1K8AQ

Co-crystal structure of carbomycin a bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAKGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title The structures of four macrolide antibiotics bound to the large ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 47
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2001-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1k8aQ02
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1k8aQ01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1k8aQ03
1YITP 1YJWP 1JJ2O 1Q82Q 1VQ6P 1NJIQ 1YJ9P 3CCRP 1VQ8P 2QA4P 1VQMP 3CXCO 2OTJP 1Q86Q 1QVGO 1VQNP 3G71P 3CCLP 1Q7YQ 1YJNP 2OTLP 3CCQP 3CCSP 1YHQP 3OW2O 1W2BO 1KQSO 3G6EP 1YI2P 1VQ9P 1VQKP 3CC7P 1KC8Q 1K9MQ 1VQOP 3CCUP 1VQ7P 3CCJP 1K73Q 1VQ4P 1M1KQ 3I55P 3I56P 3CMEP 3CCEP 1S72P 3CCMP 1M90Q 3CC2P 1QVFO 1VQLP 1K8AQ 3CMAP 3CCVP 1YIJP 3CC4P 3G4SP 1VQPP 1N8RQ 1VQ5P 1KD1Q 3CPWO 3CD6P 2QEXP 1Q81Q
chains in the Genus database with same CATH superfamily
3MUDC 3TF5A 3AEDC 1FZEA 5CCGD 3GW6A 1DH3A 1N7SD 2IBZD 1FZBA 1SFCC 4O9BA 2W90A 1M1JC 1IFIA 3BCCJ 2K1AA 4I7ZC 3A3YB 1ZN5A 1CZQA 4U0CA 1BE3E 1KFNA 3RK2D 4U3FD 3H1LJ 1SS1A 3WU2E 3VN0A 1ZOYC 1IK7A 4COPA 1RHZB 1NH4A 2FVEA 2XKMA 1GXHA 5KP8B 4YXDC 2KS1B 2FXOA 2ZYAA 1Q81Q 1NTKE 5L8RJ 2Z4EA 1DIPA 2K0XA 3V4QA 1IFPA 5AW3B 1CI6A 5CCGC 1BDCA 4PWVB 1JTHA 1N7SC 3HZQA 3HTKA 1GU4A 1JY2P 2B88A 3CCRP 1YQ3C 2H89C 2R3CA 3FWNA 1YJNP 1X79B 2LL8A 1SQQG 1BCCJ 4LC1A 2AFDA 5KLVE 1EIAA 1KB9I 3TGUJ 3HUSC 1CI6B 1T3JA 1KYOH 2I8DA 1YIJP 1AUMA 1JTHB 2KGAA 1PGJA 3HTKB 3MIWA 1A02J 1USDA 1KZUB 1LWUC 3G1IA 2K0YA 1BXIA 5AVUB 4AUWA 1SQPD 2MVUA 2FYUD 2BCCG 1WRGA 1Q2NA 2LKIA 4IL6H 1NKZB 1MUUA 3PJSK 4AQRD 2AFEA 3Q20A 2BHVA 1EDKA 1EDLA 1LNQA 1KB9E 1NTZG 4U0EA 3B5NC 4H13D 1Y9BA 5KAIH 3L74D 4IFFA 3CWBD 3EFGA 4H2WC 3WBHA 1BDDA 1SP4A 1PPJE 1U7MA 2GUSA 2QIWA 1Z56A 4HJGH 3Q3DA 2Y0EA 3GF3A 3L72E 2MVVA 1SQBK 3H25A 3C1LA 4WYMA 1T3UA 2E74B 3G1GA 4L73A 2O3JA 3G21A 1JO5A 2GZIA 1J1DB 3RBZA 3WUTA 2JYLA 2POHA 2BQ1E 2A45G 3SSUA 5DJTB 3IFMA 1X22A 2X2BA 1VKUA 3M1MA 3G28A 2Z45A 2JDIH 2M0BA 5AVSB 3L75G 3H1JE 2NO8A 2XNXA 2WSEH 2LOLA 1QVFO 3L73J 4PD4I 3M91A 1T8ZA 3O8ZA 4H13C 4I1LA 2JWDA 1AVYA 2CGQA 1VQ6P 3BVHA 3L70G 3CXCO 2FADA 1L4AD 4IOIH 2FQ1A 2LTEA 4UB6H 1SQVE 2KLVA 3AEGC 2W6AA 3A7OA 1URQD 2QRXA 1E0HA 1JCDA 1KMIZ 2JU2A 3HE4A 3FX0A 5GTHE 1LP1B 3CPWO 2OTKE 2L6EA 1FE6A 2E75D 2WPRA 4HB1A 5CBOA 3TK1A 1RQUA 2N1TA 1EZVE 1ZNVA 1QX8A 2BASA 5EFWB 5APXA 3GG2A 4PD4E 3TYYA 2Q6QA 3B5IA 4D6TG 2FY8A 1JJ2O 3HE4B 2YMYA 3I5CA 1NWQA 1JY3O 3A0HH 3CCJP 1L4AC 3S4RA 2N1TB 3M0DA 1AJYA 1NTKD 1IC2A 2FQ2A 1G2CA 2O01H 2K2QA 1RE4A 1M7LA 1URQC 4NPEA 2FFDA 3G9RA 2O1JA 4ASVA 1HF9A 2K0DX 2ZT9D 3SFDC 3NTEA 1OXZA 1Q90D 2E75C 4WY4A 4XRQA 2HODA 1VQ9P 2YIUB 1NTMG 5KTBA 1KILA 3AE2C 5M1BA 2JBGA 5BU5A 1IFJA 4H0LD 2YKQA 5AVXB 2C0WA 3RG6C 4RESB 1G2CB 2Z5IA 1PL5A 2R32A 5AW4B 3N4XA 5KLVD 2MF4A 2FFDB 2OYIA 4U3FJ 1FDOA 3N7NA 2IX7C 2WSEJ 4A7PA 3TNUA 2LIUA 2ZYDA 3L36A 2FQ0A 3E2DA 4PH1A 4NPDA 1VDFA 1SQQE 1AA0A 2GZEA 3E1RA 1KILB 3EJDA 3AECC 1KQFB 4EDFA 3V6IA 5CCHA 1U57A 2Z44A 1CSBA 2M5AB 1OMIA 2ZT9C 1SQPK 4K3AA 2FYUK 2OYIB 2Z46A 5F2OA 1ZW0A 5I4TG 3CX5E 3TNUB 1S5LH 1YYCA 1FZCC 1BAJA 1S9KE 4H0LC 2B87A 5APQA 1GW4A 1KB9D 3BRTB 4LLHA 2BCCE 3IN6A 2QM8A 4Y99C 3HE5A 4EI2A 2VRSA 2PEQA 2A45I 3Q5RA 4IL6X 3MUDA 1P84E 2QG4A 2KSJA 4QKOA 4OH8B 1EQ7A 3L72D 1TU3F 4KT0J 1NTZE 4GKGA 2IDBA 1SFCA 4HKGA 4U0AA 2Q3IA 4U7JA 3L4FA 1VQ7P 2B87B 3WUVA 5AVVB 2AF8A 2WMMA 3CMEP 3EWKA 2FXPA 2O01J 1M6NA 2PNGA 1NKNA 3HE5B 1NU1G 1SQPJ 3Q1MA 1FJKA 2B89A 2FYUJ 3DTJA 2WSFH 1WMKA 1YTZI 2QVAA 1L0HA 1FJPA 3H1JD 3S1KA 4XROA 2PEIA 4XA4A 2W8ZA 2LXCB 1SLQA 3PHLA 4YTPC 2N6ZA 1SFCB 1RE3C 2QE7H 1IFNA 4XFJA 2H43A 3L74J 4I7ZB 3M9BA 3CWBJ 1HJBA 3L75E 3H1KG 4IFDK 3JCUE 5CCGA 1SQVD 1IUQA 2HG5D 3TGUG 5TISE 5KP6B 1FDIA 1VF5D 2KYVA 1PPJG 1UNKA 3RK3B 3TDKA 4JPZB 3HD7A 3L70E 1SQXG 1CW5A 1W2EA 2W6JH 3RL0D 3EJEA 1NJIQ 1Q86Q 1EOQA 2QSIA 1HTLC 4XFYA 1RF1C 3GLMA 4QNBA 1K73Q 4PD4D 1EDJA 2CPBA 1K8AQ 3AE3C 2G8YA 3NFQA 2XZ1C 2ZFCA 3HD7B 4HKZH 4YPCA 3TSIA 1BGYJ 3GMAA 3USSA 3AE8C 4Z1MH 5KLIC 3EQ2A 3IAOA 5F2KA 3MHVA 1L0LE 2PGDA 1JMMA 1NTKK 3VYIA 2CK3H 4D6TE 3CI9A 1VF5C 5E79E 1KORA 2KOOA 1U7JA 4MN4C 5AVZB 1OX3A 1L0IA 2KOQA 1GD2E 4JYBA 3RL0C 1JY3N 4N78D 1T2KD 3B5NA 4DT0A 4BRYA 3P8CD 3VP9A 1ZLLA 2EIAA 2WSFJ 5GTIH 2NPSD 3H32A 1YBKA 3CXHE 3JC22 5TJHA 2KIKA 4BPHA 4UB8H 2L4BA 2WSCH 3AE6C 3GHGC 3L73G 1KC8Q 1Z6MA 1CEIA 1H0TA 4W80A 1MFZA 3B5NB 4BRYB 3H1HD 2OYHA 1A02F 3P8MC 2PY8A 3D71A 2WWWA 3H32B 2KG8A 4OVNF 3CX5D 2JO0A 1T2KC 5B5EH 1NOHA 3I55P 1OW8A 2E1MA 1JEKA 2KOSA 3CC4P 1JUNA 1H0TB 2D2CB 2KW2A 2QEXP 2KUBA 1NVOA 1M8OB 2K92A 5B66E 5H2FE 1QRJA 2BCCD 2QA4P 2HPCA 1AYIA 2FVFA 2NPSC 2OYHB 1OZHA 4IZ6A 3KYQA 2GUVA 3O6QA 2WSSH 2W6BA 4LGDE 3W67A 3CC2P 2E76D 4W7ZA 1GZLA 2ITAA 3CE7A 3B8EB 4PJ0H 3VOPA 1PEOA 1IMQA 2XNDH 2JU1A 2MKVA 4H2YC 2A06D 1IK9A 2GZJA 3RK2C 4NEOA 1FDMA 5AW0B 2JGPA 3L37A 2HLOA 2KOGA 5KAFE 1ZR2A 3O6QB 1LTJA 3H1IJ 1X8YA 1LT9C 3ABVC 4H44B 2KB7P 3H4EA 2QJPB 1DEBA 4R4MA 1NU1E 3DS1A 2Z5HA 2Y9ZA 1OFCX 5DJUB 3V4WA 2E43A 3L75D 4U0DA 2P2UA 5BVZA 1SQVK 4U3FG 2W27A 2E76C 3AE4C 1JOCA 4TLFA 2WSCJ 1AFOA 2JEEA 1LTJB 2Y9YA 1UIIA 1GXGA 1HVVA 3L70D 3H1KE 1ZMEC 1YTZT 4BPGA 3TGUE 2KG6A 3LIDA 1OW7A 5CHXA 3A0BH 2WPTA 1PV3A 5AW9B 2OTLP 1SQXE 2CNRA 4ZKPA 3H1JJ 5APSA 4BXLA 3VMZA 3PTZA 3Q2YA 3D6ZA 1T8KA 2QJYB 4OGQD 1GK4A 1Y47A 1YQ4C 4GOFA 3MGNA 2LR2A 1SQVJ 1GL2A 2P7JA 4GOEA 4DOJA 1VQKP 2DNWA 1EZVI 2HYNA 1AV1A 3OJAB 1KFMA 2FYNB 1FZCA 1VHNA 5F2NA 4TT3H 5C39A 2KORA 4L76A 1ZXGA 1KILE 1QEXA 1ZR4A 1L2PA 2W83C 4ZMDA 1BSNA 2KGCA 2CWOA 2AXTH 1SQPG 1LTGC 1GL2B 1KYOI 3Q5SA 1NTMD 1VQLP 5HGNA 3AEBC 1SQBJ 2XV5A 3LRYA 1AVOA 1FZCB 4U0FA 4OGQC 2N5IA 4H0LB 2ZVOB 2K93A 3CWBG 2KODA 4Y99B 2O01N 3FWLA 3F5HA 3KZIH 1S4XA 3G3ZA 1L0LG 1J1EC 2Q7CA 2CG5B 3L73E 1N7LA 1M74A 1BE3D 3U1CA 2JQ4A 1XTCC 1JY2N 4YXWH 4EYYQ 5KJ7D 2N9YB 3RGUA 2YKOA 3LIEA 3BATA 2E74D 4DG9A 1NGMB 1PP9G 3NTNA 4GT1A 3H6PA 2A45H 4BPFA 1KYOE 3L71J 1D7MA 3Q5PA 3DS0A 3CL3D 2YO2A 1M57D 1W5CE 3JCUH 2Q3EA 3VRLC 5TISH 2VLOA 3FXEA 3CC7P 3CCUP 1BGYG 2Q9IA 3CCEP 1M90Q 1UIXA 5CJ0A 1LGHB 1DX7A 5AW6B 4IL6E 1DD3A 3CX5I 4L74A 4GDOA 3H1HJ 1KD1Q 2KZIA 2PRRA 1RQVA 1RF1A 3B71A 3W68A 2GA1A 2OTJP 1X0TA 4HYTB 2G3AA 1LTSC 2C9LY 5KJ7C 1ZP0C 3RK3E 1MV8A 5KAIE 2LF4A 4WY4B 2E74C 2HODB 5EW5E 5HVCA 1J1DC 2J58A 1P84I 1VQPP 1DD4A 2PP6A 3AE7C 1PZQA 3A5TA 1VQ8P 3IR9A 1NU1D 3L35A 1GU5A 1FOSF 2Y0CA 2ONTA 2BCCJ 3VP8A 1N73C 2EHSA 1YI2P 5CMZA 4CA3A 1L0NG 4QMAA 1RF0A 1AQ5A 1ZV8A 2HR3A 2IBZE 1AF8A 1NO4A 5AVWB 3VMAA 2PEOA 5KLIB 1JY3P 3GKLC 2QJKB 1OVUA 2N1TD 3H1KD 1W2BO 3BCCG 1OW6A 4U3FE 1VQOP 3ITKA 1PEMA 3I56P 2KI7B 1PPJD 3M9QA 3H1LG 4F37A 1LJ2A 1PIXA 1NYHA 1SQXD 2FVAA 2JR8A 2SPZA 1DEEG 1KQLA 1NAFA 3NXSA 3U1AA 1AQTA 4COCA 4PV1B 4WBAA 1F80D 2E5YA 2ZYGA 3G6EP 1KQGB 1M1JA 3E1IA 2YXRB 5AW8B 3NMDA 2ROQA 2KSEA 4GR2A 2KWLA 1IJDB 1EXIA 2AVAA 3VMYA 3WU2H 2N1TC 1GMJA 3L70J 4OWFA 2AEJA 1QLED 1KILD 1FR2A 1M1JB 3DS3A 2NPSA 1KV4A 2YNYA 2WITA 2WZ7A 1BCCG 3B4QA 3KHUA 2P9XA 3DS5A 3A0HE 2YIUC 3KDPB 2GZGA 1NTMK 2IYPA 3H1IG 1N7SA 3KXDA 1GPJA 2M8LA 3U43A 1HJ0A 2HFED 1GTWA 2K37A 2R3SA 1SQPE 2ZAEB 2ERHA 2IFNA 2EHTA 1EZVD 2H7HA 2NPSB 2FFDC 3VMXA 3OAKA 5CCHD 2GDYA 5AW1B 1NQ4A 3HUSA 1LT1A 2KP8A 3SWYA 3L73D 1LT9A 5APYA 1QL1A 1FOSE 5HGOA 2M8NA 1N7SB 3JSVC 1KILC 3CWBE 1HY8A 1HGZA 3CXHI 1LWUA 1KYOD 2KK7A 3RK2B 2OYIC 2OQQA 2RN0A 3HUSB 2OARA 2NZ2A 2C0XA 1NTMJ 4Y28J 1LT9B 2DW3A 3R2PA 1PP9E 5APUA 1DNYA 1R5LA 5AW5B 4C7RA 5CCHC 1IFMA 1LTBC 4M3LA 2GM4A 4XFXA 1LWUB 3AEFC 1M1KQ 2XZRA 2M8PA 3HYBA 1KB9H 2P67A 2XV6A 3AEAC 3G4SP 1VQ5P 2I1JA 2BEQD 2J59M 2JJLA 5KLVK 2UWJE 1BGYE 3C8VA 1BE3J 2L91A 3WMM0 3RL0g 2WPVB 2GZFA 1JY2O 3RK3D 1MZ8A 1EDIA 2V7QH 4IFMA 2KGDA 2WVRA 3T97A 4ASWA 1LTIC 1ZMBA 1SQQD 5AVYB 1NU1K 3ZDMA 2FKWB 3U59A 4R0MA 2KG9A 1NTKJ 2Y0DA 2ZJSE 1HQBA 1VQNP 3SWFA 3G29A 1KQSO 1K04A 5DCKA 1SQBG 2FAEA 2N6YA 1OVVA 2KS1A 2Q1KA 3HD7D 3UIAA 1MFTA 2C9NY 3T97B 2IPPA 2M5RA 1L0NE 1RH5B 1S9KD 2LKMA 2NRGA 4WB4A 2B9BA 2I1KA 2M3BA 4GIFA 2VLPA 2VSQA 3H0DA 4AYCA 4JF7A 3MP7B 1S1CX 5KLVJ 3RK3C 3QWOC 2L9FA 3M06A 2PFXA 1P84D 5KKZC 1SQXK 2BEZF 1S5LX 4XFZA 3BCCE 1NTZD 4I2LC 4U0BA 4H13B 2YMKA 5GTHH 4EOTA 3P05A 1RO2A 3L71G 1FZGA 4C46A 1NU1J 2RH0A 3B4SA 3H1LE 4CPGA 2HPCB 1X3OA 1OVRA 3CMAP 4PD4H 2H88C 3HD7C 3C9IA 1IMPA 7CEIA 2AXCA 4RJTA 4OGQB 1MZ9A 3VTPC 3V2QA 2IBZG 1L4AA 5AVTB 5AVRB 1GW3A 3B5ND 3H1KJ 3H1HG 3E7KA 1OWAA 1URQA 3CCMP 2K5XA 1S3JA 2LPKA 1J1EB 1N86A 3D70A 2QNWA 2P10A 2WPQA 3AE5C 1NHLA 1SQXJ 2V7QJ 3L72J 2JB0A 2BUOA 1HBWA 1BCCE 1L4AB 2D2CD 3MZWB 4JBZA 1PGOA 2KZJA 4GR6A 4R4LA 3MD0A 3H1IE 1URQB 1YJ9P 5KJ7A 2JYGA 2MD9A 3KPEA 1J2JB 4GODA 2PEMA 2E75B 1OIPA 3M0AA 4PXHB 1N2DC 4I6MC 2XDJA 5GTIE 2IFMA 1HWTC 1N73A 2QM7A 2VLQA 1L0LD 2A06G 4XE5B 4UB8E 1PEQA 3A2AA 1PFIA 3CCSP 4D6TD 2VLNA 4DJGA 3QH9A 3GJNA 1QL2A 1JMBA 2M8RA 1K05A 1E6JP 5CBNA 3SFEC 1ZRTE 2GYKA 3DPHA 3R4YA 1PP9D 5CZDB 4H44D 3CX5H 2D2CC 3WUUA 2FHSC 3NY7B 1LTTC 1Q82Q 1G1IA 1PGQA 3BRVB 1IFDA 2OYHC 5BS1A 2E5TA 3G71P 1N73B 2J5UA 4HH2A 5B5EE 2ZT9B 1LP1A 4B86A 2FYUG 2L22A 1IO4A 1FZFA 3FGAD 3IF4A 2R44A 3CXHD 1BGYD 2JKVA 1VL2A 3KQGA 1FC2C 4UHPB 4PH0A 1P84H 4H2XC 1WT6A 2KGEA 1HUCA 1FU1A 2JO1A 1SQQK 2PEKA 4RO0A 3L74G 4JYCA 1VQ4P 2WPSA 2RKLA 2YO3A 2XXMA 4PJ0E 4ZKUA 4H44C 2QJPC 1KN7A 1RE3A 2KXPB 1UJZA 4IPYA 4KHXA 1ACPA 1RO0A 4M0IA 5K5GB 4WWIA 1L0ND 1X9VA 5BU8B 1H88A 2FACA 3CCVP 5APVA 1H8AA 1SQBE 2KLUA 1BSHA 3V2NA 5KP7B 1LTJC 3EFFK 4RKUJ 1EMVA 2XT1A 2ZXEB 3BCCD 1NTZK 1S72P 3M9HA 1QGKB 2O1KA 2IBZI 1SQQJ 2FXMA 2JP3A 2R5BA 2N9BA 1FAVA 1FZAA 3AE1C 2KNCA 3DS2A 3H1LD 1USEA 3G26A 1LTAC 2RMZA 1GL2D 3K5BA 3LW5H 2E42A 1K9MQ 4N78E 5CJ4A 3GF7A 1PEUA 1A43A 4N6JA 2MR7A 3L71E 1OR5A 3P8CE 1M6EX 3EJBA 2QJYC 3MGEA 1E5WA 1Y8AA 3A0BE 1XTGB 1T6AA 4DZOA 2M5AA 1H89A 5JPAA 2V4HA 2N50A 2KNCB 1RF1B 1E79H 2FYNC 1BE3G 5E79H 2K9JA 2OGUA 2P1JA 4EIJA 3SWKA 2WTYA 3H1HE 1YITP 3V5BA 1NTZJ 1K30A 4BWNA 2N98A 5BS2A 1BCCD 2M3EA 4K35A 4C7NA 1NTKG 4JQ0D 3TGUD 1GL2C 4KJMA 1VF5B 3H1ID 3DS4A 3F89A 5EJDA 2GDXA 4NPFX 2PAJA 3HRNA 2K9JB 2JAZA 3GHGA 3CXHH 3RL0B 1FBMA 3P32A 2L5GB 1FS0E 2H8PD 1DV5A 2AXTE 3CCQP 1GDTA 4UB6E 2FYZA 2XZ0D 2LMLA 5HGMA 2JWAA 4C7NB 1L0LK 3D6YA 4DCKA 3L75J 5KLVG 2GDWA 4WVZA 1NAYA 3P7KA 3PP5A 1MKMA 2YXQB 1S2EA 3RG2A 1ZRTD 3GHGB 4WY4D 1R5SA 2IYOA 2EFJA 2A06E 3KZIE 4W7YA 3G0VA 2K3RA 2WT7A 3PRJA 1EC5A 2LIWA 1JNMA 5B66H 5H2FH 3LW5J 3II6A 2MR8A 2IZ0A 3AEEC 1G1JA 5HGLA 2K94A 1N8RQ 3M0DC 4N3YB 3CD6P 1YJWP 2FYUE 2WT7B 1L0LJ 1RE4C 1A8OA 1R8EA 2ZVNB 5APWA 1YHQP 1VPCA 1JB0J 3PLNA 1D1DA 2FBWC 2WQYC 4D6TJ 2KOPA 5HV8A 4WY4C 2L0QA 2PENA 4ZNCA 5KKZB 3L72G 2IZ1A 3OA7A 2N5HA 3PH0A 1HH0A 5AVQB 5AW2B 5KAFH 1PP9J 4PV1D 3L74E 3RBXA 4MRTC 1HGVA 1VQMP 3V2PA 1QVGO 3CCLP 2Q5UA 3LMOA 2PEJA 2YKPA 3V2RA 1L0NK 2P58A 3CLQA 1JM0A 5APTA 1M56D 2MY5A 1SQBD 3S9OA 2AEMA 2R5DA 2EG5A 1KLPA 2CPSA 2KR5A 2DGYA 3H1JG 2OYOA 1JCCA 2QJKC 3MTUE 1IZNB 3OW2O 1SFCD 1EXJA 2AEFA 4L75A 3BASA 2CQ8A 1S5LE 1RF0C 1SQVG 1KTMA 1RNIA 2E76B 2LXBA 4PV1C 5AW7B 1Q7YQ 2K9YA 2MJZA 1SVFA 3L71D 3H47A 3FXDA 1PGPA 3AE9C 3GZMA 2XU6A 1GK6A 1EZVG 2ZXXA 1RY3A 1L0NJ 2K88A 3GZLA 1NTME
chains in the Genus database with same CATH topology
1YITP 1YJWP 1VQ6P 1YJ9P 3RG6C 1K30A 2JYGA 1PEOA 4COCA 3CXCO 1A8OA 3VRLC 5BS2A 3H0DA 1YHQP 4XROA 2PEIA 3G6EP 2PEMA 1VQKP 3CC7P 1D1DA 4IPYA 3CCUP 3G1IA 1RO0A 4M0IA 2PENA 3CCEP 3DS4A 1M90Q 4GR2A 3E2DA 5F2NA 2OARA 3CCVP 4PH1A 4XFZA 2EIAA 1KD1Q 3CPWO 4U0BA 2L6EA 3P05A 1PEQA 1VQMP 4U0CA 1IUQA 1RO2A 1QVGO 2OTJP 3H4EA 3CCLP 2CWOA 2Z44A 2PEJA 3CCQP 3CCSP 3Q20A 2XT1A 2BHVA 1KC8Q 3DS1A 4XFXA 1M1KQ 1E6JP 5HGMA 2Z46A 4COPA 2M8PA 3HYBA 2LF4A 4U0EA 5F2OA 1S72P 3DPHA 5I4TG 1VQLP 2XV6A 3CMAP 4U0DA 5HGNA 2EG5A 3DS3A 3G4SP 3WBHA 1VQ5P 2DGYA 3B5IA 1VQPP 1Q81Q 3LRYA 4U0FA 1Q82Q 1JJ2O 1NJIQ 3DS2A 1BAJA 1VQ8P 2PY8A 3G26A 5BS1A 1Q86Q 2ONTA 3G71P 2P9XA 1EOQA 3DS5A 3OW2O 1YI2P 4XFYA 1K9MQ 2EFJA 3CCJP 2KODA 4QNBA 1K73Q 2JO0A 2M8LA 3I55P 1PEUA 1A43A 2PEQA 2E1MA 1ZMBA 3G0VA 3CCMP 4WYMA 1M6EX 1K8AQ 3G1GA 3MGEA 3CC4P 3HZQA 3G21A 1M74A 1RNIA 4PH0A 2QEXP 2JYLA 2PEOA 2BQ1E 3CCRP 1QRJA 2QA4P 5JPAA 5F2KA 1VQNP 1Q7YQ 3G29A 1YJNP 3NTEA 2OTLP 1KQSO 1W2BO 2BUOA 5DCKA 4XRQA 3M1MA 3G28A 1VQ9P 4U0AA 2Z45A 2PEKA 1VQOP 3H47A 1VQ7P 1PEMA 1VQ4P 3CMEP 3I56P 1EIAA 1QVFO 3DS0A 3CC2P 1M6NA 5HGOA 2M8NA 1YIJP 4GR6A 5HGLA 1N8RQ 2XXMA 1AUMA 3CD6P 3DTJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YIT P;  1YJW P;  1JJ2 O;  1Q82 Q;  1VQ6 P;  1NJI Q;  1YJ9 P;  3CCR P;  1VQ8 P;  2QA4 P;  1VQM P;  3CXC O;  2OTJ P;  1Q86 Q;  1QVG O;  1VQN P;  3G71 P;  3CCL P;  1Q7Y Q;  1YJN P;  2OTL P;  3CCQ P;  3CCS P;  1YHQ P;  3OW2 O;  1W2B O;  1KQS O;  3G6E P;  1YI2 P;  1VQ9 P;  1VQK P;  3CC7 P;  1KC8 Q;  1K9M Q;  1VQO P;  3CCU P;  1VQ7 P;  3CCJ P;  1K73 Q;  1VQ4 P;  1M1K Q;  3I55 P;  3I56 P;  3CME P;  3CCE P;  1S72 P;  3CCM P;  1M90 Q;  3CC2 P;  1QVF O;  1VQL P;  1K8A Q;  3CMA P;  3CCV P;  1YIJ P;  3CC4 P;  3G4S P;  1VQP P;  1N8R Q;  1VQ5 P;  1KD1 Q;  3CPW O;  3CD6 P;  2QEX P;  1Q81 Q; 
#chains in the Genus database with same CATH topology
 3MUD C;  3TF5 A;  3AED C;  1FZE A;  5CCG D;  3GW6 A;  1DH3 A;  1N7S D;  2IBZ D;  1FZB A;  1SFC C;  4O9B A;  2W90 A;  1M1J C;  1IFI A;  3BCC J;  2K1A A;  4I7Z C;  3A3Y B;  1ZN5 A;  1CZQ A;  4U0C A;  1BE3 E;  1KFN A;  3RK2 D;  4U3F D;  3H1L J;  1SS1 A;  3WU2 E;  3VN0 A;  1ZOY C;  1IK7 A;  4COP A;  1RHZ B;  1NH4 A;  2FVE A;  2XKM A;  1GXH A;  5KP8 B;  4YXD C;  2KS1 B;  2FXO A;  2ZYA A;  1Q81 Q;  1NTK E;  5L8R J;  2Z4E A;  1DIP A;  2K0X A;  3V4Q A;  1IFP A;  5AW3 B;  1CI6 A;  5CCG C;  1BDC A;  4PWV B;  1JTH A;  1N7S C;  3HZQ A;  3HTK A;  1GU4 A;  1JY2 P;  2B88 A;  3CCR P;  1YQ3 C;  2H89 C;  2R3C A;  3FWN A;  1YJN P;  1X79 B;  2LL8 A;  1SQQ G;  1BCC J;  4LC1 A;  2AFD A;  5KLV E;  1EIA A;  1KB9 I;  3TGU J;  3HUS C;  1CI6 B;  1T3J A;  1KYO H;  2I8D A;  1YIJ P;  1AUM A;  1JTH B;  2KGA A;  1PGJ A;  3HTK B;  3MIW A;  1A02 J;  1USD A;  1KZU B;  1LWU C;  3G1I A;  2K0Y A;  1BXI A;  5AVU B;  4AUW A;  1SQP D;  2MVU A;  2FYU D;  2BCC G;  1WRG A;  1Q2N A;  2LKI A;  4IL6 H;  1NKZ B;  1MUU A;  3PJS K;  4AQR D;  2AFE A;  3Q20 A;  2BHV A;  1EDK A;  1EDL A;  1LNQ A;  1KB9 E;  1NTZ G;  4U0E A;  3B5N C;  4H13 D;  1Y9B A;  5KAI H;  3L74 D;  4IFF A;  3CWB D;  3EFG A;  4H2W C;  3WBH A;  1BDD A;  1SP4 A;  1PPJ E;  1U7M A;  2GUS A;  2QIW A;  1Z56 A;  4HJG H;  3Q3D A;  2Y0E A;  3GF3 A;  3L72 E;  2MVV A;  1SQB K;  3H25 A;  3C1L A;  4WYM A;  1T3U A;  2E74 B;  3G1G A;  4L73 A;  2O3J A;  3G21 A;  1JO5 A;  2GZI A;  1J1D B;  3RBZ A;  3WUT A;  2JYL A;  2POH A;  2BQ1 E;  2A45 G;  3SSU A;  5DJT B;  3IFM A;  1X22 A;  2X2B A;  1VKU A;  3M1M A;  3G28 A;  2Z45 A;  2JDI H;  2M0B A;  5AVS B;  3L75 G;  3H1J E;  2NO8 A;  2XNX A;  2WSE H;  2LOL A;  1QVF O;  3L73 J;  4PD4 I;  3M91 A;  1T8Z A;  3O8Z A;  4H13 C;  4I1L A;  2JWD A;  1AVY A;  2CGQ A;  1VQ6 P;  3BVH A;  3L70 G;  3CXC O;  2FAD A;  1L4A D;  4IOI H;  2FQ1 A;  2LTE A;  4UB6 H;  1SQV E;  2KLV A;  3AEG C;  2W6A A;  3A7O A;  1URQ D;  2QRX A;  1E0H A;  1JCD A;  1KMI Z;  2JU2 A;  3HE4 A;  3FX0 A;  5GTH E;  1LP1 B;  3CPW O;  2OTK E;  2L6E A;  1FE6 A;  2E75 D;  2WPR A;  4HB1 A;  5CBO A;  3TK1 A;  1RQU A;  2N1T A;  1EZV E;  1ZNV A;  1QX8 A;  2BAS A;  5EFW B;  5APX A;  3GG2 A;  4PD4 E;  3TYY A;  2Q6Q A;  3B5I A;  4D6T G;  2FY8 A;  1JJ2 O;  3HE4 B;  2YMY A;  3I5C A;  1NWQ A;  1JY3 O;  3A0H H;  3CCJ P;  1L4A C;  3S4R A;  2N1T B;  3M0D A;  1AJY A;  1NTK D;  1IC2 A;  2FQ2 A;  1G2C A;  2O01 H;  2K2Q A;  1RE4 A;  1M7L A;  1URQ C;  4NPE A;  2FFD A;  3G9R A;  2O1J A;  4ASV A;  1HF9 A;  2K0D X;  2ZT9 D;  3SFD C;  3NTE A;  1OXZ A;  1Q90 D;  2E75 C;  4WY4 A;  4XRQ A;  2HOD A;  1VQ9 P;  2YIU B;  1NTM G;  5KTB A;  1KIL A;  3AE2 C;  5M1B A;  2JBG A;  5BU5 A;  1IFJ A;  4H0L D;  2YKQ A;  5AVX B;  2C0W A;  3RG6 C;  4RES B;  1G2C B;  2Z5I A;  1PL5 A;  2R32 A;  5AW4 B;  3N4X A;  5KLV D;  2MF4 A;  2FFD B;  2OYI A;  4U3F J;  1FDO A;  3N7N A;  2IX7 C;  2WSE J;  4A7P A;  3TNU A;  2LIU A;  2ZYD A;  3L36 A;  2FQ0 A;  3E2D A;  4PH1 A;  4NPD A;  1VDF A;  1SQQ E;  1AA0 A;  2GZE A;  3E1R A;  1KIL B;  3EJD A;  3AEC C;  1KQF B;  4EDF A;  3V6I A;  5CCH A;  1U57 A;  2Z44 A;  1CSB A;  2M5A B;  1OMI A;  2ZT9 C;  1SQP K;  4K3A A;  2FYU K;  2OYI B;  2Z46 A;  5F2O A;  1ZW0 A;  5I4T G;  3CX5 E;  3TNU B;  1S5L H;  1YYC A;  1FZC C;  1BAJ A;  1S9K E;  4H0L C;  2B87 A;  5APQ A;  1GW4 A;  1KB9 D;  3BRT B;  4LLH A;  2BCC E;  3IN6 A;  2QM8 A;  4Y99 C;  3HE5 A;  4EI2 A;  2VRS A;  2PEQ A;  2A45 I;  3Q5R A;  4IL6 X;  3MUD A;  1P84 E;  2QG4 A;  2KSJ A;  4QKO A;  4OH8 B;  1EQ7 A;  3L72 D;  1TU3 F;  4KT0 J;  1NTZ E;  4GKG A;  2IDB A;  1SFC A;  4HKG A;  4U0A A;  2Q3I A;  4U7J A;  3L4F A;  1VQ7 P;  2B87 B;  3WUV A;  5AVV B;  2AF8 A;  2WMM A;  3CME P;  3EWK A;  2FXP A;  2O01 J;  1M6N A;  2PNG A;  1NKN A;  3HE5 B;  1NU1 G;  1SQP J;  3Q1M A;  1FJK A;  2B89 A;  2FYU J;  3DTJ A;  2WSF H;  1WMK A;  1YTZ I;  2QVA A;  1L0H A;  1FJP A;  3H1J D;  3S1K A;  4XRO A;  2PEI A;  4XA4 A;  2W8Z A;  2LXC B;  1SLQ A;  3PHL A;  4YTP C;  2N6Z A;  1SFC B;  1RE3 C;  2QE7 H;  1IFN A;  4XFJ A;  2H43 A;  3L74 J;  4I7Z B;  3M9B A;  3CWB J;  1HJB A;  3L75 E;  3H1K G;  4IFD K;  3JCU E;  5CCG A;  1SQV D;  1IUQ A;  2HG5 D;  3TGU G;  5TIS E;  5KP6 B;  1FDI A;  1VF5 D;  2KYV A;  1PPJ G;  1UNK A;  3RK3 B;  3TDK A;  4JPZ B;  3HD7 A;  3L70 E;  1SQX G;  1CW5 A;  1W2E A;  2W6J H;  3RL0 D;  3EJE A;  1NJI Q;  1Q86 Q;  1EOQ A;  2QSI A;  1HTL C;  4XFY A;  1RF1 C;  3GLM A;  4QNB A;  1K73 Q;  4PD4 D;  1EDJ A;  2CPB A;  1K8A Q;  3AE3 C;  2G8Y A;  3NFQ A;  2XZ1 C;  2ZFC A;  3HD7 B;  4HKZ H;  4YPC A;  3TSI A;  1BGY J;  3GMA A;  3USS A;  3AE8 C;  4Z1M H;  5KLI C;  3EQ2 A;  3IAO A;  5F2K A;  3MHV A;  1L0L E;  2PGD A;  1JMM A;  1NTK K;  3VYI A;  2CK3 H;  4D6T E;  3CI9 A;  1VF5 C;  5E79 E;  1KOR A;  2KOO A;  1U7J A;  4MN4 C;  5AVZ B;  1OX3 A;  1L0I A;  2KOQ A;  1GD2 E;  4JYB A;  3RL0 C;  1JY3 N;  4N78 D;  1T2K D;  3B5N A;  4DT0 A;  4BRY A;  3P8C D;  3VP9 A;  1ZLL A;  2EIA A;  2WSF J;  5GTI H;  2NPS D;  3H32 A;  1YBK A;  3CXH E;  3JC2 2;  5TJH A;  2KIK A;  4BPH A;  4UB8 H;  2L4B A;  2WSC H;  3AE6 C;  3GHG C;  3L73 G;  1KC8 Q;  1Z6M A;  1CEI A;  1H0T A;  4W80 A;  1MFZ A;  3B5N B;  4BRY B;  3H1H D;  2OYH A;  1A02 F;  3P8M C;  2PY8 A;  3D71 A;  2WWW A;  3H32 B;  2KG8 A;  4OVN F;  3CX5 D;  2JO0 A;  1T2K C;  5B5E H;  1NOH A;  3I55 P;  1OW8 A;  2E1M A;  1JEK A;  2KOS A;  3CC4 P;  1JUN A;  1H0T B;  2D2C B;  2KW2 A;  2QEX P;  2KUB A;  1NVO A;  1M8O B;  2K92 A;  5B66 E;  5H2F E;  1QRJ A;  2BCC D;  2QA4 P;  2HPC A;  1AYI A;  2FVF A;  2NPS C;  2OYH B;  1OZH A;  4IZ6 A;  3KYQ A;  2GUV A;  3O6Q A;  2WSS H;  2W6B A;  4LGD E;  3W67 A;  3CC2 P;  2E76 D;  4W7Z A;  1GZL A;  2ITA A;  3CE7 A;  3B8E B;  4PJ0 H;  3VOP A;  1PEO A;  1IMQ A;  2XND H;  2JU1 A;  2MKV A;  4H2Y C;  2A06 D;  1IK9 A;  2GZJ A;  3RK2 C;  4NEO A;  1FDM A;  5AW0 B;  2JGP A;  3L37 A;  2HLO A;  2KOG A;  5KAF E;  1ZR2 A;  3O6Q B;  1LTJ A;  3H1I J;  1X8Y A;  1LT9 C;  3ABV C;  4H44 B;  2KB7 P;  3H4E A;  2QJP B;  1DEB A;  4R4M A;  1NU1 E;  3DS1 A;  2Z5H A;  2Y9Z A;  1OFC X;  5DJU B;  3V4W A;  2E43 A;  3L75 D;  4U0D A;  2P2U A;  5BVZ A;  1SQV K;  4U3F G;  2W27 A;  2E76 C;  3AE4 C;  1JOC A;  4TLF A;  2WSC J;  1AFO A;  2JEE A;  1LTJ B;  2Y9Y A;  1UII A;  1GXG A;  1HVV A;  3L70 D;  3H1K E;  1ZME C;  1YTZ T;  4BPG A;  3TGU E;  2KG6 A;  3LID A;  1OW7 A;  5CHX A;  3A0B H;  2WPT A;  1PV3 A;  5AW9 B;  2OTL P;  1SQX E;  2CNR A;  4ZKP A;  3H1J J;  5APS A;  4BXL A;  3VMZ A;  3PTZ A;  3Q2Y A;  3D6Z A;  1T8K A;  2QJY B;  4OGQ D;  1GK4 A;  1Y47 A;  1YQ4 C;  4GOF A;  3MGN A;  2LR2 A;  1SQV J;  1GL2 A;  2P7J A;  4GOE A;  4DOJ A;  1VQK P;  2DNW A;  1EZV I;  2HYN A;  1AV1 A;  3OJA B;  1KFM A;  2FYN B;  1FZC A;  1VHN A;  5F2N A;  4TT3 H;  5C39 A;  2KOR A;  4L76 A;  1ZXG A;  1KIL E;  1QEX A;  1ZR4 A;  1L2P A;  2W83 C;  4ZMD A;  1BSN A;  2KGC A;  2CWO A;  2AXT H;  1SQP G;  1LTG C;  1GL2 B;  1KYO I;  3Q5S A;  1NTM D;  1VQL P;  5HGN A;  3AEB C;  1SQB J;  2XV5 A;  3LRY A;  1AVO A;  1FZC B;  4U0F A;  4OGQ C;  2N5I A;  4H0L B;  2ZVO B;  2K93 A;  3CWB G;  2KOD A;  4Y99 B;  2O01 N;  3FWL A;  3F5H A;  3KZI H;  1S4X A;  3G3Z A;  1L0L G;  1J1E C;  2Q7C A;  2CG5 B;  3L73 E;  1N7L A;  1M74 A;  1BE3 D;  3U1C A;  2JQ4 A;  1XTC C;  1JY2 N;  4YXW H;  4EYY Q;  5KJ7 D;  2N9Y B;  3RGU A;  2YKO A;  3LIE A;  3BAT A;  2E74 D;  4DG9 A;  1NGM B;  1PP9 G;  3NTN A;  4GT1 A;  3H6P A;  2A45 H;  4BPF A;  1KYO E;  3L71 J;  1D7M A;  3Q5P A;  3DS0 A;  3CL3 D;  2YO2 A;  1M57 D;  1W5C E;  3JCU H;  2Q3E A;  3VRL C;  5TIS H;  2VLO A;  3FXE A;  3CC7 P;  3CCU P;  1BGY G;  2Q9I A;  3CCE P;  1M90 Q;  1UIX A;  5CJ0 A;  1LGH B;  1DX7 A;  5AW6 B;  4IL6 E;  1DD3 A;  3CX5 I;  4L74 A;  4GDO A;  3H1H J;  1KD1 Q;  2KZI A;  2PRR A;  1RQV A;  1RF1 A;  3B71 A;  3W68 A;  2GA1 A;  2OTJ P;  1X0T A;  4HYT B;  2G3A A;  1LTS C;  2C9L Y;  5KJ7 C;  1ZP0 C;  3RK3 E;  1MV8 A;  5KAI E;  2LF4 A;  4WY4 B;  2E74 C;  2HOD B;  5EW5 E;  5HVC A;  1J1D C;  2J58 A;  1P84 I;  1VQP P;  1DD4 A;  2PP6 A;  3AE7 C;  1PZQ A;  3A5T A;  1VQ8 P;  3IR9 A;  1NU1 D;  3L35 A;  1GU5 A;  1FOS F;  2Y0C A;  2ONT A;  2BCC J;  3VP8 A;  1N73 C;  2EHS A;  1YI2 P;  5CMZ A;  4CA3 A;  1L0N G;  4QMA A;  1RF0 A;  1AQ5 A;  1ZV8 A;  2HR3 A;  2IBZ E;  1AF8 A;  1NO4 A;  5AVW B;  3VMA A;  2PEO A;  5KLI B;  1JY3 P;  3GKL C;  2QJK B;  1OVU A;  2N1T D;  3H1K D;  1W2B O;  3BCC G;  1OW6 A;  4U3F E;  1VQO P;  3ITK A;  1PEM A;  3I56 P;  2KI7 B;  1PPJ D;  3M9Q A;  3H1L G;  4F37 A;  1LJ2 A;  1PIX A;  1NYH A;  1SQX D;  2FVA A;  2JR8 A;  2SPZ A;  1DEE G;  1KQL A;  1NAF A;  3NXS A;  3U1A A;  1AQT A;  4COC A;  4PV1 B;  4WBA A;  1F80 D;  2E5Y A;  2ZYG A;  3G6E P;  1KQG B;  1M1J A;  3E1I A;  2YXR B;  5AW8 B;  3NMD A;  2ROQ A;  2KSE A;  4GR2 A;  2KWL A;  1IJD B;  1EXI A;  2AVA A;  3VMY A;  3WU2 H;  2N1T C;  1GMJ A;  3L70 J;  4OWF A;  2AEJ A;  1QLE D;  1KIL D;  1FR2 A;  1M1J B;  3DS3 A;  2NPS A;  1KV4 A;  2YNY A;  2WIT A;  2WZ7 A;  1BCC G;  3B4Q A;  3KHU A;  2P9X A;  3DS5 A;  3A0H E;  2YIU C;  3KDP B;  2GZG A;  1NTM K;  2IYP A;  3H1I G;  1N7S A;  3KXD A;  1GPJ A;  2M8L A;  3U43 A;  1HJ0 A;  2HFE D;  1GTW A;  2K37 A;  2R3S A;  1SQP E;  2ZAE B;  2ERH A;  2IFN A;  2EHT A;  1EZV D;  2H7H A;  2NPS B;  2FFD C;  3VMX A;  3OAK A;  5CCH D;  2GDY A;  5AW1 B;  1NQ4 A;  3HUS A;  1LT1 A;  2KP8 A;  3SWY A;  3L73 D;  1LT9 A;  5APY A;  1QL1 A;  1FOS E;  5HGO A;  2M8N A;  1N7S B;  3JSV C;  1KIL C;  3CWB E;  1HY8 A;  1HGZ A;  3CXH I;  1LWU A;  1KYO D;  2KK7 A;  3RK2 B;  2OYI C;  2OQQ A;  2RN0 A;  3HUS B;  2OAR A;  2NZ2 A;  2C0X A;  1NTM J;  4Y28 J;  1LT9 B;  2DW3 A;  3R2P A;  1PP9 E;  5APU A;  1DNY A;  1R5L A;  5AW5 B;  4C7R A;  5CCH C;  1IFM A;  1LTB C;  4M3L A;  2GM4 A;  4XFX A;  1LWU B;  3AEF C;  1M1K Q;  2XZR A;  2M8P A;  3HYB A;  1KB9 H;  2P67 A;  2XV6 A;  3AEA C;  3G4S P;  1VQ5 P;  2I1J A;  2BEQ D;  2J59 M;  2JJL A;  5KLV K;  2UWJ E;  1BGY E;  3C8V A;  1BE3 J;  2L91 A;  3WMM 0;  3RL0 g;  2WPV B;  2GZF A;  1JY2 O;  3RK3 D;  1MZ8 A;  1EDI A;  2V7Q H;  4IFM A;  2KGD A;  2WVR A;  3T97 A;  4ASW A;  1LTI C;  1ZMB A;  1SQQ D;  5AVY B;  1NU1 K;  3ZDM A;  2FKW B;  3U59 A;  4R0M A;  2KG9 A;  1NTK J;  2Y0D A;  2ZJS E;  1HQB A;  1VQN P;  3SWF A;  3G29 A;  1KQS O;  1K04 A;  5DCK A;  1SQB G;  2FAE A;  2N6Y A;  1OVV A;  2KS1 A;  2Q1K A;  3HD7 D;  3UIA A;  1MFT A;  2C9N Y;  3T97 B;  2IPP A;  2M5R A;  1L0N E;  1RH5 B;  1S9K D;  2LKM A;  2NRG A;  4WB4 A;  2B9B A;  2I1K A;  2M3B A;  4GIF A;  2VLP A;  2VSQ A;  3H0D A;  4AYC A;  4JF7 A;  3MP7 B;  1S1C X;  5KLV J;  3RK3 C;  3QWO C;  2L9F A;  3M06 A;  2PFX A;  1P84 D;  5KKZ C;  1SQX K;  2BEZ F;  1S5L X;  4XFZ A;  3BCC E;  1NTZ D;  4I2L C;  4U0B A;  4H13 B;  2YMK A;  5GTH H;  4EOT A;  3P05 A;  1RO2 A;  3L71 G;  1FZG A;  4C46 A;  1NU1 J;  2RH0 A;  3B4S A;  3H1L E;  4CPG A;  2HPC B;  1X3O A;  1OVR A;  3CMA P;  4PD4 H;  2H88 C;  3HD7 C;  3C9I A;  1IMP A;  7CEI A;  2AXC A;  4RJT A;  4OGQ B;  1MZ9 A;  3VTP C;  3V2Q A;  2IBZ G;  1L4A A;  5AVT B;  5AVR B;  1GW3 A;  3B5N D;  3H1K J;  3H1H G;  3E7K A;  1OWA A;  1URQ A;  3CCM P;  2K5X A;  1S3J A;  2LPK A;  1J1E B;  1N86 A;  3D70 A;  2QNW A;  2P10 A;  2WPQ A;  3AE5 C;  1NHL A;  1SQX J;  2V7Q J;  3L72 J;  2JB0 A;  2BUO A;  1HBW A;  1BCC E;  1L4A B;  2D2C D;  3MZW B;  4JBZ A;  1PGO A;  2KZJ A;  4GR6 A;  4R4L A;  3MD0 A;  3H1I E;  1URQ B;  1YJ9 P;  5KJ7 A;  2JYG A;  2MD9 A;  3KPE A;  1J2J B;  4GOD A;  2PEM A;  2E75 B;  1OIP A;  3M0A A;  4PXH B;  1N2D C;  4I6M C;  2XDJ A;  5GTI E;  2IFM A;  1HWT C;  1N73 A;  2QM7 A;  2VLQ A;  1L0L D;  2A06 G;  4XE5 B;  4UB8 E;  1PEQ A;  3A2A A;  1PFI A;  3CCS P;  4D6T D;  2VLN A;  4DJG A;  3QH9 A;  3GJN A;  1QL2 A;  1JMB A;  2M8R A;  1K05 A;  1E6J P;  5CBN A;  3SFE C;  1ZRT E;  2GYK A;  3DPH A;  3R4Y A;  1PP9 D;  5CZD B;  4H44 D;  3CX5 H;  2D2C C;  3WUU A;  2FHS C;  3NY7 B;  1LTT C;  1Q82 Q;  1G1I A;  1PGQ A;  3BRV B;  1IFD A;  2OYH C;  5BS1 A;  2E5T A;  3G71 P;  1N73 B;  2J5U A;  4HH2 A;  5B5E E;  2ZT9 B;  1LP1 A;  4B86 A;  2FYU G;  2L22 A;  1IO4 A;  1FZF A;  3FGA D;  3IF4 A;  2R44 A;  3CXH D;  1BGY D;  2JKV A;  1VL2 A;  3KQG A;  1FC2 C;  4UHP B;  4PH0 A;  1P84 H;  4H2X C;  1WT6 A;  2KGE A;  1HUC A;  1FU1 A;  2JO1 A;  1SQQ K;  2PEK A;  4RO0 A;  3L74 G;  4JYC A;  1VQ4 P;  2WPS A;  2RKL A;  2YO3 A;  2XXM A;  4PJ0 E;  4ZKU A;  4H44 C;  2QJP C;  1KN7 A;  1RE3 A;  2KXP B;  1UJZ A;  4IPY A;  4KHX A;  1ACP A;  1RO0 A;  4M0I A;  5K5G B;  4WWI A;  1L0N D;  1X9V A;  5BU8 B;  1H88 A;  2FAC A;  3CCV P;  5APV A;  1H8A A;  1SQB E;  2KLU A;  1BSH A;  3V2N A;  5KP7 B;  1LTJ C;  3EFF K;  4RKU J;  1EMV A;  2XT1 A;  2ZXE B;  3BCC D;  1NTZ K;  1S72 P;  3M9H A;  1QGK B;  2O1K A;  2IBZ I;  1SQQ J;  2FXM A;  2JP3 A;  2R5B A;  2N9B A;  1FAV A;  1FZA A;  3AE1 C;  2KNC A;  3DS2 A;  3H1L D;  1USE A;  3G26 A;  1LTA C;  2RMZ A;  1GL2 D;  3K5B A;  3LW5 H;  2E42 A;  1K9M Q;  4N78 E;  5CJ4 A;  3GF7 A;  1PEU A;  1A43 A;  4N6J A;  2MR7 A;  3L71 E;  1OR5 A;  3P8C E;  1M6E X;  3EJB A;  2QJY C;  3MGE A;  1E5W A;  1Y8A A;  3A0B E;  1XTG B;  1T6A A;  4DZO A;  2M5A A;  1H89 A;  5JPA A;  2V4H A;  2N50 A;  2KNC B;  1RF1 B;  1E79 H;  2FYN C;  1BE3 G;  5E79 H;  2K9J A;  2OGU A;  2P1J A;  4EIJ A;  3SWK A;  2WTY A;  3H1H E;  1YIT P;  3V5B A;  1NTZ J;  1K30 A;  4BWN A;  2N98 A;  5BS2 A;  1BCC D;  2M3E A;  4K35 A;  4C7N A;  1NTK G;  4JQ0 D;  3TGU D;  1GL2 C;  4KJM A;  1VF5 B;  3H1I D;  3DS4 A;  3F89 A;  5EJD A;  2GDX A;  4NPF X;  2PAJ A;  3HRN A;  2K9J B;  2JAZ A;  3GHG A;  3CXH H;  3RL0 B;  1FBM A;  3P32 A;  2L5G B;  1FS0 E;  2H8P D;  1DV5 A;  2AXT E;  3CCQ P;  1GDT A;  4UB6 E;  2FYZ A;  2XZ0 D;  2LML A;  5HGM A;  2JWA A;  4C7N B;  1L0L K;  3D6Y A;  4DCK A;  3L75 J;  5KLV G;  2GDW A;  4WVZ A;  1NAY A;  3P7K A;  3PP5 A;  1MKM A;  2YXQ B;  1S2E A;  3RG2 A;  1ZRT D;  3GHG B;  4WY4 D;  1R5S A;  2IYO A;  2EFJ A;  2A06 E;  3KZI E;  4W7Y A;  3G0V A;  2K3R A;  2WT7 A;  3PRJ A;  1EC5 A;  2LIW A;  1JNM A;  5B66 H;  5H2F H;  3LW5 J;  3II6 A;  2MR8 A;  2IZ0 A;  3AEE C;  1G1J A;  5HGL A;  2K94 A;  1N8R Q;  3M0D C;  4N3Y B;  3CD6 P;  1YJW P;  2FYU E;  2WT7 B;  1L0L J;  1RE4 C;  1A8O A;  1R8E A;  2ZVN B;  5APW A;  1YHQ P;  1VPC A;  1JB0 J;  3PLN A;  1D1D A;  2FBW C;  2WQY C;  4D6T J;  2KOP A;  5HV8 A;  4WY4 C;  2L0Q A;  2PEN A;  4ZNC A;  5KKZ B;  3L72 G;  2IZ1 A;  3OA7 A;  2N5H A;  3PH0 A;  1HH0 A;  5AVQ B;  5AW2 B;  5KAF H;  1PP9 J;  4PV1 D;  3L74 E;  3RBX A;  4MRT C;  1HGV A;  1VQM P;  3V2P A;  1QVG O;  3CCL P;  2Q5U A;  3LMO A;  2PEJ A;  2YKP A;  3V2R A;  1L0N K;  2P58 A;  3CLQ A;  1JM0 A;  5APT A;  1M56 D;  2MY5 A;  1SQB D;  3S9O A;  2AEM A;  2R5D A;  2EG5 A;  1KLP A;  2CPS A;  2KR5 A;  2DGY A;  3H1J G;  2OYO A;  1JCC A;  2QJK C;  3MTU E;  1IZN B;  3OW2 O;  1SFC D;  1EXJ A;  2AEF A;  4L75 A;  3BAS A;  2CQ8 A;  1S5L E;  1RF0 C;  1SQV G;  1KTM A;  1RNI A;  2E76 B;  2LXB A;  4PV1 C;  5AW7 B;  1Q7Y Q;  2K9Y A;  2MJZ A;  1SVF A;  3L71 D;  3H47 A;  3FXD A;  1PGP A;  3AE9 C;  3GZM A;  2XU6 A;  1GK6 A;  1EZV G;  2ZXX A;  1RY3 A;  1L0N J;  2K88 A;  3GZL A;  1NTM E; 
#chains in the Genus database with same CATH homology
 1YIT P;  1YJW P;  1VQ6 P;  1YJ9 P;  3RG6 C;  1K30 A;  2JYG A;  1PEO A;  4COC A;  3CXC O;  1A8O A;  3VRL C;  5BS2 A;  3H0D A;  1YHQ P;  4XRO A;  2PEI A;  3G6E P;  2PEM A;  1VQK P;  3CC7 P;  1D1D A;  4IPY A;  3CCU P;  3G1I A;  1RO0 A;  4M0I A;  2PEN A;  3CCE P;  3DS4 A;  1M90 Q;  4GR2 A;  3E2D A;  5F2N A;  2OAR A;  3CCV P;  4PH1 A;  4XFZ A;  2EIA A;  1KD1 Q;  3CPW O;  4U0B A;  2L6E A;  3P05 A;  1PEQ A;  1VQM P;  4U0C A;  1IUQ A;  1RO2 A;  1QVG O;  2OTJ P;  3H4E A;  3CCL P;  2CWO A;  2Z44 A;  2PEJ A;  3CCQ P;  3CCS P;  3Q20 A;  2XT1 A;  2BHV A;  1KC8 Q;  3DS1 A;  4XFX A;  1M1K Q;  1E6J P;  5HGM A;  2Z46 A;  4COP A;  2M8P A;  3HYB A;  2LF4 A;  4U0E A;  5F2O A;  1S72 P;  3DPH A;  5I4T G;  1VQL P;  2XV6 A;  3CMA P;  4U0D A;  5HGN A;  2EG5 A;  3DS3 A;  3G4S P;  3WBH A;  1VQ5 P;  2DGY A;  3B5I A;  1VQP P;  1Q81 Q;  3LRY A;  4U0F A;  1Q82 Q;  1JJ2 O;  1NJI Q;  3DS2 A;  1BAJ A;  1VQ8 P;  2PY8 A;  3G26 A;  5BS1 A;  1Q86 Q;  2ONT A;  3G71 P;  2P9X A;  1EOQ A;  3DS5 A;  3OW2 O;  1YI2 P;  4XFY A;  1K9M Q;  2EFJ A;  3CCJ P;  2KOD A;  4QNB A;  1K73 Q;  2JO0 A;  2M8L A;  3I55 P;  1PEU A;  1A43 A;  2PEQ A;  2E1M A;  1ZMB A;  3G0V A;  3CCM P;  4WYM A;  1M6E X;  1K8A Q;  3G1G A;  3MGE A;  3CC4 P;  3HZQ A;  3G21 A;  1M74 A;  1RNI A;  4PH0 A;  2QEX P;  2JYL A;  2PEO A;  2BQ1 E;  3CCR P;  1QRJ A;  2QA4 P;  5JPA A;  5F2K A;  1VQN P;  1Q7Y Q;  3G29 A;  1YJN P;  3NTE A;  2OTL P;  1KQS O;  1W2B O;  2BUO A;  5DCK A;  4XRQ A;  3M1M A;  3G28 A;  1VQ9 P;  4U0A A;  2Z45 A;  2PEK A;  1VQO P;  3H47 A;  1VQ7 P;  1PEM A;  1VQ4 P;  3CME P;  3I56 P;  1EIA A;  1QVF O;  3DS0 A;  3CC2 P;  1M6N A;  5HGO A;  2M8N A;  1YIJ P;  4GR6 A;  5HGL A;  1N8R Q;  2XXM A;  1AUM A;  3CD6 P;  3DTJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...