1K73Q

Co-crystal structure of anisomycin bound to the 50s ribosomal subunit
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAKGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Five Antibiotics Bound at the Peptidyl Transferase Center of the Large Ribosomal Subunit
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S RRNA
total genus 47
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2001-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1k73Q02
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1k73Q01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1k73Q03
3CCSP 1VQOP 1QVFO 1VQ9P 1YJWP 1NJIQ 1Q82Q 3CCMP 1YI2P 1Q7YQ 1QVGO 1VQ4P 1YITP 3CXCO 3G71P 3CCVP 1W2BO 1K8AQ 1K73Q 3CCQP 1VQLP 3CD6P 1VQNP 3CC7P 1YJ9P 3CCLP 2OTLP 3CCUP 1M90Q 1VQ6P 3CMEP 2QA4P 3CC4P 3I56P 3CCRP 1KD1Q 3CMAP 1VQ7P 3G6EP 1VQ8P 3CPWO 1VQ5P 1N8RQ 1KC8Q 1K9MQ 1YIJP 1JJ2O 3CCEP 1YJNP 3I55P 1YHQP 3G4SP 1VQPP 1KQSO 3OW2O 2QEXP 1S72P 1VQKP 3CCJP 1Q81Q 1Q86Q 1M1KQ 2OTJP 3CC2P 1VQMP
chains in the Genus database with same CATH superfamily
3CCSP 3MTUE 2NPSA 2QG4A 2FYUK 3USSA 1MKMA 3B8EB 5H2FH 1DV5A 5AVWB 3PJSK 1PGJA 5CMZA 5TISE 1P84I 1X22A 1SS1A 2HR3A 5KKZB 2PFXA 1R8EA 2PEQA 2KXPB 3GKLC 3G0VA 2XV5A 3P8MC 2E74D 4JF7A 3OA7A 1URQC 4N78D 1UJZA 3BRVB 5APVA 2WPSA 5DJTB 1FZFA 4R4LA 4W7YA 3MP7B 1JB0J 3S1KA 1FZEA 3H1KJ 4A7PA 3L75D 3EQ2A 2FFDB 1JCDA 2N5HA 4RJTA 2BHVA 3EJDA 2FYZA 1BE3J 1EOQA 3TK1A 2C9NY 1YI2P 1KILB 5CJ0A 5EW5E 2Z44A 3L73J 2KWLA 1OXZA 1SP4A 3OJAB 1SQPD 3TF5A 4JQ0D 2SPZA 2YIUC 1EDJA 1L0ND 1J1DC 3MGNA 1IFMA 1KILA 2KNCB 4L75A 2Y9YA 2GUVA 3HUSB 2K3RA 3IR9A 2E42A 3H0DA 3P8CD 1GW4A 2Y9ZA 1KZUB 2OTKE 4C46A 2N9BA 5KLVE 3A0HH 2M8PA 1RO2A 1W5CE 5BU8B 1WT6A 3GHGB 3GW6A 2M5AA 1M6NA 2LKMA 3CD6P 4OH8B 1L4AB 1VQ6P 1PIXA 2JU2A 2Q9IA 1GXGA 3RK2C 1RH5B 5KAFH 4O9BA 3L74D 3AE9C 1NTKE 3L70G 1BAJA 1K04A 3VTPC 4PV1C 1USEA 3V4QA 1SFCB 2L22A 1PP9J 1MZ9A 2ZT9D 4HJGH 2W27A 2CK3H 4IL6X 2FBWC 1T8KA 1RY3A 4I6MC 3PRJA 2JDIH 1NH4A 3L4FA 5KAFE 1SQXD 3E1RA 1CEIA 1Q2NA 2FQ0A 2HFED 3GZLA 1Q7YQ 4H0LC 5CCHC 2R3SA 5APTA 2CPBA 3I56P 1M1JB 2YO3A 2O1JA 2JGPA 2KB7P 2B89A 3WBHA 2E1MA 2A45H 5APWA 2XNXA 3R2PA 2Z4EA 2JWDA 4H44D 2NO8A 1E5WA 2K0YA 5CCGC 1SQPE 5AW9B 2ZT9B 2K9JB 4ASVA 1M8OB 3IAOA 3B5ND 2MF4A 3A2AA 1SQXJ 3Q5PA 4XFZA 1KTMA 2YKOA 1LTJB 1MZ8A 3I5CA 4GIFA 3Q5RA 3P8CE 2IFMA 4OGQD 2A06E 4KHXA 4EYYQ 4TT3H 1JTHA 2MY5A 1Z56A 1RE3A 4UB6E 4GR2A 1FAVA 1MV8A 1HBWA 1YYCA 1CI6B 3P7KA 2KORA 3WU2E 1EZVI 3RL0D 5C39A 2E75C 1J1EC 1H89A 4U7JA 1GK6A 1G1JA 2IPPA 1S2EA 2N1TB 3WUVA 2GM4A 1NYHA 3RK3E 5GTHH 3QH9A 1N2DC 1SQXE 1WMKA 1GZLA 3M0AA 3H4EA 2H43A 1H0TB 1CSBA 4CA3A 2BCCJ 2QA4P 2ROQA 4N78E 1M7LA 2E76B 1BCCE 2K9YA 3CX5I 4EI2A 2OYIA 1PL5A 3AEBC 1J1DB 4L73A 3RL0B 3DS2A 3NXSA 4R4MA 1DD4A 2V7QH 2RH0A 2WMMA 1W2BO 2XZRA 3HUSC 2CWOA 1EQ7A 5AVQB 1GXHA 1OVVA 2Z5HA 1KC8Q 2BEQD 2FXOA 1NVOA 5AVZB 1LT9A 1N7SD 2WSCJ 1X3OA 3T97A 3P32A 3E1IA 1SQVK 3MZWB 2KSEA 3BCCE 3GHGA 1L4AD 1M74A 4JYBA 2IBZG 3Q1MA 1VDFA 2KGEA 1L4AC 1BE3D 1HVVA 3CXHD 1KV4A 1LWUB 3L72J 3II6A 3CCEP 2POHA 4LC1A 5HGLA 3L75G 1PEMA 1HUCA 5HV8A 3FX0A 1VQMP 1L0NE 2W90A 2WTYA 3H1IG 1QGKB 3AE1C 3W67A 2KW2A 3CCVP 1M90Q 5DJUB 3V2NA 2AFEA 2I1JA 1R5SA 1HF9A 1N7SB 4XFYA 2NPSC 1A43A 2D2CB 3H1IE 2E5YA 2XZ1C 2N98A 5AW3B 4H2WC 2EHSA 2KGCA 5CCHD 2KOOA 1M1JC 1IC2A 4GDOA 1P84E 1NTZD 1AYIA 2PNGA 1OW7A 3V2PA 4I7ZB 4H13B 2W6BA 1EDKA 2GZEA 2K1AA 2E75D 1QRJA 1BSNA 3L75J 3VP8A 3CE7A 4DOJA 3AEDC 1A02F 1FJKA 1JOCA 2LOLA 2FACA 1VQPP 2H8PD 1CI6A 1P84H 2P58A 1YTZI 3V2RA 2VLPA 1KMIZ 2WT7A 3A3YB 4XROA 1EDLA 4H44C 3CCQP 3CCLP 3IN6A 1LTBC 1YQ4C 1ZV8A 2K0XA 1AJYA 2GDWA 1QL2A 2QJYB 3HTKA 2BUOA 1KYOD 3L74G 2N5IA 3H1JG 4COCA 3EJEA 2XXMA 2E75B 3JSVC 1JY2P 1IUQA 4GR6A 3LW5J 3M0DA 3WU2H 2LR2A 1ZMEC 3M0DC 2JYLA 3IF4A 2VRSA 3MUDC 2LXCB 3PP5A 1T3JA 1JO5A 2NPSD 3BCCD 1GW3A 1FS0E 5KLVG 1SQVD 5KLIC 1PPJG 3VN0A 3H1HJ 1PPJE 2R5BA 1VQ5P 3U43A 1EC5A 2H89C 2ZYDA 2GDXA 1S5LX 2A45G 2XNDH 3D70A 1EXJA 2HPCA 3H32A 2E5TA 1NAFA 3MGEA 2QJKC 1NTKD 3TGUG 4H0LD 1YJ9P 2P9XA 3L74E 1FJPA 2WSFJ 5AVVB 2WSSH 1FOSF 1EZVD 1NTZG 4ZNCA 1H0TA 4CPGA 3G3ZA 2M3BA 1OMIA 2ZVNB 1X8YA 4YXWH 2AXTE 2EHTA 3BATA 2KP8A 4DT0A 1SQQJ 1IO4A 5BU5A 1L0HA 3P05A 1GK4A 1A8OA 3TGUD 3H1LJ 5AVRB 2K94A 3JCUE 3RBXA 1BSHA 1FZCB 1JM0A 2I1KA 2R32A 4I2LC 2DW3A 1IMPA 1SFCC 2QM7A 1U57A 2K2QA 1KQGB 3LIEA 4WVZA 3HE4A 2KZIA 4XA4A 3EJBA 1VF5B 1ZLLA 1NTMD 3F89A 2D2CD 2RN0A 4PD4D 2QEXP 1FZAA 1KB9D 2KGAA 1PGQA 2IBZE 1AV1A 1SQQD 1HQBA 3H1LG 2AEMA 2HPCB 1BXIA 2H88C 2KGDA 3KQGA 2E76D 1LTJA 2JEEA 3KZIH 4DZOA 1ZRTD 2ONTA 2WITA 3G6EP 3VMAA 2IDBA 2WZ7A 2WPTA 4JYCA 3Q2YA 3SFEC 3L72D 3BCCG 1OX3A 3C1LA 2OYOA 1AVOA 3O8ZA 3T97B 1HY8A 2PEKA 3PH0A 3H47A 3K5BA 2JJLA 2KUBA 1BE3G 1DEBA 1NU1G 2WQYC 1L0LK 3KXDA 3KZIE 1FZCA 1L0NG 1SVFA 3L71D 2GZJA 1ZR2A 7CEIA 2IZ0A 3S9OA 1NTMK 1RE4C 4XRQA 4XFXA 2LL8A 3CCUP 1DD3A 4QNBA 2GYKA 3BVHA 2KG6A 4PJ0H 2GZFA 1NTZK 2B88A 3LIDA 4ZMDA 5KJ7A 1BGYD 4NPDA 1L0NJ 5E79E 3GJNA 1Q82Q 2FYUD 4PH1A 3V5BA 3CL3D 4UHPB 5B5EE 2E43A 1SQXK 2O01N 5F2OA 3L70E 1Y47A 2PEIA 2Z45A 2CG5B 2M8NA 2J5UA 3L36A 4UB8E 4GODA 5BS2A 2PP6A 1QVFO 3L71J 2FVFA 3E7KA 4W80A 5HGOA 2QSIA 1UIXA 3GLMA 2N50A 5KLIB 4PWVB 2K37A 3KHUA 3CMEP 2MD9A 5CZDB 4NPEA 2QVAA 2P1JA 3U1AA 1MFTA 1MUUA 2FYNB 2M5RA 1AUMA 4U0FA 1S3JA 4ZKUA 1YQ3C 4AQRD 3AECC 1ZNVA 3G1GA 1G2CA 2NZ2A 4BPHA 2HLOA 4H0LB 3VMYA 5AW2B 1E0HA 3HUSA 3MIWA 1LP1A 1NTKG 2LTEA 3CWBE 5KJ7D 3L70J 1VKUA 3D6ZA 1H8AA 3H1JE 4TLFA 1VQ9P 4D6TE 5AW4B 1X0TA 2K93A 5AVTB 1LWUC 3H1HE 3AE2C 1LTJC 3PLNA 3HD7A 1L0NK 3CLQA 4U0EA 1JMMA 3GMAA 3OW2O 3RL0g 1IK7A 5M1BA 2VSQA 4HH2A 4IPYA 2EG5A 3WUTA 1KFMA 3V6IA 1NU1E 1NTZJ 1NTMG 2YXRB 2P67A 1YBKA 3G1IA 4EIJA 3L70D 4DG9A 2PEOA 4JBZA 2NPSB 2L0QA 3DS5A 2WPVB 3RL0C 2FYUG 2OYIB 3HZQA 3LMOA 2OTLP 4HB1A 3W68A 3NTEA 2IYOA 2LIUA 1SQXG 1L0LD 4MN4C 1SQBE 2C9LY 1L4AA 4I1LA 5AW0B 1GD2E 3H1KG 1RF1C 1URQA 2L5GB 3MD0A 3G26A 1GL2C 3PHLA 5APSA 2B9BA 3QWOC 2Q7CA 1Z6MA 1EXIA 1TU3F 1K8AQ 3B4SA 4IOIH 5KP6B 2YMYA 1KD1Q 1N73C 3M9BA 4WY4C 4EDFA 2AXCA 2MR8A 4H2YC 2KOQA 4HYTB 3AE5C 2OTJP 4U0DA 2O1KA 4M0IA 3CWBG 1PP9E 1NU1D 1NTMJ 2DNWA 2ZXEB 1FR2A 2YKPA 3SFDC 3VOPA 4GOFA 3HD7C 1N86A 2M8RA 1T8ZA 3H1LE 2XDJA 3H1HD 4H13D 3L35A 2KNCA 1GTWA 2YXQB 4PD4I 4NEOA 1T2KC 5BVZA 1MFZA 3A0BH 2IBZD 3EWKA 1S4XA 1SQQK 3CWBD 4PJ0E 1NKNA 3VP9A 2Q5UA 1ZN5A 3Q3DA 1EDIA 2FHSC 1JNMA 3CX5H 4OVNF 5EJDA 4ASWA 3DS3A 1NAYA 3RK3B 3L72G 4U3FD 2L6EA 3N4XA 3CI9A 2Q1KA 4BRYA 2PY8A 1T3UA 1YTZT 2KOPA 5K5GB 4Y28J 2JWAA 2KI7B 3G9RA 1VPCA 1JY2O 2MVVA 4U0AA 3O6QA 2KYVA 1NTKK 3H6PA 2D2CC 1Q86Q 4BRYB 2Q3EA 4BPGA 3CWBJ 3D6YA 4IFDK 2FVAA 2GA1A 2QJKB 2IX7C 1M56D 1GL2D 3KPEA 2FAEA 3LRYA 2V4HA 1KQFB 3GF7A 1DIPA 2GZIA 2KS1A 4KT0J 1KB9I 1VQKP 5AW7B 2Z46A 3RK2D 1AQTA 1NOHA 3MUDA 2AEJA 2QE7H 3H1KE 1T2KD 2FVEA 1QLED 1JMBA 2ZAEB 1SQBK 3GZMA 2QRXA 1U7MA 4EOTA 3Q20A 3M06A 5AVSB 1L0IA 1M57D 4YPCA 1F80D 1YJWP 1SQPK 1KYOH 1JUNA 1D1DA 2MJZA 1XTCC 2JB0A 3CCRP 3CPWO 5DCKA 2IFNA 2M8LA 1QEXA 2KLVA 1RF0C 1YJNP 2HODB 1KYOI 5AW5B 5GTHE 3DS1A 2W6JH 4OWFA 1DNYA 3HE5A 3NMDA 1GMJA 1LJ2A 2XKMA 1KYOE 1ZOYC 1AA0A 2L4BA 5CCHA 3FXEA 1VQ8P 2LIWA 3VMZA 2AF8A 4C7RA 3TSIA 4JPZB 4DCKA 3M9QA 1E6JP 5HGNA 3DS4A 1L0LE 5APUA 1E79H 1VF5D 1S5LE 1KB9E 3H1KD 3CC4P 2E74C 1EIAA 3ITKA 3U59A 2R3CA 3M91A 4OGQC 2KOSA 1JEKA 2PEJA 1KILE 1PFIA 2CGQA 3EFGA 3EFFK 3H1JJ 3M9HA 2BCCE 2HG5D 3G71P 4D6TG 4IFFA 3CC7P 5AVXB 3RG6C 5AVUB 2CPSA 3NY7B 1BCCJ 2ERHA 5I4TG 1VF5C 1YIJP 4WYMA 2QJPC 2JKVA 1EZVG 4PXHB 4YTPC 3CC2P 4LGDE 3HYBA 5KLVJ 1BDDA 2O3JA 1NJIQ 1NQ4A 2X2BA 3H1ID 3B71A 1LT9C 2QNWA 3MHVA 1IK9A 2ZXXA 4D6TD 5GTIH 1SQBG 1AQ5A 4N3YB 1GU4A 2AEFA 3H1JD 4U3FE 1IZNB 2EIAA 1FZBA 1LTTC 5CJ4A 1FZCC 3A0BE 1Q81Q 2WPQA 1RHZB 1S1CX 2B87B 1D7MA 5JPAA 1AFOA 1VQLP 1IMQA 3CX5E 4U0CA 4BPFA 1VHNA 2KG8A 1OW6A 4WY4D 1FU1A 5APXA 4MRTC 3L37A 1ACPA 3RGUA 2J58A 3H1LD 2JU1A 2K9JA 1NKZB 2WPRA 4D6TJ 2LKIA 2UWJE 3GG2A 1KN7A 1VQ7P 1X9VA 5E79H 5AVYB 2L9FA 2J59M 1IFNA 1PP9D 3H1IJ 1FZGA 1FBMA 3HRNA 5AW6B 5KKZC 3L73D 4COPA 1UNKA 1OVRA 4PH0A 4L74A 5EFWB 2QM8A 2PENA 1S9KE 3L73E 2A06G 3SWFA 4U3FJ 4UB8H 3BCCJ 1SQVJ 1JCCA 2FY8A 2KS1B 3OAKA 2LMLA 2V7QJ 3I55P 1T6AA 2CNRA 2KG9A 5BS1A 2OYHB 1PV3A 5APQA 3C9IA 2G3AA 1NWQA 2H7HA 3L73G 1ZR4A 1Y8AA 2XT1A 2N1TA 2WSCH 3V4WA 3H25A 2BASA 1RNIA 4BXLA 5CCGA 1VL2A 3AE7C 2YIUB 3RK3D 3RBZA 5H2FE 3CX5D 3AEEC 2JQ4A 3CCJP 5L8RJ 3L71E 2FXPA 3Q5SA 1FC2C 2GZGA 1HJBA 2JO0A 2XV6A 1LT1A 1OIPA 3SWKA 2IYPA 1LP1B 2OGUA 1J2JB 1DH3A 1DEEG 2YKQA 2O01H 3L72E 3RG2A 2RKLA 5TJHA 4AYCA 2KR5A 1GL2A 2AVAA 5HVCA 1GL2B 1OVUA 1KILC 3L71G 2JP3A 3A7OA 3CXHI 2FXMA 3M1MA 4NPFX 1N73A 1N73B 3KDPB 2E74B 2FYNC 3B5NC 1FE6A 3RK2B 3HE4B 2KLUA 2RMZA 1GU5A 4Y99B 2BCCD 3SSUA 3FGAD 4PV1B 1M6EX 1QVGO 2K5XA 3CXCO 1G2CB 2DGYA 2O01J 3PTZA 4R0MA 3WUUA 1KLPA 2AXTH 2FYUE 2G8YA 2L91A 2P7JA 3U1CA 4QMAA 4K35A 1CZQA 1SQBD 2OYHA 3JCUH 4M3LA 2OYIC 1KORA 1URQB 2YMKA 4U0BA 1ZW0A 1ZP0C 1OW8A 4HKZH 1JY3P 4IZ6A 3B4QA 1S9KD 2FFDC 3BASA 3B5NA 1OFCX 2WSEJ 3H32B 5GTIE 3VYIA 2W6AA 2FQ2A 5CBOA 1CW5A 4XE5B 1BGYJ 2M0BA 3TNUB 5KAIE 1SQBJ 4WY4B 4PD4H 4F37A 1H88A 2YNYA 1BGYE 1BDCA 1HH0A 5KP7B 2YO2A 3LW5H 4XFJA 2OQQA 2M5AB 2JO1A 1IFIA 5KLVD 1SFCD 2WWWA 3HD7B 5HGMA 1SQVE 2WSEH 1LTIC 2JAZA 1RQUA 5KAIH 1RF1B 2GDYA 4PD4E 3SWYA 1BGYG 2ZYAA 2ZJSE 2Z5IA 5KLVK 2OARA 4YXDC 1RE4A 1IFPA 1FDOA 3DS0A 2QIWA 1K30A 1HGVA 1QX8A 2K88A 3CXHH 4IL6E 5KP8B 3S4RA 1PZQA 1RO0A 2CQ8A 2OYHC 2A06D 2IZ1A 2FADA 2BCCG 1LTSC 1X79B 2A45I 2BQ1E 3FXDA 2WSFH 4GOEA 4WB4A 1OR5A 4RKUJ 1NU1K 3BRTB 1K9MQ 5F2NA 5B5EH 2AFDA 2FFDA 4U3FG 1GPJA 1SQVG 2PGDA 1NTME 3AEGC 2ZVOB 2W83C 4L76A 2W8ZA 2KOGA 3CCMP 1PEUA 3AE3C 2KZJA 1KFNA 4H2XC 1KILD 5APYA 3TNUA 1PEOA 3NTNA 2MKVA 1QL1A 2LPKA 2FKWB 3WMM0 2PRRA 1AF8A 3RK3C 2ZYGA 3TGUE 1YITP 1HWTC 2XZ0D 1SQQG 1N7SA 1SFCA 2GUSA 1BCCG 1W2EA 4C7NA 1PGOA 2EFJA 2BEZF 1FDMA 2HYNA 4RO0A 4Y99C 2ITAA 1SQPJ 1L0LJ 4IFMA 1FDIA 1K73Q 4K3AA 5KTBA 1UIIA 3A5TA 3F5HA 3B5IA 3NFQA 1LWUA 3HE5B 5AW8B 5KJ7C 1RQVA 3UIAA 2LXBA 1KQSO 1NTKJ 2WVRA 1G1IA 2HODA 2P2UA 4KJMA 2JYGA 1ZRTE 1J1EB 1VQNP 3IFMA 2ZFCA 3C8VA 1LT9B 2N1TC 2N6YA 2PEMA 1L0LG 1U7JA 1SQQE 3TYYA 4ZKPA 3ABVC 2KIKA 1S5LH 1KB9H 1S72P 2JBGA 3FWNA 2XU6A 1NHLA 3D71A 1GDTA 2WT7B 1PP9G 5B66H 4QKOA 2IBZI 1LTAC 1NU1J 3L74J 4DJGA 1ZXGA 4WWIA 2E76C 1N8RQ 1XTGB 3VRLC 3AE6C 1IJDB 1YHQP 4LLHA 2Q6QA 4RESB 2I8DA 2VLNA 2Y0DA 3V2QA 1NTZE 2K0DX 1P84D 3G21A 3AEFC 2K92A 3VMXA 3G28A 1SQPG 1FOSE 2JR8A 1JY2N 4H44B 1Q90D 3A0HE 3DTJA 2VLOA 2NRGA 4GKGA 5F2KA 4W7ZA 2M3EA 1ZMBA 2PAJA 3L75E 3CMAP 4BWNA 5B66E 3ZDMA 1JJ2O 1PEQA 4Z1MH 3H1HG 4PV1D 1LNQA 4I7ZC 1EZVE 2QJYC 1RF0A 2P10A 3GHGC 3O6QB 5CBNA 3R4YA 1HJ0A 3AEAC 2MVUA 1Y9BA 4GT1A 3DPHA 2FQ1A 4OGQB 1JY3N 1JTHB 3AE8C 1N7LA 1R5LA 4B86A 1A02J 4WBAA 1L2PA 2R5DA 1M1KQ 1OZHA 1URQD 1LGHB 3G29A 3CXHE 4IL6H 4AUWA 1PPJD 3GF3A 1NO4A 5CCGD 2VLQA 2QJPB 1AVYA 2N1TD 3TDKA 2KSJA 2LF4A 1N7SC 2C0WA 2C0XA 2Y0CA 4HKGA 1HTLC 1IFDA 3FWLA 1SLQA 1EMVA 2N6ZA 1USDA 1HGZA 3N7NA 3TGUJ 2Y0EA 2Q3IA 4N6JA 1LTGC 3AE4C 2KODA 1PGPA 5CHXA 1RF1A 1M1JA 5AW1B 2MR7A 1NGMB 1RE3C 1BCCD 2B87A 1VQOP 1K05A 4H13C 1VQ4P 1JY3O 2R44A 2ZT9C 3KYQA 2N9YB 1OWAA 3HD7D 3HTKB 1BE3E 1DX7A 3JC22 1WRGA 5TISH 3E2DA 2FYUJ 3B5NB 2KK7A 1IFJA 3G4SP 4WY4A 4C7NB 1KQLA 4UB6H
chains in the Genus database with same CATH topology
4XROA 3CCSP 4M0IA 4PH0A 1VQ9P 1M6EX 1M6NA 2OARA 1QVGO 3CXCO 2PENA 3G71P 1M74A 4XRQA 3CCQP 1K73Q 2DGYA 4XFXA 3CD6P 3CC7P 3CCLP 3RG6C 3CCUP 1VQ6P 3B5IA 4QNBA 3DPHA 3DS0A 1K30A 3P05A 5I4TG 1A8OA 1YIJP 4WYMA 3Q20A 4GR2A 3CCEP 3I55P 4U0EA 1RO0A 5HGLA 5BS1A 1KQSO 3OW2O 1PEMA 1M1KQ 2BUOA 1BAJA 3CC2P 1VQMP 1YJWP 3HYBA 4IPYA 2BQ1E 2EG5A 2PEQA 1NJIQ 1Q82Q 3G0VA 4COCA 1D1DA 3G29A 2XXMA 2JYGA 2XT1A 3CCVP 4PH1A 3G1IA 1VQNP 1M90Q 1RNIA 1IUQA 4U0BA 3CCRP 4GR6A 3CPWO 5DCKA 2PEMA 5F2OA 2M8LA 1K9MQ 5F2NA 2PEOA 1YJNP 2PEIA 2JYLA 2Z45A 2LF4A 4XFYA 2EIAA 3DS3A 1A43A 2QEXP 1S72P 2M8NA 3CCJP 1Q81Q 3DS5A 2BHVA 3DS1A 5BS2A 1QVFO 2L6EA 3H4EA 1EOQA 5HGOA 5JPAA 3CCMP 1YI2P 1Q7YQ 3HZQA 2Z44A 1PEUA 2PY8A 1VQLP 2OTLP 3CMEP 2JO0A 2QA4P 3I56P 2ONTA 3NTEA 2XV6A 4U0CA 2KODA 3G6EP 1VQ8P 1PEOA 1VQ5P 3WBHA 1N8RQ 3VRLC 1AUMA 2E1MA 4U0AA 1YHQP 4U0FA 3G1GA 1Q86Q 1E6JP 3DS2A 3G26A 1VQOP 3G21A 3G28A 5HGNA 3MGEA 3DS4A 1VQ4P 1YITP 1K8AQ 2PEKA 1W2BO 3DTJA 3H47A 1YJ9P 2P9XA 3LRYA 3M1MA 5F2KA 2CWOA 1QRJA 3CC4P 1ZMBA 1EIAA 1KD1Q 3CMAP 1VQ7P 3H0DA 3E2DA 5HGMA 4XFZA 1KC8Q 1JJ2O 1PEQA 2PEJA 2EFJA 3G4SP 1VQPP 4COPA 1VQKP 2M8PA 2Z46A 1RO2A 2OTJP 4U0DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCS P;  1VQO P;  1QVF O;  1VQ9 P;  1YJW P;  1NJI Q;  1Q82 Q;  3CCM P;  1YI2 P;  1Q7Y Q;  1QVG O;  1VQ4 P;  1YIT P;  3CXC O;  3G71 P;  3CCV P;  1W2B O;  1K8A Q;  1K73 Q;  3CCQ P;  1VQL P;  3CD6 P;  1VQN P;  3CC7 P;  1YJ9 P;  3CCL P;  2OTL P;  3CCU P;  1M90 Q;  1VQ6 P;  3CME P;  2QA4 P;  3CC4 P;  3I56 P;  3CCR P;  1KD1 Q;  3CMA P;  1VQ7 P;  3G6E P;  1VQ8 P;  3CPW O;  1VQ5 P;  1N8R Q;  1KC8 Q;  1K9M Q;  1YIJ P;  1JJ2 O;  3CCE P;  1YJN P;  3I55 P;  1YHQ P;  3G4S P;  1VQP P;  1KQS O;  3OW2 O;  2QEX P;  1S72 P;  1VQK P;  3CCJ P;  1Q81 Q;  1Q86 Q;  1M1K Q;  2OTJ P;  3CC2 P;  1VQM P; 
#chains in the Genus database with same CATH topology
 3CCS P;  3MTU E;  2NPS A;  2QG4 A;  2FYU K;  3USS A;  1MKM A;  3B8E B;  5H2F H;  1DV5 A;  5AVW B;  3PJS K;  1PGJ A;  5CMZ A;  5TIS E;  1P84 I;  1X22 A;  1SS1 A;  2HR3 A;  5KKZ B;  2PFX A;  1R8E A;  2PEQ A;  2KXP B;  3GKL C;  3G0V A;  2XV5 A;  3P8M C;  2E74 D;  4JF7 A;  3OA7 A;  1URQ C;  4N78 D;  1UJZ A;  3BRV B;  5APV A;  2WPS A;  5DJT B;  1FZF A;  4R4L A;  4W7Y A;  3MP7 B;  1JB0 J;  3S1K A;  1FZE A;  3H1K J;  4A7P A;  3L75 D;  3EQ2 A;  2FFD B;  1JCD A;  2N5H A;  4RJT A;  2BHV A;  3EJD A;  2FYZ A;  1BE3 J;  1EOQ A;  3TK1 A;  2C9N Y;  1YI2 P;  1KIL B;  5CJ0 A;  5EW5 E;  2Z44 A;  3L73 J;  2KWL A;  1OXZ A;  1SP4 A;  3OJA B;  1SQP D;  3TF5 A;  4JQ0 D;  2SPZ A;  2YIU C;  1EDJ A;  1L0N D;  1J1D C;  3MGN A;  1IFM A;  1KIL A;  2KNC B;  4L75 A;  2Y9Y A;  2GUV A;  3HUS B;  2K3R A;  3IR9 A;  2E42 A;  3H0D A;  3P8C D;  1GW4 A;  2Y9Z A;  1KZU B;  2OTK E;  4C46 A;  2N9B A;  5KLV E;  3A0H H;  2M8P A;  1RO2 A;  1W5C E;  5BU8 B;  1WT6 A;  3GHG B;  3GW6 A;  2M5A A;  1M6N A;  2LKM A;  3CD6 P;  4OH8 B;  1L4A B;  1VQ6 P;  1PIX A;  2JU2 A;  2Q9I A;  1GXG A;  3RK2 C;  1RH5 B;  5KAF H;  4O9B A;  3L74 D;  3AE9 C;  1NTK E;  3L70 G;  1BAJ A;  1K04 A;  3VTP C;  4PV1 C;  1USE A;  3V4Q A;  1SFC B;  2L22 A;  1PP9 J;  1MZ9 A;  2ZT9 D;  4HJG H;  2W27 A;  2CK3 H;  4IL6 X;  2FBW C;  1T8K A;  1RY3 A;  4I6M C;  3PRJ A;  2JDI H;  1NH4 A;  3L4F A;  5KAF E;  1SQX D;  3E1R A;  1CEI A;  1Q2N A;  2FQ0 A;  2HFE D;  3GZL A;  1Q7Y Q;  4H0L C;  5CCH C;  2R3S A;  5APT A;  2CPB A;  3I56 P;  1M1J B;  2YO3 A;  2O1J A;  2JGP A;  2KB7 P;  2B89 A;  3WBH A;  2E1M A;  2A45 H;  5APW A;  2XNX A;  3R2P A;  2Z4E A;  2JWD A;  4H44 D;  2NO8 A;  1E5W A;  2K0Y A;  5CCG C;  1SQP E;  5AW9 B;  2ZT9 B;  2K9J B;  4ASV A;  1M8O B;  3IAO A;  3B5N D;  2MF4 A;  3A2A A;  1SQX J;  3Q5P A;  4XFZ A;  1KTM A;  2YKO A;  1LTJ B;  1MZ8 A;  3I5C A;  4GIF A;  3Q5R A;  3P8C E;  2IFM A;  4OGQ D;  2A06 E;  4KHX A;  4EYY Q;  4TT3 H;  1JTH A;  2MY5 A;  1Z56 A;  1RE3 A;  4UB6 E;  4GR2 A;  1FAV A;  1MV8 A;  1HBW A;  1YYC A;  1CI6 B;  3P7K A;  2KOR A;  3WU2 E;  1EZV I;  3RL0 D;  5C39 A;  2E75 C;  1J1E C;  1H89 A;  4U7J A;  1GK6 A;  1G1J A;  2IPP A;  1S2E A;  2N1T B;  3WUV A;  2GM4 A;  1NYH A;  3RK3 E;  5GTH H;  3QH9 A;  1N2D C;  1SQX E;  1WMK A;  1GZL A;  3M0A A;  3H4E A;  2H43 A;  1H0T B;  1CSB A;  4CA3 A;  2BCC J;  2QA4 P;  2ROQ A;  4N78 E;  1M7L A;  2E76 B;  1BCC E;  2K9Y A;  3CX5 I;  4EI2 A;  2OYI A;  1PL5 A;  3AEB C;  1J1D B;  4L73 A;  3RL0 B;  3DS2 A;  3NXS A;  4R4M A;  1DD4 A;  2V7Q H;  2RH0 A;  2WMM A;  1W2B O;  2XZR A;  3HUS C;  2CWO A;  1EQ7 A;  5AVQ B;  1GXH A;  1OVV A;  2Z5H A;  1KC8 Q;  2BEQ D;  2FXO A;  1NVO A;  5AVZ B;  1LT9 A;  1N7S D;  2WSC J;  1X3O A;  3T97 A;  3P32 A;  3E1I A;  1SQV K;  3MZW B;  2KSE A;  3BCC E;  3GHG A;  1L4A D;  1M74 A;  4JYB A;  2IBZ G;  3Q1M A;  1VDF A;  2KGE A;  1L4A C;  1BE3 D;  1HVV A;  3CXH D;  1KV4 A;  1LWU B;  3L72 J;  3II6 A;  3CCE P;  2POH A;  4LC1 A;  5HGL A;  3L75 G;  1PEM A;  1HUC A;  5HV8 A;  3FX0 A;  1VQM P;  1L0N E;  2W90 A;  2WTY A;  3H1I G;  1QGK B;  3AE1 C;  3W67 A;  2KW2 A;  3CCV P;  1M90 Q;  5DJU B;  3V2N A;  2AFE A;  2I1J A;  1R5S A;  1HF9 A;  1N7S B;  4XFY A;  2NPS C;  1A43 A;  2D2C B;  3H1I E;  2E5Y A;  2XZ1 C;  2N98 A;  5AW3 B;  4H2W C;  2EHS A;  2KGC A;  5CCH D;  2KOO A;  1M1J C;  1IC2 A;  4GDO A;  1P84 E;  1NTZ D;  1AYI A;  2PNG A;  1OW7 A;  3V2P A;  4I7Z B;  4H13 B;  2W6B A;  1EDK A;  2GZE A;  2K1A A;  2E75 D;  1QRJ A;  1BSN A;  3L75 J;  3VP8 A;  3CE7 A;  4DOJ A;  3AED C;  1A02 F;  1FJK A;  1JOC A;  2LOL A;  2FAC A;  1VQP P;  2H8P D;  1CI6 A;  1P84 H;  2P58 A;  1YTZ I;  3V2R A;  2VLP A;  1KMI Z;  2WT7 A;  3A3Y B;  4XRO A;  1EDL A;  4H44 C;  3CCQ P;  3CCL P;  3IN6 A;  1LTB C;  1YQ4 C;  1ZV8 A;  2K0X A;  1AJY A;  2GDW A;  1QL2 A;  2QJY B;  3HTK A;  2BUO A;  1KYO D;  3L74 G;  2N5I A;  3H1J G;  4COC A;  3EJE A;  2XXM A;  2E75 B;  3JSV C;  1JY2 P;  1IUQ A;  4GR6 A;  3LW5 J;  3M0D A;  3WU2 H;  2LR2 A;  1ZME C;  3M0D C;  2JYL A;  3IF4 A;  2VRS A;  3MUD C;  2LXC B;  3PP5 A;  1T3J A;  1JO5 A;  2NPS D;  3BCC D;  1GW3 A;  1FS0 E;  5KLV G;  1SQV D;  5KLI C;  1PPJ G;  3VN0 A;  3H1H J;  1PPJ E;  2R5B A;  1VQ5 P;  3U43 A;  1EC5 A;  2H89 C;  2ZYD A;  2GDX A;  1S5L X;  2A45 G;  2XND H;  3D70 A;  1EXJ A;  2HPC A;  3H32 A;  2E5T A;  1NAF A;  3MGE A;  2QJK C;  1NTK D;  3TGU G;  4H0L D;  1YJ9 P;  2P9X A;  3L74 E;  1FJP A;  2WSF J;  5AVV B;  2WSS H;  1FOS F;  1EZV D;  1NTZ G;  4ZNC A;  1H0T A;  4CPG A;  3G3Z A;  2M3B A;  1OMI A;  2ZVN B;  1X8Y A;  4YXW H;  2AXT E;  2EHT A;  3BAT A;  2KP8 A;  4DT0 A;  1SQQ J;  1IO4 A;  5BU5 A;  1L0H A;  3P05 A;  1GK4 A;  1A8O A;  3TGU D;  3H1L J;  5AVR B;  2K94 A;  3JCU E;  3RBX A;  1BSH A;  1FZC B;  1JM0 A;  2I1K A;  2R32 A;  4I2L C;  2DW3 A;  1IMP A;  1SFC C;  2QM7 A;  1U57 A;  2K2Q A;  1KQG B;  3LIE A;  4WVZ A;  3HE4 A;  2KZI A;  4XA4 A;  3EJB A;  1VF5 B;  1ZLL A;  1NTM D;  3F89 A;  2D2C D;  2RN0 A;  4PD4 D;  2QEX P;  1FZA A;  1KB9 D;  2KGA A;  1PGQ A;  2IBZ E;  1AV1 A;  1SQQ D;  1HQB A;  3H1L G;  2AEM A;  2HPC B;  1BXI A;  2H88 C;  2KGD A;  3KQG A;  2E76 D;  1LTJ A;  2JEE A;  3KZI H;  4DZO A;  1ZRT D;  2ONT A;  2WIT A;  3G6E P;  3VMA A;  2IDB A;  2WZ7 A;  2WPT A;  4JYC A;  3Q2Y A;  3SFE C;  3L72 D;  3BCC G;  1OX3 A;  3C1L A;  2OYO A;  1AVO A;  3O8Z A;  3T97 B;  1HY8 A;  2PEK A;  3PH0 A;  3H47 A;  3K5B A;  2JJL A;  2KUB A;  1BE3 G;  1DEB A;  1NU1 G;  2WQY C;  1L0L K;  3KXD A;  3KZI E;  1FZC A;  1L0N G;  1SVF A;  3L71 D;  2GZJ A;  1ZR2 A;  7CEI A;  2IZ0 A;  3S9O A;  1NTM K;  1RE4 C;  4XRQ A;  4XFX A;  2LL8 A;  3CCU P;  1DD3 A;  4QNB A;  2GYK A;  3BVH A;  2KG6 A;  4PJ0 H;  2GZF A;  1NTZ K;  2B88 A;  3LID A;  4ZMD A;  5KJ7 A;  1BGY D;  4NPD A;  1L0N J;  5E79 E;  3GJN A;  1Q82 Q;  2FYU D;  4PH1 A;  3V5B A;  3CL3 D;  4UHP B;  5B5E E;  2E43 A;  1SQX K;  2O01 N;  5F2O A;  3L70 E;  1Y47 A;  2PEI A;  2Z45 A;  2CG5 B;  2M8N A;  2J5U A;  3L36 A;  4UB8 E;  4GOD A;  5BS2 A;  2PP6 A;  1QVF O;  3L71 J;  2FVF A;  3E7K A;  4W80 A;  5HGO A;  2QSI A;  1UIX A;  3GLM A;  2N50 A;  5KLI B;  4PWV B;  2K37 A;  3KHU A;  3CME P;  2MD9 A;  5CZD B;  4NPE A;  2QVA A;  2P1J A;  3U1A A;  1MFT A;  1MUU A;  2FYN B;  2M5R A;  1AUM A;  4U0F A;  1S3J A;  4ZKU A;  1YQ3 C;  4AQR D;  3AEC C;  1ZNV A;  3G1G A;  1G2C A;  2NZ2 A;  4BPH A;  2HLO A;  4H0L B;  3VMY A;  5AW2 B;  1E0H A;  3HUS A;  3MIW A;  1LP1 A;  1NTK G;  2LTE A;  3CWB E;  5KJ7 D;  3L70 J;  1VKU A;  3D6Z A;  1H8A A;  3H1J E;  4TLF A;  1VQ9 P;  4D6T E;  5AW4 B;  1X0T A;  2K93 A;  5AVT B;  1LWU C;  3H1H E;  3AE2 C;  1LTJ C;  3PLN A;  3HD7 A;  1L0N K;  3CLQ A;  4U0E A;  1JMM A;  3GMA A;  3OW2 O;  3RL0 g;  1IK7 A;  5M1B A;  2VSQ A;  4HH2 A;  4IPY A;  2EG5 A;  3WUT A;  1KFM A;  3V6I A;  1NU1 E;  1NTZ J;  1NTM G;  2YXR B;  2P67 A;  1YBK A;  3G1I A;  4EIJ A;  3L70 D;  4DG9 A;  2PEO A;  4JBZ A;  2NPS B;  2L0Q A;  3DS5 A;  2WPV B;  3RL0 C;  2FYU G;  2OYI B;  3HZQ A;  3LMO A;  2OTL P;  4HB1 A;  3W68 A;  3NTE A;  2IYO A;  2LIU A;  1SQX G;  1L0L D;  4MN4 C;  1SQB E;  2C9L Y;  1L4A A;  4I1L A;  5AW0 B;  1GD2 E;  3H1K G;  1RF1 C;  1URQ A;  2L5G B;  3MD0 A;  3G26 A;  1GL2 C;  3PHL A;  5APS A;  2B9B A;  3QWO C;  2Q7C A;  1Z6M A;  1EXI A;  1TU3 F;  1K8A Q;  3B4S A;  4IOI H;  5KP6 B;  2YMY A;  1KD1 Q;  1N73 C;  3M9B A;  4WY4 C;  4EDF A;  2AXC A;  2MR8 A;  4H2Y C;  2KOQ A;  4HYT B;  3AE5 C;  2OTJ P;  4U0D A;  2O1K A;  4M0I A;  3CWB G;  1PP9 E;  1NU1 D;  1NTM J;  2DNW A;  2ZXE B;  1FR2 A;  2YKP A;  3SFD C;  3VOP A;  4GOF A;  3HD7 C;  1N86 A;  2M8R A;  1T8Z A;  3H1L E;  2XDJ A;  3H1H D;  4H13 D;  3L35 A;  2KNC A;  1GTW A;  2YXQ B;  4PD4 I;  4NEO A;  1T2K C;  5BVZ A;  1MFZ A;  3A0B H;  2IBZ D;  3EWK A;  1S4X A;  1SQQ K;  3CWB D;  4PJ0 E;  1NKN A;  3VP9 A;  2Q5U A;  1ZN5 A;  3Q3D A;  1EDI A;  2FHS C;  1JNM A;  3CX5 H;  4OVN F;  5EJD A;  4ASW A;  3DS3 A;  1NAY A;  3RK3 B;  3L72 G;  4U3F D;  2L6E A;  3N4X A;  3CI9 A;  2Q1K A;  4BRY A;  2PY8 A;  1T3U A;  1YTZ T;  2KOP A;  5K5G B;  4Y28 J;  2JWA A;  2KI7 B;  3G9R A;  1VPC A;  1JY2 O;  2MVV A;  4U0A A;  3O6Q A;  2KYV A;  1NTK K;  3H6P A;  2D2C C;  1Q86 Q;  4BRY B;  2Q3E A;  4BPG A;  3CWB J;  3D6Y A;  4IFD K;  2FVA A;  2GA1 A;  2QJK B;  2IX7 C;  1M56 D;  1GL2 D;  3KPE A;  2FAE A;  3LRY A;  2V4H A;  1KQF B;  3GF7 A;  1DIP A;  2GZI A;  2KS1 A;  4KT0 J;  1KB9 I;  1VQK P;  5AW7 B;  2Z46 A;  3RK2 D;  1AQT A;  1NOH A;  3MUD A;  2AEJ A;  2QE7 H;  3H1K E;  1T2K D;  2FVE A;  1QLE D;  1JMB A;  2ZAE B;  1SQB K;  3GZM A;  2QRX A;  1U7M A;  4EOT A;  3Q20 A;  3M06 A;  5AVS B;  1L0I A;  1M57 D;  4YPC A;  1F80 D;  1YJW P;  1SQP K;  1KYO H;  1JUN A;  1D1D A;  2MJZ A;  1XTC C;  2JB0 A;  3CCR P;  3CPW O;  5DCK A;  2IFN A;  2M8L A;  1QEX A;  2KLV A;  1RF0 C;  1YJN P;  2HOD B;  1KYO I;  5AW5 B;  5GTH E;  3DS1 A;  2W6J H;  4OWF A;  1DNY A;  3HE5 A;  3NMD A;  1GMJ A;  1LJ2 A;  2XKM A;  1KYO E;  1ZOY C;  1AA0 A;  2L4B A;  5CCH A;  3FXE A;  1VQ8 P;  2LIW A;  3VMZ A;  2AF8 A;  4C7R A;  3TSI A;  4JPZ B;  4DCK A;  3M9Q A;  1E6J P;  5HGN A;  3DS4 A;  1L0L E;  5APU A;  1E79 H;  1VF5 D;  1S5L E;  1KB9 E;  3H1K D;  3CC4 P;  2E74 C;  1EIA A;  3ITK A;  3U59 A;  2R3C A;  3M91 A;  4OGQ C;  2KOS A;  1JEK A;  2PEJ A;  1KIL E;  1PFI A;  2CGQ A;  3EFG A;  3EFF K;  3H1J J;  3M9H A;  2BCC E;  2HG5 D;  3G71 P;  4D6T G;  4IFF A;  3CC7 P;  5AVX B;  3RG6 C;  5AVU B;  2CPS A;  3NY7 B;  1BCC J;  2ERH A;  5I4T G;  1VF5 C;  1YIJ P;  4WYM A;  2QJP C;  2JKV A;  1EZV G;  4PXH B;  4YTP C;  3CC2 P;  4LGD E;  3HYB A;  5KLV J;  1BDD A;  2O3J A;  1NJI Q;  1NQ4 A;  2X2B A;  3H1I D;  3B71 A;  1LT9 C;  2QNW A;  3MHV A;  1IK9 A;  2ZXX A;  4D6T D;  5GTI H;  1SQB G;  1AQ5 A;  4N3Y B;  1GU4 A;  2AEF A;  3H1J D;  4U3F E;  1IZN B;  2EIA A;  1FZB A;  1LTT C;  5CJ4 A;  1FZC C;  3A0B E;  1Q81 Q;  2WPQ A;  1RHZ B;  1S1C X;  2B87 B;  1D7M A;  5JPA A;  1AFO A;  1VQL P;  1IMQ A;  3CX5 E;  4U0C A;  4BPF A;  1VHN A;  2KG8 A;  1OW6 A;  4WY4 D;  1FU1 A;  5APX A;  4MRT C;  3L37 A;  1ACP A;  3RGU A;  2J58 A;  3H1L D;  2JU1 A;  2K9J A;  1NKZ B;  2WPR A;  4D6T J;  2LKI A;  2UWJ E;  3GG2 A;  1KN7 A;  1VQ7 P;  1X9V A;  5E79 H;  5AVY B;  2L9F A;  2J59 M;  1IFN A;  1PP9 D;  3H1I J;  1FZG A;  1FBM A;  3HRN A;  5AW6 B;  5KKZ C;  3L73 D;  4COP A;  1UNK A;  1OVR A;  4PH0 A;  4L74 A;  5EFW B;  2QM8 A;  2PEN A;  1S9K E;  3L73 E;  2A06 G;  3SWF A;  4U3F J;  4UB8 H;  3BCC J;  1SQV J;  1JCC A;  2FY8 A;  2KS1 B;  3OAK A;  2LML A;  2V7Q J;  3I55 P;  1T6A A;  2CNR A;  2KG9 A;  5BS1 A;  2OYH B;  1PV3 A;  5APQ A;  3C9I A;  2G3A A;  1NWQ A;  2H7H A;  3L73 G;  1ZR4 A;  1Y8A A;  2XT1 A;  2N1T A;  2WSC H;  3V4W A;  3H25 A;  2BAS A;  1RNI A;  4BXL A;  5CCG A;  1VL2 A;  3AE7 C;  2YIU B;  3RK3 D;  3RBZ A;  5H2F E;  3CX5 D;  3AEE C;  2JQ4 A;  3CCJ P;  5L8R J;  3L71 E;  2FXP A;  3Q5S A;  1FC2 C;  2GZG A;  1HJB A;  2JO0 A;  2XV6 A;  1LT1 A;  1OIP A;  3SWK A;  2IYP A;  1LP1 B;  2OGU A;  1J2J B;  1DH3 A;  1DEE G;  2YKQ A;  2O01 H;  3L72 E;  3RG2 A;  2RKL A;  5TJH A;  4AYC A;  2KR5 A;  1GL2 A;  2AVA A;  5HVC A;  1GL2 B;  1OVU A;  1KIL C;  3L71 G;  2JP3 A;  3A7O A;  3CXH I;  2FXM A;  3M1M A;  4NPF X;  1N73 A;  1N73 B;  3KDP B;  2E74 B;  2FYN C;  3B5N C;  1FE6 A;  3RK2 B;  3HE4 B;  2KLU A;  2RMZ A;  1GU5 A;  4Y99 B;  2BCC D;  3SSU A;  3FGA D;  4PV1 B;  1M6E X;  1QVG O;  2K5X A;  3CXC O;  1G2C B;  2DGY A;  2O01 J;  3PTZ A;  4R0M A;  3WUU A;  1KLP A;  2AXT H;  2FYU E;  2G8Y A;  2L91 A;  2P7J A;  3U1C A;  4QMA A;  4K35 A;  1CZQ A;  1SQB D;  2OYH A;  3JCU H;  4M3L A;  2OYI C;  1KOR A;  1URQ B;  2YMK A;  4U0B A;  1ZW0 A;  1ZP0 C;  1OW8 A;  4HKZ H;  1JY3 P;  4IZ6 A;  3B4Q A;  1S9K D;  2FFD C;  3BAS A;  3B5N A;  1OFC X;  2WSE J;  3H32 B;  5GTI E;  3VYI A;  2W6A A;  2FQ2 A;  5CBO A;  1CW5 A;  4XE5 B;  1BGY J;  2M0B A;  3TNU B;  5KAI E;  1SQB J;  4WY4 B;  4PD4 H;  4F37 A;  1H88 A;  2YNY A;  1BGY E;  1BDC A;  1HH0 A;  5KP7 B;  2YO2 A;  3LW5 H;  4XFJ A;  2OQQ A;  2M5A B;  2JO1 A;  1IFI A;  5KLV D;  1SFC D;  2WWW A;  3HD7 B;  5HGM A;  1SQV E;  2WSE H;  1LTI C;  2JAZ A;  1RQU A;  5KAI H;  1RF1 B;  2GDY A;  4PD4 E;  3SWY A;  1BGY G;  2ZYA A;  2ZJS E;  2Z5I A;  5KLV K;  2OAR A;  4YXD C;  1RE4 A;  1IFP A;  1FDO A;  3DS0 A;  2QIW A;  1K30 A;  1HGV A;  1QX8 A;  2K88 A;  3CXH H;  4IL6 E;  5KP8 B;  3S4R A;  1PZQ A;  1RO0 A;  2CQ8 A;  2OYH C;  2A06 D;  2IZ1 A;  2FAD A;  2BCC G;  1LTS C;  1X79 B;  2A45 I;  2BQ1 E;  3FXD A;  2WSF H;  4GOE A;  4WB4 A;  1OR5 A;  4RKU J;  1NU1 K;  3BRT B;  1K9M Q;  5F2N A;  5B5E H;  2AFD A;  2FFD A;  4U3F G;  1GPJ A;  1SQV G;  2PGD A;  1NTM E;  3AEG C;  2ZVO B;  2W83 C;  4L76 A;  2W8Z A;  2KOG A;  3CCM P;  1PEU A;  3AE3 C;  2KZJ A;  1KFN A;  4H2X C;  1KIL D;  5APY A;  3TNU A;  1PEO A;  3NTN A;  2MKV A;  1QL1 A;  2LPK A;  2FKW B;  3WMM 0;  2PRR A;  1AF8 A;  3RK3 C;  2ZYG A;  3TGU E;  1YIT P;  1HWT C;  2XZ0 D;  1SQQ G;  1N7S A;  1SFC A;  2GUS A;  1BCC G;  1W2E A;  4C7N A;  1PGO A;  2EFJ A;  2BEZ F;  1FDM A;  2HYN A;  4RO0 A;  4Y99 C;  2ITA A;  1SQP J;  1L0L J;  4IFM A;  1FDI A;  1K73 Q;  4K3A A;  5KTB A;  1UII A;  3A5T A;  3F5H A;  3B5I A;  3NFQ A;  1LWU A;  3HE5 B;  5AW8 B;  5KJ7 C;  1RQV A;  3UIA A;  2LXB A;  1KQS O;  1NTK J;  2WVR A;  1G1I A;  2HOD A;  2P2U A;  4KJM A;  2JYG A;  1ZRT E;  1J1E B;  1VQN P;  3IFM A;  2ZFC A;  3C8V A;  1LT9 B;  2N1T C;  2N6Y A;  2PEM A;  1L0L G;  1U7J A;  1SQQ E;  3TYY A;  4ZKP A;  3ABV C;  2KIK A;  1S5L H;  1KB9 H;  1S72 P;  2JBG A;  3FWN A;  2XU6 A;  1NHL A;  3D71 A;  1GDT A;  2WT7 B;  1PP9 G;  5B66 H;  4QKO A;  2IBZ I;  1LTA C;  1NU1 J;  3L74 J;  4DJG A;  1ZXG A;  4WWI A;  2E76 C;  1N8R Q;  1XTG B;  3VRL C;  3AE6 C;  1IJD B;  1YHQ P;  4LLH A;  2Q6Q A;  4RES B;  2I8D A;  2VLN A;  2Y0D A;  3V2Q A;  1NTZ E;  2K0D X;  1P84 D;  3G21 A;  3AEF C;  2K92 A;  3VMX A;  3G28 A;  1SQP G;  1FOS E;  2JR8 A;  1JY2 N;  4H44 B;  1Q90 D;  3A0H E;  3DTJ A;  2VLO A;  2NRG A;  4GKG A;  5F2K A;  4W7Z A;  2M3E A;  1ZMB A;  2PAJ A;  3L75 E;  3CMA P;  4BWN A;  5B66 E;  3ZDM A;  1JJ2 O;  1PEQ A;  4Z1M H;  3H1H G;  4PV1 D;  1LNQ A;  4I7Z C;  1EZV E;  2QJY C;  1RF0 A;  2P10 A;  3GHG C;  3O6Q B;  5CBN A;  3R4Y A;  1HJ0 A;  3AEA C;  2MVU A;  1Y9B A;  4GT1 A;  3DPH A;  2FQ1 A;  4OGQ B;  1JY3 N;  1JTH B;  3AE8 C;  1N7L A;  1R5L A;  4B86 A;  1A02 J;  4WBA A;  1L2P A;  2R5D A;  1M1K Q;  1OZH A;  1URQ D;  1LGH B;  3G29 A;  3CXH E;  4IL6 H;  4AUW A;  1PPJ D;  3GF3 A;  1NO4 A;  5CCG D;  2VLQ A;  2QJP B;  1AVY A;  2N1T D;  3TDK A;  2KSJ A;  2LF4 A;  1N7S C;  2C0W A;  2C0X A;  2Y0C A;  4HKG A;  1HTL C;  1IFD A;  3FWL A;  1SLQ A;  1EMV A;  2N6Z A;  1USD A;  1HGZ A;  3N7N A;  3TGU J;  2Y0E A;  2Q3I A;  4N6J A;  1LTG C;  3AE4 C;  2KOD A;  1PGP A;  5CHX A;  1RF1 A;  1M1J A;  5AW1 B;  2MR7 A;  1NGM B;  1RE3 C;  1BCC D;  2B87 A;  1VQO P;  1K05 A;  4H13 C;  1VQ4 P;  1JY3 O;  2R44 A;  2ZT9 C;  3KYQ A;  2N9Y B;  1OWA A;  3HD7 D;  3HTK B;  1BE3 E;  1DX7 A;  3JC2 2;  1WRG A;  5TIS H;  3E2D A;  2FYU J;  3B5N B;  2KK7 A;  1IFJ A;  3G4S P;  4WY4 A;  4C7N B;  1KQL A;  4UB6 H; 
#chains in the Genus database with same CATH homology
 4XRO A;  3CCS P;  4M0I A;  4PH0 A;  1VQ9 P;  1M6E X;  1M6N A;  2OAR A;  1QVG O;  3CXC O;  2PEN A;  3G71 P;  1M74 A;  4XRQ A;  3CCQ P;  1K73 Q;  2DGY A;  4XFX A;  3CD6 P;  3CC7 P;  3CCL P;  3RG6 C;  3CCU P;  1VQ6 P;  3B5I A;  4QNB A;  3DPH A;  3DS0 A;  1K30 A;  3P05 A;  5I4T G;  1A8O A;  1YIJ P;  4WYM A;  3Q20 A;  4GR2 A;  3CCE P;  3I55 P;  4U0E A;  1RO0 A;  5HGL A;  5BS1 A;  1KQS O;  3OW2 O;  1PEM A;  1M1K Q;  2BUO A;  1BAJ A;  3CC2 P;  1VQM P;  1YJW P;  3HYB A;  4IPY A;  2BQ1 E;  2EG5 A;  2PEQ A;  1NJI Q;  1Q82 Q;  3G0V A;  4COC A;  1D1D A;  3G29 A;  2XXM A;  2JYG A;  2XT1 A;  3CCV P;  4PH1 A;  3G1I A;  1VQN P;  1M90 Q;  1RNI A;  1IUQ A;  4U0B A;  3CCR P;  4GR6 A;  3CPW O;  5DCK A;  2PEM A;  5F2O A;  2M8L A;  1K9M Q;  5F2N A;  2PEO A;  1YJN P;  2PEI A;  2JYL A;  2Z45 A;  2LF4 A;  4XFY A;  2EIA A;  3DS3 A;  1A43 A;  2QEX P;  1S72 P;  2M8N A;  3CCJ P;  1Q81 Q;  3DS5 A;  2BHV A;  3DS1 A;  5BS2 A;  1QVF O;  2L6E A;  3H4E A;  1EOQ A;  5HGO A;  5JPA A;  3CCM P;  1YI2 P;  1Q7Y Q;  3HZQ A;  2Z44 A;  1PEU A;  2PY8 A;  1VQL P;  2OTL P;  3CME P;  2JO0 A;  2QA4 P;  3I56 P;  2ONT A;  3NTE A;  2XV6 A;  4U0C A;  2KOD A;  3G6E P;  1VQ8 P;  1PEO A;  1VQ5 P;  3WBH A;  1N8R Q;  3VRL C;  1AUM A;  2E1M A;  4U0A A;  1YHQ P;  4U0F A;  3G1G A;  1Q86 Q;  1E6J P;  3DS2 A;  3G26 A;  1VQO P;  3G21 A;  3G28 A;  5HGN A;  3MGE A;  3DS4 A;  1VQ4 P;  1YIT P;  1K8A Q;  2PEK A;  1W2B O;  3DTJ A;  3H47 A;  1YJ9 P;  2P9X A;  3LRY A;  3M1M A;  5F2K A;  2CWO A;  1QRJ A;  3CC4 P;  1ZMB A;  1EIA A;  1KD1 Q;  3CMA P;  1VQ7 P;  3H0D A;  3E2D A;  5HGM A;  4XFZ A;  1KC8 Q;  1JJ2 O;  1PEQ A;  2PEJ A;  2EFJ A;  3G4S P;  1VQP P;  4COP A;  1VQK P;  2M8P A;  2Z46 A;  1RO2 A;  2OTJ P;  4U0D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...