;  1G1I A;  3F89 A;  5GTH H;  1SQB E;  1EDK A;  1KOR A;  4WYM A;  2P67 A;  1RO0 A;  1LP1 A;  1VQ9 P;  3V4Q A;  2KOR A;  4OGQ D;  1PGQ A;  3MUD A;  2IZ0 A;  1P84 E;  3RL0 B;  1RF0 A;  1OVR A;  3MTU E;  2C0X A;  3R4Y A;  1LTG C;  1BCC E;  2B87 B;  1RNI A;  2N9Y B;  1L4A C;  3BVH A;  1UNK A;  3WU2 E;  1LWU B;  3HE5 A;  2FVA A;  5KKZ C;  1LT9 C;  1PGJ A;  1JO5 A;  2ZFC A;  2OTL P;  2Y9Z A;  1DEB A;  1EDL A;  5APV A;  2H88 C;  5K5G B;  1DD4 A;  3L75 E;  2YO2 A;  3O8Z A;  2E75 D;  2JEE A;  3AE6 C;  2ZT9 B;  3B5N D;  4EOT A;  2OYI B;  5HGN A;  1USE A;  2KOD A;  2KNC B;  4U0D A;  2N1T D;  1AYI A;  2B87 A;  1QEX A;  2Q1K A;  3U1A A;  2KG9 A;  3PP5 A;  1FDI A;  2LXC B;  1LWU A;  2KS1 A;  1K05 A;  1L0N G;  2C9N Y;  3G3Z A;  2PEK A;  1SQB D;  3KXD A;  5AVX B;  1PV3 A;  2W8Z A;  1X9V A;  3CCL P;  2NPS D;  3B4S A;  3CX5 D;  3IF4 A;  3S4R A;  2AFE A;  3RK2 C;  1KIL B;  5HVC A;  4I6M C;  3FX0 A;  1ZMB A;  2YXR B;  1BCC D;  4QNB A;  1GW3 A;  2XKM A;  2PAJ A;  1CEI A;  4PH1 A;  1W2E A;  3L74 J;  1GL2 C;  3A5T A;  3TYY A;  3I56 P;  1IZN B;  1L0L E;  2E76 C;  4U0F A;  1ZOY C;  4H44 C;  4U7J A;  3RK3 B;  3L75 D;  4HJG H;  4LC1 A;  1L2P A;  2BCC G;  1SQP J;  1NTM D;  4WBA A;  1SS1 A;  1KIL A;  3P8M C;  2YMY A;  3R2P A;  1SFC D;  4PJ0 E;  1NTZ K;  4O9B A;  1PEM A;  2BUO A;  3GKL C;  2M0B A;  1HTL C;  1FS0 E;  2P2U A;  3H1K D;  2GYK A;  3CMA P;  2GUS A;  2ITA A;  1KMI Z;  1T3U A;  1NTZ J;  5TIS E;  1RE4 C;  1M56 D;  5AW6 B;  3DTJ A;  1CW5 A;  4RKU J;  3H0D A;  1L0N E;  1URQ C;  3NMD A;  1HUC A;  1IK7 A;  1U7M A;  2KP8 A;  3G21 A;  1BAJ A;  3AE4 C;  2FXM A;  4PD4 E;  2Q3E A;  1BXI A;  3A0H E;  3Q5P A;  4Y99 C;  2DGY A;  1Q7Y Q;  1Q2N A;  2HOD B;  1OR5 A;  2LIU A;  1SVF A;  1JY2 N;  2A06 G;  3T97 B;  3CLQ A;  1FAV A;  2HR3 A;  5AW7 B;  2JYL A;  2QNW A;  1M6N A;  2LPK A;  1HJ0 A;  1M1J A;  3EJB A;  2XV6 A;  3NTN A;  4PH0 A;  1FZC B;  1LTS C;  5BU5 A;  2BCC E;  5KP8 B;  2L22 A;  1P84 H;  1GK4 A;  1FZE A;  1HH0 A;  5AW9 B;  2GZI A;  5KLI B;  1D1D A;  3G1I A;  3VYI A;  1HGZ A;  1GK6 A;  4Z1M H;  5CCG A;  4BPH A;  1VQL P;  3T97 A;  3WU2 H;  4EIJ A;  2OYH A;  4GOE A;  5KJ7 A;  2J5U A;  1EDJ A;  3FXE A;  3W68 A;  3Q2Y A;  3H1J G;  1OVV A;  2PEI A;  1OFC X;  2B88 A;  3AE1 C;  4H13 D;  4GIF A;  2WZ7 A;  1NO4 A;  2E74 B;  2JO0 A;  1FZC A;  2CWO A;  4ZKU A;  2QG4 A;  2NO8 A;  1Y9B A;  1VPC A;  2W83 C;  4R4L A;  1IFN A;  5GTI E;  1BCC J;  4L74 A;  2JKV A;  1MFT A;  2W6A A;  3HTK A;  1M8O B;  2R5B A;  5KTB A;  1YTZ I;  1A43 A;  2PEJ A;  3CCU P;  3HYB A;  2FYN C;  4OGQ B;  1NTM K;  2G3A A;  1OW7 A;  1K9M Q;  4EYY Q;  2FFD B;  3MIW A;  3A2A A;  2UWJ E;  2A06 E;  3LIE A;  2IYP A;  1ZW0 A;  1NTM J;  2C9L Y;  1IK9 A;  2KGD A;  3M0D A;  3MUD C;  1GMJ A;  1ZN5 A;  2BCC D;  1FZA A;  4GKG A;  1EC5 A;  3DS5 A;  2PFX A;  1RF0 C;  1BGY D;  1YJ9 P;  3A0B E;  2HYN A;  2N5I A;  5APS A;  5CCH D;  1ZV8 A;  2AEF A;  3SFD C;  3P7K A;  2JAZ A;  4HKZ H;  2K0D X;  3JSV C;  3OA7 A;  2E75 B;  3HUS B;  3H1K J;  3B5N B;  3KQG A;  2FFD A;  3VOP A;  2KOQ A;  1KTM A;  5AW1 B;  3L70 D;  3PRJ A;  1EXI A;  2Y0D A;  2L91 A;  3G1G A;  2N1T B;  4MRT C;  2M3E A;  1IFP A;  1FR2 A;  1AV1 A;  4H0L D;  4BPF A;  4I7Z C;  3HZQ A;  1IO4 A;  2O01 H;  2H8P D;  1Z56 A;  1OXZ A;  4NPD A;  1VQ7 P;  3TDK A;  3ZDM A;  3AEF C;  2MR8 A;  2XZ1 C;  2OTK E;  5B5E E;  5AW8 B;  3O6Q A;  1GZL A;  3M9Q A;  4PJ0 H;  2I1K A;  3EQ2 A;  5EFW B;  3DS3 A;  2O1J A;  4IFF A;  1SQV G;  2H7H A;  2KOS A;  2NPS B;  4YTP C;  2IPP A;  3VP8 A;  1UJZ A;  1LWU C;  2WSE H;  1BSN A;  3V2R A;  3C9I A;  5APQ A;  1KQL A;  1SQX D;  2RN0 A;  3IR9 A;  1BSH A;  2IX7 C;  2KGE A;  2KUB A;  1K8A Q;  4PWV B;  2VLN A;  3GHG A;  4BRY B;  1L4A D;  2CG5 B;  2A06 D;  1FOS E;  1VQP P;  2FKW B;  2N1T A;  2W90 A;  1JJ2 O;  5TIS H;  1P84 I;  1QL1 A;  2GA1 A;  4WVZ A;  1VF5 D;  2WSC J;  1TU3 F;  1HWT C;  3Q3D A;  1VDF A;  3AEB C;  2R3C A;  2KZI A;  2KOP A;  4K3A A;  2FQ2 A;  3N7N A;  1EDI A;  5AVW B;  2WSF J;  4PD4 H;  2KZJ A;  2POH A;  3A0H H;  1NTK G;  2Z44 A;  1GXH A;  1KN7 A;  2NPS A;  2Y0E A;  1BDD A;  2Q7C A;  1X79 B;  5HV8 A;  1NU1 D;  2PEO A;  2PEM A;  1NAY A;  3RBX A;  3VMA A;  1T6A A;  2JP3 A;  2MVU A;  4U3F G;  1H0T B;  4BRY A;  1QRJ A;  1SFC B;  5HGO A;  1GD2 E;  1EZV E;  4ZKP A;  2GZE A;  2CGQ A;  3L72 D;  2LKM A;  4WY4 D;  2Q5U A;  1KIL C;  2QM8 A;  3H1J D;  4PV1 D;  3G0V A;  4IPY A;  1LJ2 A;  4U0E A;  3BAS A;  2KGA A;  1JNM A;  4A7P A;  1NH4 A;  2FQ1 A;  3DS0 A;  2EFJ A;  2YKP A;  2WQY C;  3RK2 D;  4XFY A;  3AEA C;  3G4S P;  1JCD A;  3P8C E;  4UB8 E;  1HJB A;  2Y0C A;  3LMO A;  1T2K D;  2R3S A;  2WPT A;  3I55 P;  1RF1 B;  3CCR P;  2KSE A;  2M5A B;  2QJK C;  2YKO A;  3C8V A;  3FGA D;  3L73 G;  2E43 A;  1SQV E;  1FE6 A;  3B8E B;  3BCC G;  3RK3 C;  1RO2 A;  3H1L G;  4XFX A;  1H0T A;  1Z6M A;  4XFZ A;  2YIU C;  5AVU B;  1JEK A;  4XRQ A;  2FHS C;  1BE3 G;  3MZW B;  1CZQ A;  1IJD B;  4H44 D;  1EMV A;  1AFO A;  3BAT A;  2BCC J;  4IFD K;  1HGV A;  1R8E A;  2EHS A;  4QKO A;  4C7R A;  1BGY J;  4M0I A;  1AF8 A;  5B66 H;  3VRL C;  1KFN A;  5GTI H;  3DPH A;  4H2W C;  4NPE A;  2L6E A;  3C1L A;  4WWI A;  2EIA A;  1L0L G;  1NTK E;  2RMZ A;  5DJU B;  2C0W A;  2WT7 B;  1JB0 J;  3L70 J;  3H6P A;  1NGM B;  4W7Z A;  1AVO A;  3I5C A;  2YNY A;  1JTH B;  2K0X A;  5CBN A;  2QSI A;  1M1J C;  1KQG B;  1VL2 A;  2RKL A;  1IFI A;  4U3F E;  1KC8 Q;  1FDO A;  2PNG A;  1MUU A;  2LOL A;  4D6T G;  3DS1 A;  4IFM A;  2KI7 B;  3JCU E;  3GF3 A;  3M1M A;  2KLU A;  1URQ D;  1SQX K;  5AVV B;  3G28 A;  2O1K A;  3A0B H;  1FOS F;  3OW2 O;  2BHV A;  4JPZ B;  5CCG C;  2GDY A;  3VP9 A;  4H13 B;  3GF7 A;  2M8P A;  3GZM A;  3CE7 A;  5KAF E;  3SSU A;  1SQV D;  4N3Y B;  2OYH C;  1SQX J;  2WT7 A;  3HD7 D;  5KJ7 C;  5APW A;  2JYG A;  3L71 J;  1F80 D;  3CWB J;  2D2C D;  4QMA A;  3L73 E;  5M1B A;  3CXH E;  4PD4 I;  1LTJ B;  1R5L A;  4IOI H;  2ZVO B;  3BCC E;  1KLP A;  1FZC C;  3H1L E;  4U0C A;  3SWY A;  1BE3 E;  4KJM A;  2PEQ A;  2E5T A;  1NAF A;  1ZR4 A;  3H1I J;  1P84 D;  2KXP B;  1NU1 K;  4GDO A;  3CL3 D;  5B5E H;  4I2L C;  2OYI A;  2LXB A;  3AE9 C;  2KNC A;  2FAD A;  1PEQ A;  5KLV G;  5H2F E;  1PP9 G;  2ZXX A;  3RL0 g;  4TLF A;  2QIW A;  3E1R A;  4DJG A;  3WBH A;  1HVV A;  1NU1 J;  2QJY B;  3MGE A;  4W7Y A;  4BPG A;  1NKZ B;  1M6E X;  2XXM A;  3M0A A;  2R44 A;  3FWL A;  1JOC A;  2KYV A;  4U3F D;  3L72 J;  3M0D C;  1GPJ A;  2E74 C;  3S9O A;  3H1J J;  2E42 A;  1KYO E;  2V4H A;  1E79 H;  3M9B A;  3MGN A;  1L0H A;  3SWK A;  4D6T E;  1H88 A;  3DS4 A;  3GW6 A;  3D6Z A;  1PFI A;  2PGD A;  1VQO P;  1RHZ B;  2K1A A;  4OGQ C;  4H0L B;  2FFD C;  4ASV A;  3TGU E;  1DV5 A;  2FXP A;  2FVE A;  2LIW A;  3H1H G;  3L73 D;  3CC7 P;  3CXH D;  2LL8 A;  3BCC D;  5CCH A;  2L4B A;  1PL5 A;  2IFM A;  2YMK A;  5F2K A;  3U59 A;  4MN4 C;  1BE3 D;  1X8Y A;  3GMA A;  1N73 B;  3N4X A;  5F2O A;  1OW6 A;  1N2D C;  3P32 A;  3M06 A;  3H32 B;  1KZU B;  5CJ4 A;  1QX8 A;  1H8A A;  4DCK A;  2IDB A;  1KB9 E;  1L4A B;  2A45 G;  2IBZ G;  2M8R A;  5AW3 B;  2K2Q A;  3ABV C;  3AEG C;  3KDP B;  4XFJ A;  4B86 A;  3B4Q A;  4U0A A;  1CSB A;  1PIX A;  3KHU A;  1LT9 B;  1VF5 B;  4UB8 H;  3H25 A;  2W27 A;  4DZO A;  3Q20 A;  1W2B O;  3GHG C;  2P10 A;  3NTE A;  1L0L D;  5KLV E;  1PP9 E;  2N1T C;  4AQR D;  3Q1M A;  2EG5 A;  2QM7 A;  2SPZ A;  2KIK A;  5AVZ B;  1YTZ T;  3TNU B;  1J1E C;  3CCV P;  2VLQ A;  1Q81 Q;  1KYO D;  1RH5 B;  3KPE A;  3PTZ A;  1G1J A;  4C7N B;  5HGM A;  1N73 A;  1IC2 A;  3CC4 P;  3AEE C;  1K04 A;  1DX7 A;  2Z45 A;  3H32 A;  4N78 E;  3BRV B;  1UIX A;  1EOQ A;  2NPS C;  2O01 N;  1E6J P;  4WY4 B;  3SFE C;  5APU A;  1ZME C;  4U0B A;  1SQB K;  4PV1 B;  4LLH A;  1YIT P;  2HOD A;  1IFJ A;  4DT0 A;  2E1M A;  4GOF A;  2DW3 A;  2MF4 A;  1FBM A;  3RK2 B;  1G2C B;  3QWO C;  2DNW A;  1SQB J;  2GZJ A;  1RQU A;  1GXG A;  2WSS H;  3B5I A;  1L0N D;  3H1H E;  3CCS P;  2AF8 A;  4C7N A;  3RK3 E;  2JWA A;  4HH2 A;  2FYZ A;  4UB6 H;  2XND H;  5DJT B;  1M74 A;  3JCU H;  4PD4 D;  2WPQ A;  2L9F A;  1KD1 Q;  1PPJ E;  4COP A;  5B66 E;  2HLO A;  1SQP G;  2WIT A;  4WY4 A;  2MVV A;  2AXT H;  2IBZ E;  5CMZ A;  5KAF H;  4LGD E;  5KLV D;  2QEX P;  1PP9 D;  3DS2 A;  4ZMD A;  1A8O A;  2V7Q H;  2FVF A;  2OTJ P;  3A3Y B;  1N7S D;  3HE4 B;  2K0Y A;  3CCE P;  3CXH H;  4U3F J;  3L75 J;  4IL6 E;  1Q90 D;  3VMY A;  2ZJS E;  5I4T G;  2K5X A;  4N78 D;  2XNX A;  3L36 A;  2G8Y A;  3V2N A;  1LTI C;  1NTZ G;  3V2Q A;  2NRG A;  2GUV A;  2H89 C;  1EZV I;  5H2F H;  2CPB A;  4ZNC A;  3BRT B;  1VKU A;  1EZV G;  1URQ B;  2Q9I A;  3L73 J;  3HE4 A;  1M90 Q;  3USS A;  1OIP A;  1YJN P;  5C39 A;  1JY3 O;  3H1H D;  1S1C X;  3WUT A;  1KYO H;  4EDF A;  3HD7 B;  2ONT A;  5BS2 A;  3L74 E;  4Y99 B;  1PGO A;  2IYO A;  3RL0 C;  1VQN P;  3HRN A;  1DNY A;  1L0L K;  2BAS A;  2J58 A;  2D2C B;  2W6B A;  2IBZ D;  2ZVN B;  1FU1 A;  2ZYA A;  2XZR A;  3A7O A;  3HUS A;  1SQP E;  1L0L J;  2K9J B;  3Q5R A;  1GDT A;  3B5N A;  4PXH B;  2E5Y A;  2Z5I A;  5APX A;  3P05 A;  3GG2 A;  2ZT9 C;  1S4X A;  2O01 J;  3HD7 A;  1YYC A;  3VMX A;  2OYI C;  2Z4E A;  1VQM P;  1S9K E;  1KB9 H;  4H13 C;  2Q3I A;  3M9H A;  1S5L E;  3LW5 H;  2AFD A;  3CCJ P;  5TJH A;  4JYC A;  1NTZ E;  2M3B A;  2QE7 H;  2WSE J;  3U43 A;  1L0N K;  1D7M A;  1YBK A;  1AA0 A;  2K9J A;  4DOJ A;  2W6J H;  5CCG D;  3VMZ A;  2K9Y A;  5AW5 B;  1LNQ A;  2B89 A;  2ZXE B;  1NYH A;  5CHX A;  1N7L A;  1L0N J;  1U7J A;  4W80 A;  1OX3 A;  5F2N A;  2N98 A;  1QGK B;  5L8R J;  3CI9 A;  3PJS K;  2JGP A;  3F5H A;  5KLV K;  3CCM P;  1A02 F;  2M8L A;  1X3O A;  1FJP A;  4XE5 B;  1DH3 A;  2CPS A;  5E79 H;  2ZYG A;  3FXD A;  1YQ3 C;  1NTM G;  1SLQ A;  2PY8 A;  3CXH I;  2QJY C;  3EFF K;  2KG6 A;  1ZR2 A;  1SQP D;  1PP9 J;  2NZ2 A;  2HFE D;  5AW2 B;  1CI6 B;  2K93 A;  2YO3 A;  5CCH C;  2GZF A;  3AE3 C;  1GL2 D;  2BQ1 E;  2J59 M;  3AEC C;  1SFC A;  1GU4 A;  1VQ5 P;  3G26 A;  2E76 D;  2PEN A;  3LID A;  4I1L A;  4IL6 X;  3RBZ A;  3G71 P;  1Y8A A;  1OMI A;  2QJP B;  2KW2 A;  2E74 D;  2FYU G;  3MD0 A;  1RE3 A;  3H47 A;  2MKV A;  2M8N A;  1T8Z A;  2WTY A;  3CCQ P;  1NTZ D;  2HG5 D;  2WWW A;  1X22 A;  3K5B A;  2A45 H;  2JWD A;  1RF1 A;  2M5A A;  2WPS A;  1OWA A;  1CI6 A;  3CX5 E;  1KYO I;  4I7Z B;  5AVS B;  2Q6Q A;  3VN0 A;  2K37 A;  1EZV D;  1N73 C;  3H1H J;  4HKG A;  3II6 A;  4IL6 H;  2VSQ A;  2FY8 A;  1HY8 A;  4UB6 E;  3MHV A;  2BEQ D;  2GM4 A;  4H2Y C;  3KYQ A;  5CZD B;  1DEE G;  1PGP A;  3AED C;  3G29 A;  2KS1 B;  3TSI A;  1VF5 C;  1NJI Q;  2WVR A;  1H89 A;  2ROQ A;  3P8C D;  1XTG B;  4KT0 J;  2YXQ B;  3TGU G;  5DCK A;  2AXT E;  1A02 J;  4YXD C;  2VRS A;  3WUV A;  4H2X C;  1NTM E;  2KWL A;  4RJT A;  2R5D A;  4C46 A;  3Q5S A;  1K30 A;  1GTW A;  4NEO A;  1GW4 A;  1JTH A;  1KB9 I;  3CPW O;  2I1J A;  3FWN A;  3RG2 A;  5KAI H;  2FAC A;  1NKN A;  1MV8 A;  5EW5 E;  2XT1 A;  1ZP0 C;  2P58 A;  4M3L A;  3GLM A;  1USD A;  2JDI H;  1DD3 A;  2N9B A;  2JU1 A;  1N7S B;  3H1K E;  3AE7 C;  4WY4 C;  5KLI C;  2P1J A;  4PV1 C;  1PEU A;  2FYU E;  1SQQ G;  3LRY A;  1S5L X;  3U1C A;  1NTK D;  1QL2 A;  2JU2 A;  2H43 A;  3L35 A;  3TK1 A;  1JUN A;  1JMM A;  1YHQ P;  1SP4 A;  1U57 A;  3GJN A;  2CK3 H;  3NXS A;  1N86 A;  1T2K C;  1LTJ A;  4DG9 A;  1VQ6 P;  4RES B;  1ZLL A;  1LTT C;  1IFD A;  5APT A;  2LTE A;  5EJD A;  1NHL A;  1AUM A;  1EXJ A;  2XV5 A;  1SQP K;  1FJK A;  1VQK P;  1N7S A;  2QJK B;  4UHP B;  3CD6 P;  1S5L H;  2MJZ A;  3W67 A;  1WMK A;  2YIU B;  4L73 A;  4R4M A;  1J1D B;  2KR5 A;  5AVY B;  4F37 A;  2M5R A;  1BGY G;  5CBO A;  2VLO A;  2AVA A;  1RQV A;  1LTB C;  3TF5 A;  3OAK A;  2O3J A;  4K35 A;  3L4F A;  2KG8 A;  2N5H A;  1AQT A;  1JMB A;  1YJW P;  4R0M A;  3H1L D;  1NQ4 A;  2KOG A;  1K73 Q;  2P7J A;  2Z46 A;  2YKQ A;  4EI2 A;  1EQ7 A;  1N8R Q;  2WMM A;  2XDJ A;  1UII A;  1M1K Q;  2A45 I;  2IBZ I;  3L70 G;  1PPJ G;  2ERH A;  1ACP A;  1XTC C;  1VQ4 P;  2K88 A;  1KQF B;  2FYU D;  2OAR A;  2QRX A;  1AQ5 A;  1BDC A;  2E75 C;  3HUS C;  3L37 A;  5KKZ B;  1FDM A;  1W5C E;  3B5N C;  2LR2 A;  3AE2 C;  1Q82 Q;  2K92 A;  1MZ9 A;  1M1J B;  1SQQ E;  1S3J A;  3SWF A;  3MP7 B;  3IAO A;  1HQB A;  3EJE A;  1JY3 P;  2AXC A;  2R32 A;  3OJA B;  3RG6 C;  1JCC A;  1JY3 N;  2FBW C;  2XU6 A;  3HD7 C;  2L0Q A;  3UIA A;  3EJD A;  1SQX G;  3E1I A;  4OH8 B;  1KV4 A;  5JPA A;  1ZXG A;  3WUU A;  2KB7 P;  3L71 G;  2D2C C;  2EHT A;  1JY2 P;  2WPR A;  3CWB G;  7CEI A;  1SQV K;  4JYB A;  4D6T D;  2OYH B;  1KIL E;  1L4A A;  3CME P;  2KSJ A;  5E79 E;  2WPV B;  1WT6 A;  1FZF A;  3V6I A;  2L5G B;  3RL0 D;  1JM0 A;  1EIA A;  2QVA A;  1LT9 A;  3D70 A;  4L76 A;  4KHX A;  1SQV J;  1L0I A;  1PEO A;  2JBG A;  3TGU D;  5AVT B;  4CA3 A;  1DIP A;  3H1I G;  3CX5 H;  4YPC A;  1M57 D;  3D71 A;  3TNU A;  3PHL A;  2B9B A;  2JB0 A;  1BGY E;  3KZI E;  5AVQ B;  3HTK B;  3L74 G;  4RO0 A;  1NU1 G;  4BXL A;  1AJY A;  1NTK K;  1LT1 A;  2CQ8 A;  2GZG A;  2KLV A;  1KB9 D;  2ZT9 D;  1GL2 B;  1J2J B;  3L72 G;  1T8K A;  4HYT B;  1MFZ A;  3L70 E; 
#chains in the Genus database with same CATH homology
 1M6E X;  2XXM A;  3P05 A;  3CC2 P;  2OAR A;  5BS1 A;  3H47 A;  1D1D A;  2M8N A;  3CCV P;  5I4T G;  4COC A;  2PEO A;  3G1I A;  2PEM A;  1Q81 Q;  1PEU A;  3LRY A;  5HGM A;  5HGN A;  2KOD A;  3CC4 P;  1VQM P;  4U0D A;  2Z45 A;  1Q82 Q;  3CCQ P;  3CXC O;  1QRJ A;  1VQL P;  5HGO A;  1PEM A;  2BUO A;  1QVG O;  1QVF O;  1KC8 Q;  1IUQ A;  4GR6 A;  1YIJ P;  3G1G A;  3CCJ P;  1YHQ P;  1EOQ A;  3DS1 A;  3G0V A;  4IPY A;  3CMA P;  4U0E A;  3M1M A;  3RG6 C;  1E6J P;  3DS4 A;  3HZQ A;  1VQO P;  3G28 A;  2PEI A;  3DS0 A;  3DTJ A;  4U0B A;  2EFJ A;  3H0D A;  2PEK A;  1VQ6 P;  1Q86 Q;  1YIT P;  1VQ7 P;  5JPA A;  2JO0 A;  3OW2 O;  2CWO A;  2BHV A;  4XFY A;  1VQ8 P;  3CCL P;  3G4S P;  1M90 Q;  3G21 A;  1AUM A;  2E1M A;  1BAJ A;  2M8P A;  4WYM A;  1YJN P;  1VQK P;  1RO0 A;  3DS3 A;  2P9X A;  3I55 P;  1S72 P;  3CCR P;  1VQ9 P;  3CME P;  5F2N A;  3CC7 P;  2JYG A;  4XRO A;  3CD6 P;  1KQS O;  3B5I A;  1EIA A;  2LF4 A;  3G29 A;  1ZMB A;  3CCS P;  1NJI Q;  1A43 A;  3CCM P;  2ONT A;  2PEJ A;  2QA4 P;  5BS2 A;  2M8L A;  3CCU P;  1RO2 A;  4XFX A;  5HGL A;  2DGY A;  3HYB A;  4XFZ A;  5F2K A;  1Q7Y Q;  1PEO A;  4QNB A;  1M74 A;  1VQN P;  1K8A Q;  4XRQ A;  1K9M Q;  5F2O A;  4PH1 A;  4U0C A;  5DCK A;  1VQP P;  2PY8 A;  1JJ2 O;  1RNI A;  1KD1 Q;  3I56 P;  4COP A;  2PEQ A;  4U0F A;  1K30 A;  4U0A A;  1YJW P;  2JYL A;  4GR2 A;  1K73 Q;  1M6N A;  4M0I A;  2Z46 A;  3CPW O;  2QEX P;  1PEQ A;  3DS2 A;  3E2D A;  1A8O A;  3VRL C;  3H4E A;  2BQ1 E;  3DPH A;  2OTL P;  3Q20 A;  2XV6 A;  3DS5 A;  1N8R Q;  1W2B O;  4PH0 A;  1M1K Q;  2OTJ P;  1VQ5 P;  3NTE A;  3G26 A;  3G6E P;  2L6E A;  2PEN A;  2XT1 A;  2Z44 A;  1YJ9 P;  2EIA A;  3WBH A;  1YI2 P;  3G71 P;  3CCE P;  1VQ4 P;  3MGE A;  2EG5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...