1K73Q

Co-crystal structure of anisomycin bound to the 50s ribosomal subunit
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
143
structure length
143
Chain Sequence
b'TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAKGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title Structures of Five Antibiotics Bound at the Peptidyl Transferase Center of the Large Ribosomal Subunit
pubmed doi rcsb
molecule tags Ribosome
total genus 47
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2001-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1k73Q02
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1k73Q01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1k73Q03
1YJ9P 2OTLP 3G71P 3CCJP 3G6EP 1YJNP 3CCLP 3G4SP 3CMAP 3CC7P 3CCMP 1VQ4P 1YI2P 1NJIQ 1VQNP 1KD1Q 2QA4P 3CCSP 3CC4P 1M90Q 1QVFO 2QEXP 3CD6P 3CCEP 1Q86Q 3CXCO 1K9MQ 1Q7YQ 3CPWO 1YIJP 3CC2P 1K73Q 1W2BO 1YHQP 1N8RQ 3CCVP 3CCUP 3I55P 3CCRP 2OTJP 1VQOP 1VQKP 3CMEP 1VQ8P 1VQMP 3OW2O 1VQ5P 1YJWP 1VQPP 3CCQP 1QVGO 1Q81Q 1VQ7P 1VQ9P 1YITP 1KQSO 1VQ6P 1M1KQ 3I56P 1K8AQ 1Q82Q 1JJ2O 1VQLP 1S72P 1KC8Q
chains in the Genus database with same CATH superfamily
4DG9A 1T6AA 1GK6A 5L8RJ 1LTBC 4RKUJ 2QE7H 1S3JA 2IDBA 4U0EA 4LGDE 2JR8A 1PP9D 1N73B 1URQA 3AE1C 1D1DA 1WMKA 3HUSB 2FYNC 2RMZA 3R4YA 1A02J 1N2DC 1W5CE 5E79H 5CHXA 3FWNA 2PY8A 2JU2A 1PL5A 3CCMP 3VP8A 4WY4B 3U43A 4MRTC 4U3FJ 2AEJA 4IL6H 1ZR2A 3BASA 3H1KJ 2Q1KA 2M3BA 2C9NY 2FAEA 3CC4P 1GDTA 4PWVB 3RK2B 1KYOI 2WWWA 2KODA 2FXPA 1DD3A 4GIFA 3GZMA 1ZRTD 3USSA 5AVQB 1KYOD 2KZIA 1FDIA 1SQPE 2RKLA 2Z4EA 2O01H 4W7ZA 3M0DA 4PJ0H 4PH0A 3EFGA 1OW8A 3TYYA 1RE4A 2G3AA 2HFED 3DPHA 5APSA 2H88C 2HPCA 5DJTB 1Q90D 1M7LA 3CX5I 1VQKP 3HD7A 4D6TJ 2KG6A 5KJ7D 4BWNA 2JAZA 1QVGO 2XKMA 2H7HA 1X79B 3JSVC 3CX5D 3RK3D 2FACA 4EYYQ 4DZOA 4ZMDA 1BE3J 4L75A 2ZXXA 3EWKA 1CI6B 5KKZC 5APTA 5AVRB 2Y0CA 2WSFH 5KAIE 4U3FD 2MVVA 3BATA 2OTJP 1SQBJ 1LTGC 3H1KD 1QRJA 3RL0B 4N78D 3TGUE 4H44B 5TISE 1VL2A 1S1CX 1L4AA 2FYUJ 4I2LC 1QL1A 3QWOC 1OFCX 2IX7C 2OYIB 1X8YA 1PPJG 2VLNA 3L74G 3NTEA 3FWLA 3D71A 2Y0EA 3WUTA 2M3EA 4IFDK 3VMYA 1EXJA 1L0LJ 2K5XA 5K5GB 1T3UA 5M1BA 2KZJA 1RQVA 1EXIA 5KP7B 1QVFO 2NPSC 1BCCE 4D6TD 3GHGB 2PAJA 4ZNCA 3O6QB 1PGJA 5BU8B 1VKUA 2IBZI 3KQGA 3V6IA 2V7QJ 1AUMA 1EOQA 1RHZB 3H1JJ 3G1IA 1BE3D 1N7SC 2IBZD 2GYKA 2IFMA 1AQTA 2MD9A 3E1RA 2JDIH 5KAFH 1FZBA 3V4WA 1NTZG 3L71E 4UHPB 1GW4A 1SQBD 3H32A 1NTKK 1URQC 4R4MA 2FYUD 3H1IE 1L0HA 2ZXEB 2LKMA 2R32A 3IR9A 1GL2A 3TF5A 2YKOA 2RN0A 1EIAA 1SQBK 3T97A 3BCCG 3LW5H 1IZNB 2FYUK 2XU6A 3C1LA 2FYNB 5APUA 1PP9E 2IFNA 2R3CA 1L0LD 2ZYGA 3P32A 3R2PA 4C46A 3DS2A 3E1IA 3HYBA 3WU2H 1LT1A 2KOPA 2M8LA 1NKNA 3BVHA 1NTME 3RG2A 1G1JA 5HGOA 1L0LK 5CBOA 3KXDA 3H1JD 1GTWA 2XV5A 2WT7B 3M9HA 1SVFA 2HG5D 3Q2YA 2CGQA 4JYBA 1NAFA 4WYMA 4QMAA 5TJHA 1WT6A 5AVWB 1SQVJ 3E2DA 3FXEA 5CMZA 3FX0A 2KOSA 4LC1A 5AW2B 2CQ8A 2QRXA 1RH5B 3KPEA 1E6JP 2XZ0D 4F37A 3GF3A 4AYCA 1SP4A 3M91A 3VYIA 2MJZA 5B5EH 5CJ0A 5KLVK 3CI9A 3W68A 1LWUA 3DTJA 2MVUA 1LP1A 1VQOP 2K2QA 1IK9A 3IN6A 1PEQA 4NPFX 2KOQA 1JB0J 2AVAA 2JWDA 3OA7A 1T2KD 3OJAB 4IZ6A 2P2UA 2Z44A 3RK2D 5KKZB 3GW6A 3RK3E 2XNXA 4PD4I 4W80A 1FZEA 4UB6E 2JGPA 1BSHA 2NZ2A 3V2PA 5HVCA 4PD4D 2HLOA 5AW6B 1K05A 2XZRA 1IFJA 2FBWC 1DNYA 1SQXJ 2D2CC 4U3FE 3RGUA 2PEJA 2KSEA 1JUNA 1R5SA 4N78E 2W27A 1OX3A 4BPGA 1SQVD 1FJPA 4YTPC 1IFPA 1AJYA 1KTMA 2MR8A 1Q86Q 1OVRA 3B5NB 3GMAA 3D6YA 4H13C 1E79H 1HTLC 2E75B 2ZT9C 1SQPG 1DIPA 1KILD 1M1JA 1H0TA 1SQVK 1AFOA 1HJBA 1JMMA 3KDPB 1GU5A 1GXGA 1ZV8A 1HUCA 4H0LC 1S2EA 1BXIA 4WY4C 4H44D 2K94A 1KB9I 1EZVE 2GZGA 1JCDA 2Y9YA 4IFFA 3VMXA 1KFNA 1VQPP 3MUDC 1KB9D 1M1KQ 2JEEA 2KSJA 1GMJA 1SFCA 1NTKE 3L70J 2YIUB 3D6ZA 2VLOA 3HE5A 2LOLA 2E43A 3CXHH 2EHSA 2VRSA 3CE7A 1EQ7A 2WPSA 2CPSA 4L76A 2WPQA 1ACPA 1URQB 1X9VA 3WU2E 1PPJE 1SQXD 1BGYJ 3TGUG 3A7OA 1EDJA 3IAOA 1JCCA 2WSCJ 1PZQA 5AW7B 1RF1A 2AXTE 2K9JA 2YKPA 1GZLA 3Q5SA 3CC7P 4HB1A 5BS1A 1BAJA 3G9RA 3G26A 1FAVA 2PGDA 2Z45A 1SQXK 3AEFC 3P8MC 2E76D 1FDOA 1L0ND 1IMQA 1NAYA 5AW1B 1SQQJ 5CCHA 2Z5HA 3L75J 4BPHA 1LTTC 1TU3F 2YKQA 3AE7C 1ZMEC 1H88A 3NMDA 2N1TA 3VTPC 2A06D 1BCCG 1ZP0C 3H1LJ 1PEUA 1K73Q 1NTZE 3LMOA 2CNRA 1L0NK 1U7MA 2R5BA 5H2FE 2W83C 3L70D 2K9YA 3RL0C 4XFXA 1N86A 2PFXA 3U1AA 2XZ1C 1P84E 2ZVOB 1IFDA 2QEXP 2OYIC 1CSBA 1BGYD 4PH1A 2Q7CA 2C9LY 2L9FA 1GK4A 1Z6MA 3IF4A 5KLVE 1RO0A 2QJKC 5AVZB 5AVSB 3G71P 1OZHA 5KAIH 2QA4P 1BSNA 4XFYA 2PEQA 4GDOA 1DD4A 2C0WA 5TISH 3A0BE 1G2CA 1S9KE 1W2BO 1PP9G 1JY3N 5CBNA 4I6MC 2QNWA 2IYOA 1NYHA 2PENA 1SQQD 3L75D 1L4AB 1NWQA 1IJDB 5F2KA 2O3JA 3MP7B 4NPEA 2OTKE 3M06A 2KGAA 3H1LD 1JEKA 3H1HJ 4HKGA 1X22A 1YYCA 1SQQK 2JB0A 5DCKA 4PD4E 5KP8B 5AW0B 1K8AQ 4O9BA 5KLIC 1HVVA 1FDMA 1FC2C 2JP3A 5GTHE 1YI2P 2Y0DA 3G3ZA 3AE5C 2J5UA 2GZJA 3G28A 4H13B 1SQVE 2ZT9B 3CXHE 1HQBA 2MF4A 5AW4B 2WSFJ 3RBZA 2EFJA 5KJ7A 1NVOA 2FFDA 2H8PD 1SFCC 1RF0C 3MD0A 1KILE 2M5AA 4QKOA 4H0LB 4ZKPA 5EJDA 4K35A 3RL0g 1MFTA 3H47A 3H32B 1ZNVA 1VF5B 2FADA 2E1MA 2BCCJ 1AVYA 2JU1A 1EDKA 1M6EX 2POHA 2EHTA 2V4HA 1RF1C 5APWA 1KB9E 3V4QA 1X3OA 3H1HD 2JQ4A 3CCSP 1GL2B 3T97B 2JO0A 2K92A 2GZIA 1FJKA 5GTIE 1LJ2A 1PV3A 3TNUA 4U3FG 3WBHA 4U0FA 2KIKA 3H1KG 2OQQA 3V2RA 5I4TG 2NPSD 4B86A 3Q20A 2Z46A 3CWBJ 2B87A 1MV8A 2N1TC 2WSEH 2WPTA 1N7SD 1JNMA 1FZCA 5EFWB 1AYIA 2B89A 3B5IA 1AV1A 1ZW0A 2PP6A 3FGAD 1L0NE 3G6EP 2B88A 2FY8A 3MGEA 1URQD 5CCGD 4H2WC 1U57A 3G29A 4KHXA 4AUWA 1EZVG 1L2PA 4EDFA 2BCCD 3LW5J 1LT9A 3E7KA 2HR3A 1PGQA 3HTKA 2EIAA 2E74C 1NTKG 4OGQB 1YQ4C 1JMBA 2PEOA 3AE9C 1NJIQ 2K0DX 2IBZG 3A5TA 1DEEG 2KP8A 3L74J 2GDXA 3U1CA 5B66E 1LWUB 3B5NC 4KJMA 1SQBG 2E75C 2QJKB 4QNBA 2R44A 1KC8Q 1YJ9P 2YXRB 2M8NA 1SLQA 1XTGB 4UB6H 4XFJA 3V2QA 3CWBD 1KD1Q 1L0IA 2WPVB 2B9BA 2K3RA 3PLNA 4XRQA 2VLQA 3QH9A 1VQMP 3CCQP 3S9OA 1LNQA 1BDDA 1L0LG 3P7KA 1NKZB 1RY3A 2YIUC 1ZLLA 1HH0A 1G1IA 3OAKA 2YMYA 4XE5B 1AQ5A 3LIDA 4YXWH 3I55P 3L72E 2N6ZA 5HGNA 1K04A 1BDCA 2JKVA 5KLIB 1ZXGA 2ZFCA 1H0TB 5BS2A 2OARA 4BPFA 3EJBA 3PJSK 3L74D 3BCCJ 4L74A 1IO4A 1JY2N 2DNWA 1OVVA 2I1KA 4UB8E 4GR6A 1E5WA 5KLVG 3F89A 2GA1A 1JJ2O 1R5LA 4JPZB 1SFCB 1R8EA 1PEMA 2KGEA 2JYGA 2QJPB 2WSSH 3HE5B 3M9BA 3LRYA 1PFIA 3AE3C 3CCEP 2MY5A 5DJUB 2D2CD 2FQ1A 2FQ2A 2ZAEB 5AVUB 4H2XC 2AXTH 1DV5A 2JBGA 3HZQA 4Y99C 1RF1B 3F5HA 4XROA 2ZJSE 2OTLP 3K5BA 3P05A 4H13D 2LXBA 4OVNF 3M0DC 1GXHA 2CG5B 1EDIA 1Q7YQ 4R4LA 2Q3EA 1RE4C 3FXDA 4IPYA 2BUOA 1Y9BA 3HD7C 2BHVA 1ZRTE 1KYOE 4Z1MH 4WY4D 1HBWA 1KILA 3BCCD 1EMVA 2N1TB 1SQVG 5JPAA 5KTBA 5H2FH 2LMLA 3P8CD 4IL6X 2GUVA 3L4FA 2P7JA 3PRJA 2N5IA 1YTZT 1JY3O 3VMZA 1P84H 1J1DC 2GDYA 5AW9B 2A45I 4WWIA 1A43A 1L4AC 3LIEA 3U59A 4GR2A 1RE3A 3CX5E 1EC5A 3CLQA 3SSUA 3H25A 2R5DA 1FZGA 3SFEC 1KMIZ 4ZKUA 2W90A 1DH3A 2E74B 1USDA 3DS3A 1FZFA 2PRRA 2BASA 3H1KE 4NEOA 3Q5PA 3A0BH 1M90Q 1AF8A 3HE4A 2W6JH 3RG6C 3GHGA 3AE4C 3EQ2A 1YIJP 1G2CB 4IOIH 2N9BA 1SQPJ 2LPKA 1ZR4A 2WMMA 4C7NA 1GW3A 1SQXG 2FVEA 3W67A 2C0XA 2KOGA 3AEGC 4W7YA 3CMAP 3L36A 4KT0J 2WPRA 3RBXA 3RL0D 4PD4H 1YHQP 3L35A 3CCRP 3H0DA 1VF5C 5GTHH 4D6TE 1T8KA 4M0IA 4M3LA 1L0NG 3AEAC 2K88A 2LIWA 1EDLA 5HV8A 2AXCA 1Y47A 1A02F 2PEKA 1BE3E 1GL2C 1AVOA 2IBZE 3TGUJ 3B71A 4BRYA 1LTJA 1SQBE 2FYUE 2FFDB 3L70G 2KXPB 3WUUA 3RK3B 2LTEA 4Y28J 3TDKA 2M5AB 2N6YA 1S5LE 1NH4A 2K37A 3C9IA 3M9QA 3UIAA 4AQRD 1NU1J 2E5TA 3CL3D 2W8ZA 3Q1MA 3BRVB 2QIWA 4JBZA 1KB9H 4WVZA 1HJ0A 2CWOA 2O1KA 3GJNA 1KV4A 1L0LE 2OYOA 1BCCJ 1IC2A 1OIPA 5AVYB 5GTIH 2KLVA 3N7NA 1KORA 1N8RQ 1FR2A 3G1GA 4Y99B 1VPCA 3TNUB 3S1KA 1Q81Q 2KR5A 5AW3B 2X2BA 1FBMA 1HGVA 4OGQC 2J58A 1SQQG 3L75G 2I1JA 3G4SP 3H1JE 2NRGA 1KILC 3L71J 1H8AA 2B87B 1K9MQ 3L72G 1UNKA 3H1LG 3H1IJ 3SWKA 4YXDC 2HPCB 1SFCD 1LWUC 1S5LX 3HD7B 1QGKB 1FZCB 1MUUA 4TLFA 4HJGH 2ITAA 2YXQB 3JCUE 1YJNP 2LF4A 2W6BA 2K93A 4PV1C 4A7PA 2WTYA 1MZ9A 1NU1D 1RE3C 3A0HE 7CEIA 1PP9J 2PEMA 2I8DA 1LT9B 3HTKB 3KZIE 1J1DB 1CEIA 1BCCD 3VN0A 2O01J 1NU1K 5B66H 1NTMJ 2WQYC 3L73J 3CXCO 2HODA 5C39A 5AVTB 1KZUB 2WSEJ 4ASVA 1MKMA 1PGOA 1SS1A 2P58A 2Q6QA 4L73A 3NTNA 2N1TD 1HF9A 3L71D 2WZ7A 1M1JC 1M57D 2Q3IA 2PNGA 2JWAA 2NPSA 1ZOYC 2FVAA 4ASWA 3H1ID 3H1HG 1OW7A 2OYHA 3M1MA 1HY8A 1Q2NA 1JY2O 1KFMA 4GT1A 1PGPA 2JYLA 2P10A 1VQ9P 1QL2A 3Q5RA 2KWLA 1OWAA 2YMKA 1N7SA 3SFDC 1FZAA 1YQ3C 1M74A 1NHLA 1JTHA 1E0HA 3WMM0 2FQ0A 3MTUE 2QJPC 2K0XA 5EW5E 3NXSA 4U0CA 1U7JA 5CCGA 3S4RA 2E74D 3AEDC 2OGUA 5AW8B 2L6EA 1JO5A 4I7ZC 3AECC 1LTJC 2KLUA 2FXOA 1DEBA 2LR2A 1NTMD 3L73D 3B5ND 3GG2A 3SWFA 2KGDA 4UB8H 3BRTB 2E75D 1IMPA 4XA4A 1JY2P 2FYZA 1IK7A 2BCCG 1LGHB 3DS4A 2KS1A 2L0QA 1SQXE 4JQ0D 1QX8A 1NTMK 5CCHC 4H2YC 5AVVB 3N4XA 3O8ZA 1LTSC 3II6A 2KGCA 4DJGA 1IUQA 1VHNA 3MZWB 3CWBG 3VRLC 1DX7A 3IFMA 3G21A 2KNCA 3CMEP 1KYOH 2A06E 1NTKJ 4D6TG 1OR5A 1UIIA 1N7LA 2H43A 4MN4C 1KILB 2N50A 3L70E 2K1AA 1BE3G 3L37A 2ZYAA 5APVA 2YO3A 1MZ8A 2CPBA 3I5CA 3ABVC 4N3YB 1JM0A 4JF7A 1LP1B 5APXA 5APQA 2M5RA 1BGYE 2HYNA 2FYUG 3SWYA 2QM7A 4R0MA 3CX5H 4PV1B 1RO2A 1OXZA 2J59M 1KQLA 1J1EB 2KK7A 4OWFA 2L4BA 1NU1E 3EJDA 1VQ5P 2AEMA 1VQ7P 2DW3A 2XT1A 1FU1A 5BVZA 2IZ0A 1EZVI 2KW2A 1IFNA 5F2OA 4JYCA 3M0AA 3ZDMA 1SQQE 2H89C 1EZVD 3L75E 2GM4A 2IYPA 2KB7P 2L91A 3HE4B 1NTZJ 1N73A 3HD7D 2OYHC 3HUSA 1NTKD 2K0YA 2KUBA 3H1LE 1UIXA 1YJWP 4C7NB 2E76B 3G0VA 3NFQA 3VOPA 1LTIC 1M1JB 1HGZA 1LTAC 2NO8A 5E79E 2WVRA 3H1JG 5KJ7C 1QLED 2FFDC 3DS1A 1PPJD 4EIJA 1GU4A 1KQFB 2E42A 4WY4A 3RK3C 3NY7B 1M8OB 5CCGC 3GKLC 2P9XA 3MUDA 1UJZA 1L4AD 3DS5A 5KLVJ 1FE6A 2E5YA 4HH2A 4IL6E 3PHLA 4GODA 3B8EB 4U0DA 4CPGA 2RH0A 2ERHA 3GZLA 4I7ZB 4HKZH 2XNDH 2QG4A 2IZ1A 4GOEA 4BRYB 1LTJB 2N98A 3DS0A 1VQLP 2K9JB 2Q9IA 1S5LH 2M8PA 2VSQA 3MGNA 1VQNP 2GZEA 2PEIA 1NTZD 3ITKA 2KG9A 1NQ4A 2ZT9D 1KQGB 4PJ0E 2A45G 3L73E 1P84I 3H1HE 4NPDA 2N5HA 2LIUA 1HWTC 1VQ8P 4LLHA 1P84D 1J2JB 1FZCC 2QJYC 3EJEA 1XTCC 4WB4A 4H0LD 2ROQA 1NTZK 1VQ4P 2JJLA 3TSIA 1CI6A 1VF5D 5HGLA 5KLVD 5AW5B 3MHVA 1K30A 3CC2P 5HGMA 2AFDA 1LT9C 2V7QH 1OVUA 4N6JA 1YTZI 1ZMBA 4U7JA 4OH8B 1S72P 3HRNA 1GL2D 2M8RA 2LL8A 1S9KD 4I1LA 1T8ZA 2OYIA 3PTZA 1F80D 2FVFA 3B4SA 1YBKA 1CZQA 2XV6A 2ZVNB 2ZYDA 4EOTA 3JCUH 3AEBC 4DT0A 2BCCE 1Q82Q 1FS0E 3TK1A 5APYA 2L22A 1CW5A 3A0HH 1A8OA 4U0BA 2O01N 1FOSE 4C7RA 1NOHA 3V2NA 2KOOA 3PH0A 3GLMA 3KZIH 3O6QA 2N9YB 2G8YA 4IFMA 1NO4A 3VP9A 1M56D 2L5GB 2P67A 1KN7A 3A2AA 1JY3P 3AE8C 3CXHI 1X0TA 5F2NA 2FKWB 3CXHD 4RJTA 2A45H 1PEOA 4HYTB 2YO2A 2HODB 1IFMA 2MKVA 3AE2C 3GF7A 1N73C 3CWBE 2LKIA 3CCUP 5KAFE 4OGQD 1Y8AA 4COPA 4COCA 3HUSC 5AVXB 4GOFA 1L0NJ 1USEA 2KORA 3C8VA 2AFEA 2Q5UA 4U0AA 4RO0A 2NPSB 4EI2A 2GDWA 4TT3H 1D7MA 2OYHB 2P1JA 3VMAA 1T3JA 2A06G 1OW6A 3OW2O 4PV1D 3MIWA 2FXMA 4XFZA 1N7SB 1RF0A 3WUVA 2Y9ZA 1QEXA 1JTHB 3H6PA 4BXLA 1T2KC 1W2EA 2VLPA 3RK2C 1GPJA 3D70A 1FOSF 1SQPD 3JC22 2KYVA 1RQUA 3L74E 5CJ4A 2QSIA 1BGYG 2CK3H 4DOJA 2LXCB 1KQSO 1Z56A 4GKGA 2WT7A 2BQ1E 3PP5A 4YPCA 3Q3DA 2EG5A 1AA0A 1SQPK 2JO1A 3CPWO 1VDFA 1NU1G 1IFIA 2DGYA 3A3YB 1PIXA 2KS1B 4CA3A 1MFZA 2XDJA 1M6NA 3CCLP 2R3SA 3L72J 3TGUD 2QM8A 5B5EE 2BEZF 5KP6B 4K3AA 2Z5IA 4H44C 3I56P 2GZFA 2QJYB 4WBAA 2UWJE 3KHUA 3AEEC 2KI7B 2GUSA 1GD2E 3AE6C 3L71G 2QVAA 2W6AA 3BCCE 5CZDB 4PXHB 3CCVP 1J1EC 3H1IG 2KNCB 3KYQA 3P8CE 3CCJP 2WITA 2O1JA 2M0BA 4RESB 2IPPA 3B5NA 2AEFA 1KLPA 3GHGC 2FHSC 2WSCH 2MR7A 3B4QA 2KG8A 2SPZA 3H4EA 1H89A 1JOCA 5CCHD 1NGMB 1YITP 1S4XA 2ONTA 2E76C 3L72D 5BU5A 3CD6P 3EFFK 1NTMG 3L73G 1ZN5A 1RNIA 2BEQD 2D2CB 3V5BA 1WRGA 2YNYA 4DCKA 1VQ6P 1OMIA 2AF8A 2XXMA
chains in the Genus database with same CATH topology
5I4TG 5F2KA 2M8PA 5F2NA 1M6NA 1YJNP 1RO2A 3CCLP 2LF4A 2Z44A 3CC7P 1VQNP 5BS1A 1BAJA 2PEIA 3Q20A 4U0EA 1PEOA 3G26A 2Z46A 2PEKA 1EIAA 5JPAA 2Z45A 1D1DA 2PEMA 3CCUP 3I55P 2OTJP 4COPA 5HGNA 1QRJA 4COCA 1VQ8P 1VQ5P 3DS4A 5DCKA 1VQ7P 2PEJA 2XT1A 3I56P 1K8AQ 3B5IA 2PY8A 3DS2A 1A43A 5F2OA 3HYBA 3G6EP 5BS2A 3CCMP 1VQ4P 1YI2P 4U0AA 4GR2A 3MGEA 2OARA 3G29A 5HGLA 3G28A 1Q86Q 3CXCO 2M8LA 1K30A 3CC2P 1PEUA 1K73Q 3CCVP 3NTEA 4GR6A 5HGOA 5HGMA 2EIAA 3OW2O 1YJWP 2EFJA 3DS3A 3G0VA 1JJ2O 4XFXA 1ZMBA 4XFZA 1S72P 2CWOA 2PEOA 1PEMA 3CCJP 2JYGA 1IUQA 4WYMA 1NJIQ 3LRYA 3DS1A 3CC4P 1M90Q 1QVFO 3E2DA 2QEXP 3CCEP 3VRLC 3H47A 3RG6C 2KODA 3M1MA 4PH1A 2XV6A 1YIJP 1N8RQ 3G1GA 3G21A 2P9XA 2E1MA 3DS5A 2JYLA 3CMEP 3HZQA 3H4EA 1M6EX 1VQPP 1VQ9P 1Q81Q 4QNBA 1YITP 1KQSO 1M1KQ 1E6JP 1Q82Q 1RO0A 2ONTA 4XROA 1AUMA 1EOQA 1YJ9P 1KC8Q 2BQ1E 3G1IA 3G71P 2OTLP 2M8NA 3P05A 1M74A 1A8OA 4U0BA 3G4SP 3CMAP 4PH0A 1KD1Q 2QA4P 3CCSP 2EG5A 4XFYA 2PEQA 3CD6P 4U0DA 4U0CA 2JO0A 1K9MQ 1Q7YQ 3DPHA 3CPWO 1RNIA 2L6EA 1W2BO 1YHQP 3DTJA 3CCRP 4IPYA 4XRQA 1VQOP 1VQKP 2BUOA 2DGYA 3H0DA 1VQMP 3WBHA 3CCQP 1QVGO 4U0FA 2PENA 3DS0A 1VQ6P 1PEQA 2BHVA 1VQLP 4M0IA 2XXMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YJ9 P;  2OTL P;  3G71 P;  3CCJ P;  3G6E P;  1YJN P;  3CCL P;  3G4S P;  3CMA P;  3CC7 P;  3CCM P;  1VQ4 P;  1YI2 P;  1NJI Q;  1VQN P;  1KD1 Q;  2QA4 P;  3CCS P;  3CC4 P;  1M90 Q;  1QVF O;  2QEX P;  3CD6 P;  3CCE P;  1Q86 Q;  3CXC O;  1K9M Q;  1Q7Y Q;  3CPW O;  1YIJ P;  3CC2 P;  1K73 Q;  1W2B O;  1YHQ P;  1N8R Q;  3CCV P;  3CCU P;  3I55 P;  3CCR P;  2OTJ P;  1VQO P;  1VQK P;  3CME P;  1VQ8 P;  1VQM P;  3OW2 O;  1VQ5 P;  1YJW P;  1VQP P;  3CCQ P;  1QVG O;  1Q81 Q;  1VQ7 P;  1VQ9 P;  1YIT P;  1KQS O;  1VQ6 P;  1M1K Q;  3I56 P;  1K8A Q;  1Q82 Q;  1JJ2 O;  1VQL P;  1S72 P;  1KC8 Q; 
#chains in the Genus database with same CATH topology
 4DG9 A;  1T6A A;  1GK6 A;  5L8R J;  1LTB C;  4RKU J;  2QE7 H;  1S3J A;  2IDB A;  4U0E A;  4LGD E;  2JR8 A;  1PP9 D;  1N73 B;  1URQ A;  3AE1 C;  1D1D A;  1WMK A;  3HUS B;  2FYN C;  2RMZ A;  3R4Y A;  1A02 J;  1N2D C;  1W5C E;  5E79 H;  5CHX A;  3FWN A;  2PY8 A;  2JU2 A;  1PL5 A;  3CCM P;  3VP8 A;  4WY4 B;  3U43 A;  4MRT C;  4U3F J;  2AEJ A;  4IL6 H;  1ZR2 A;  3BAS A;  3H1K J;  2Q1K A;  2M3B A;  2C9N Y;  2FAE A;  3CC4 P;  1GDT A;  4PWV B;  3RK2 B;  1KYO I;  2WWW A;  2KOD A;  2FXP A;  1DD3 A;  4GIF A;  3GZM A;  1ZRT D;  3USS A;  5AVQ B;  1KYO D;  2KZI A;  1FDI A;  1SQP E;  2RKL A;  2Z4E A;  2O01 H;  4W7Z A;  3M0D A;  4PJ0 H;  4PH0 A;  3EFG A;  1OW8 A;  3TYY A;  1RE4 A;  2G3A A;  2HFE D;  3DPH A;  5APS A;  2H88 C;  2HPC A;  5DJT B;  1Q90 D;  1M7L A;  3CX5 I;  1VQK P;  3HD7 A;  4D6T J;  2KG6 A;  5KJ7 D;  4BWN A;  2JAZ A;  1QVG O;  2XKM A;  2H7H A;  1X79 B;  3JSV C;  3CX5 D;  3RK3 D;  2FAC A;  4EYY Q;  4DZO A;  4ZMD A;  1BE3 J;  4L75 A;  2ZXX A;  3EWK A;  1CI6 B;  5KKZ C;  5APT A;  5AVR B;  2Y0C A;  2WSF H;  5KAI E;  4U3F D;  2MVV A;  3BAT A;  2OTJ P;  1SQB J;  1LTG C;  3H1K D;  1QRJ A;  3RL0 B;  4N78 D;  3TGU E;  4H44 B;  5TIS E;  1VL2 A;  1S1C X;  1L4A A;  2FYU J;  4I2L C;  1QL1 A;  3QWO C;  1OFC X;  2IX7 C;  2OYI B;  1X8Y A;  1PPJ G;  2VLN A;  3L74 G;  3NTE A;  3FWL A;  3D71 A;  2Y0E A;  3WUT A;  2M3E A;  4IFD K;  3VMY A;  1EXJ A;  1L0L J;  2K5X A;  5K5G B;  1T3U A;  5M1B A;  2KZJ A;  1RQV A;  1EXI A;  5KP7 B;  1QVF O;  2NPS C;  1BCC E;  4D6T D;  3GHG B;  2PAJ A;  4ZNC A;  3O6Q B;  1PGJ A;  5BU8 B;  1VKU A;  2IBZ I;  3KQG A;  3V6I A;  2V7Q J;  1AUM A;  1EOQ A;  1RHZ B;  3H1J J;  3G1I A;  1BE3 D;  1N7S C;  2IBZ D;  2GYK A;  2IFM A;  1AQT A;  2MD9 A;  3E1R A;  2JDI H;  5KAF H;  1FZB A;  3V4W A;  1NTZ G;  3L71 E;  4UHP B;  1GW4 A;  1SQB D;  3H32 A;  1NTK K;  1URQ C;  4R4M A;  2FYU D;  3H1I E;  1L0H A;  2ZXE B;  2LKM A;  2R32 A;  3IR9 A;  1GL2 A;  3TF5 A;  2YKO A;  2RN0 A;  1EIA A;  1SQB K;  3T97 A;  3BCC G;  3LW5 H;  1IZN B;  2FYU K;  2XU6 A;  3C1L A;  2FYN B;  5APU A;  1PP9 E;  2IFN A;  2R3C A;  1L0L D;  2ZYG A;  3P32 A;  3R2P A;  4C46 A;  3DS2 A;  3E1I A;  3HYB A;  3WU2 H;  1LT1 A;  2KOP A;  2M8L A;  1NKN A;  3BVH A;  1NTM E;  3RG2 A;  1G1J A;  5HGO A;  1L0L K;  5CBO A;  3KXD A;  3H1J D;  1GTW A;  2XV5 A;  2WT7 B;  3M9H A;  1SVF A;  2HG5 D;  3Q2Y A;  2CGQ A;  4JYB A;  1NAF A;  4WYM A;  4QMA A;  5TJH A;  1WT6 A;  5AVW B;  1SQV J;  3E2D A;  3FXE A;  5CMZ A;  3FX0 A;  2KOS A;  4LC1 A;  5AW2 B;  2CQ8 A;  2QRX A;  1RH5 B;  3KPE A;  1E6J P;  2XZ0 D;  4F37 A;  3GF3 A;  4AYC A;  1SP4 A;  3M91 A;  3VYI A;  2MJZ A;  5B5E H;  5CJ0 A;  5KLV K;  3CI9 A;  3W68 A;  1LWU A;  3DTJ A;  2MVU A;  1LP1 A;  1VQO P;  2K2Q A;  1IK9 A;  3IN6 A;  1PEQ A;  4NPF X;  2KOQ A;  1JB0 J;  2AVA A;  2JWD A;  3OA7 A;  1T2K D;  3OJA B;  4IZ6 A;  2P2U A;  2Z44 A;  3RK2 D;  5KKZ B;  3GW6 A;  3RK3 E;  2XNX A;  4PD4 I;  4W80 A;  1FZE A;  4UB6 E;  2JGP A;  1BSH A;  2NZ2 A;  3V2P A;  5HVC A;  4PD4 D;  2HLO A;  5AW6 B;  1K05 A;  2XZR A;  1IFJ A;  2FBW C;  1DNY A;  1SQX J;  2D2C C;  4U3F E;  3RGU A;  2PEJ A;  2KSE A;  1JUN A;  1R5S A;  4N78 E;  2W27 A;  1OX3 A;  4BPG A;  1SQV D;  1FJP A;  4YTP C;  1IFP A;  1AJY A;  1KTM A;  2MR8 A;  1Q86 Q;  1OVR A;  3B5N B;  3GMA A;  3D6Y A;  4H13 C;  1E79 H;  1HTL C;  2E75 B;  2ZT9 C;  1SQP G;  1DIP A;  1KIL D;  1M1J A;  1H0T A;  1SQV K;  1AFO A;  1HJB A;  1JMM A;  3KDP B;  1GU5 A;  1GXG A;  1ZV8 A;  1HUC A;  4H0L C;  1S2E A;  1BXI A;  4WY4 C;  4H44 D;  2K94 A;  1KB9 I;  1EZV E;  2GZG A;  1JCD A;  2Y9Y A;  4IFF A;  3VMX A;  1KFN A;  1VQP P;  3MUD C;  1KB9 D;  1M1K Q;  2JEE A;  2KSJ A;  1GMJ A;  1SFC A;  1NTK E;  3L70 J;  2YIU B;  3D6Z A;  2VLO A;  3HE5 A;  2LOL A;  2E43 A;  3CXH H;  2EHS A;  2VRS A;  3CE7 A;  1EQ7 A;  2WPS A;  2CPS A;  4L76 A;  2WPQ A;  1ACP A;  1URQ B;  1X9V A;  3WU2 E;  1PPJ E;  1SQX D;  1BGY J;  3TGU G;  3A7O A;  1EDJ A;  3IAO A;  1JCC A;  2WSC J;  1PZQ A;  5AW7 B;  1RF1 A;  2AXT E;  2K9J A;  2YKP A;  1GZL A;  3Q5S A;  3CC7 P;  4HB1 A;  5BS1 A;  1BAJ A;  3G9R A;  3G26 A;  1FAV A;  2PGD A;  2Z45 A;  1SQX K;  3AEF C;  3P8M C;  2E76 D;  1FDO A;  1L0N D;  1IMQ A;  1NAY A;  5AW1 B;  1SQQ J;  5CCH A;  2Z5H A;  3L75 J;  4BPH A;  1LTT C;  1TU3 F;  2YKQ A;  3AE7 C;  1ZME C;  1H88 A;  3NMD A;  2N1T A;  3VTP C;  2A06 D;  1BCC G;  1ZP0 C;  3H1L J;  1PEU A;  1K73 Q;  1NTZ E;  3LMO A;  2CNR A;  1L0N K;  1U7M A;  2R5B A;  5H2F E;  2W83 C;  3L70 D;  2K9Y A;  3RL0 C;  4XFX A;  1N86 A;  2PFX A;  3U1A A;  2XZ1 C;  1P84 E;  2ZVO B;  1IFD A;  2QEX P;  2OYI C;  1CSB A;  1BGY D;  4PH1 A;  2Q7C A;  2C9L Y;  2L9F A;  1GK4 A;  1Z6M A;  3IF4 A;  5KLV E;  1RO0 A;  2QJK C;  5AVZ B;  5AVS B;  3G71 P;  1OZH A;  5KAI H;  2QA4 P;  1BSN A;  4XFY A;  2PEQ A;  4GDO A;  1DD4 A;  2C0W A;  5TIS H;  3A0B E;  1G2C A;  1S9K E;  1W2B O;  1PP9 G;  1JY3 N;  5CBN A;  4I6M C;  2QNW A;  2IYO A;  1NYH A;  2PEN A;  1SQQ D;  3L75 D;  1L4A B;  1NWQ A;  1IJD B;  5F2K A;  2O3J A;  3MP7 B;  4NPE A;  2OTK E;  3M06 A;  2KGA A;  3H1L D;  1JEK A;  3H1H J;  4HKG A;  1X22 A;  1YYC A;  1SQQ K;  2JB0 A;  5DCK A;  4PD4 E;  5KP8 B;  5AW0 B;  1K8A Q;  4O9B A;  5KLI C;  1HVV A;  1FDM A;  1FC2 C;  2JP3 A;  5GTH E;  1YI2 P;  2Y0D A;  3G3Z A;  3AE5 C;  2J5U A;  2GZJ A;  3G28 A;  4H13 B;  1SQV E;  2ZT9 B;  3CXH E;  1HQB A;  2MF4 A;  5AW4 B;  2WSF J;  3RBZ A;  2EFJ A;  5KJ7 A;  1NVO A;  2FFD A;  2H8P D;  1SFC C;  1RF0 C;  3MD0 A;  1KIL E;  2M5A A;  4QKO A;  4H0L B;  4ZKP A;  5EJD A;  4K35 A;  3RL0 g;  1MFT A;  3H47 A;  3H32 B;  1ZNV A;  1VF5 B;  2FAD A;  2E1M A;  2BCC J;  1AVY A;  2JU1 A;  1EDK A;  1M6E X;  2POH A;  2EHT A;  2V4H A;  1RF1 C;  5APW A;  1KB9 E;  3V4Q A;  1X3O A;  3H1H D;  2JQ4 A;  3CCS P;  1GL2 B;  3T97 B;  2JO0 A;  2K92 A;  2GZI A;  1FJK A;  5GTI E;  1LJ2 A;  1PV3 A;  3TNU A;  4U3F G;  3WBH A;  4U0F A;  2KIK A;  3H1K G;  2OQQ A;  3V2R A;  5I4T G;  2NPS D;  4B86 A;  3Q20 A;  2Z46 A;  3CWB J;  2B87 A;  1MV8 A;  2N1T C;  2WSE H;  2WPT A;  1N7S D;  1JNM A;  1FZC A;  5EFW B;  1AYI A;  2B89 A;  3B5I A;  1AV1 A;  1ZW0 A;  2PP6 A;  3FGA D;  1L0N E;  3G6E P;  2B88 A;  2FY8 A;  3MGE A;  1URQ D;  5CCG D;  4H2W C;  1U57 A;  3G29 A;  4KHX A;  4AUW A;  1EZV G;  1L2P A;  4EDF A;  2BCC D;  3LW5 J;  1LT9 A;  3E7K A;  2HR3 A;  1PGQ A;  3HTK A;  2EIA A;  2E74 C;  1NTK G;  4OGQ B;  1YQ4 C;  1JMB A;  2PEO A;  3AE9 C;  1NJI Q;  2K0D X;  2IBZ G;  3A5T A;  1DEE G;  2KP8 A;  3L74 J;  2GDX A;  3U1C A;  5B66 E;  1LWU B;  3B5N C;  4KJM A;  1SQB G;  2E75 C;  2QJK B;  4QNB A;  2R44 A;  1KC8 Q;  1YJ9 P;  2YXR B;  2M8N A;  1SLQ A;  1XTG B;  4UB6 H;  4XFJ A;  3V2Q A;  3CWB D;  1KD1 Q;  1L0I A;  2WPV B;  2B9B A;  2K3R A;  3PLN A;  4XRQ A;  2VLQ A;  3QH9 A;  1VQM P;  3CCQ P;  3S9O A;  1LNQ A;  1BDD A;  1L0L G;  3P7K A;  1NKZ B;  1RY3 A;  2YIU C;  1ZLL A;  1HH0 A;  1G1I A;  3OAK A;  2YMY A;  4XE5 B;  1AQ5 A;  3LID A;  4YXW H;  3I55 P;  3L72 E;  2N6Z A;  5HGN A;  1K04 A;  1BDC A;  2JKV A;  5KLI B;  1ZXG A;  2ZFC A;  1H0T B;  5BS2 A;  2OAR A;  4BPF A;  3EJB A;  3PJS K;  3L74 D;  3BCC J;  4L74 A;  1IO4 A;  1JY2 N;  2DNW A;  1OVV A;  2I1K A;  4UB8 E;  4GR6 A;  1E5W A;  5KLV G;  3F89 A;  2GA1 A;  1JJ2 O;  1R5L A;  4JPZ B;  1SFC B;  1R8E A;  1PEM A;  2KGE A;  2JYG A;  2QJP B;  2WSS H;  3HE5 B;  3M9B A;  3LRY A;  1PFI A;  3AE3 C;  3CCE P;  2MY5 A;  5DJU B;  2D2C D;  2FQ1 A;  2FQ2 A;  2ZAE B;  5AVU B;  4H2X C;  2AXT H;  1DV5 A;  2JBG A;  3HZQ A;  4Y99 C;  1RF1 B;  3F5H A;  4XRO A;  2ZJS E;  2OTL P;  3K5B A;  3P05 A;  4H13 D;  2LXB A;  4OVN F;  3M0D C;  1GXH A;  2CG5 B;  1EDI A;  1Q7Y Q;  4R4L A;  2Q3E A;  1RE4 C;  3FXD A;  4IPY A;  2BUO A;  1Y9B A;  3HD7 C;  2BHV A;  1ZRT E;  1KYO E;  4Z1M H;  4WY4 D;  1HBW A;  1KIL A;  3BCC D;  1EMV A;  2N1T B;  1SQV G;  5JPA A;  5KTB A;  5H2F H;  2LML A;  3P8C D;  4IL6 X;  2GUV A;  3L4F A;  2P7J A;  3PRJ A;  2N5I A;  1YTZ T;  1JY3 O;  3VMZ A;  1P84 H;  1J1D C;  2GDY A;  5AW9 B;  2A45 I;  4WWI A;  1A43 A;  1L4A C;  3LIE A;  3U59 A;  4GR2 A;  1RE3 A;  3CX5 E;  1EC5 A;  3CLQ A;  3SSU A;  3H25 A;  2R5D A;  1FZG A;  3SFE C;  1KMI Z;  4ZKU A;  2W90 A;  1DH3 A;  2E74 B;  1USD A;  3DS3 A;  1FZF A;  2PRR A;  2BAS A;  3H1K E;  4NEO A;  3Q5P A;  3A0B H;  1M90 Q;  1AF8 A;  3HE4 A;  2W6J H;  3RG6 C;  3GHG A;  3AE4 C;  3EQ2 A;  1YIJ P;  1G2C B;  4IOI H;  2N9B A;  1SQP J;  2LPK A;  1ZR4 A;  2WMM A;  4C7N A;  1GW3 A;  1SQX G;  2FVE A;  3W67 A;  2C0X A;  2KOG A;  3AEG C;  4W7Y A;  3CMA P;  3L36 A;  4KT0 J;  2WPR A;  3RBX A;  3RL0 D;  4PD4 H;  1YHQ P;  3L35 A;  3CCR P;  3H0D A;  1VF5 C;  5GTH H;  4D6T E;  1T8K A;  4M0I A;  4M3L A;  1L0N G;  3AEA C;  2K88 A;  2LIW A;  1EDL A;  5HV8 A;  2AXC A;  1Y47 A;  1A02 F;  2PEK A;  1BE3 E;  1GL2 C;  1AVO A;  2IBZ E;  3TGU J;  3B71 A;  4BRY A;  1LTJ A;  1SQB E;  2FYU E;  2FFD B;  3L70 G;  2KXP B;  3WUU A;  3RK3 B;  2LTE A;  4Y28 J;  3TDK A;  2M5A B;  2N6Y A;  1S5L E;  1NH4 A;  2K37 A;  3C9I A;  3M9Q A;  3UIA A;  4AQR D;  1NU1 J;  2E5T A;  3CL3 D;  2W8Z A;  3Q1M A;  3BRV B;  2QIW A;  4JBZ A;  1KB9 H;  4WVZ A;  1HJ0 A;  2CWO A;  2O1K A;  3GJN A;  1KV4 A;  1L0L E;  2OYO A;  1BCC J;  1IC2 A;  1OIP A;  5AVY B;  5GTI H;  2KLV A;  3N7N A;  1KOR A;  1N8R Q;  1FR2 A;  3G1G A;  4Y99 B;  1VPC A;  3TNU B;  3S1K A;  1Q81 Q;  2KR5 A;  5AW3 B;  2X2B A;  1FBM A;  1HGV A;  4OGQ C;  2J58 A;  1SQQ G;  3L75 G;  2I1J A;  3G4S P;  3H1J E;  2NRG A;  1KIL C;  3L71 J;  1H8A A;  2B87 B;  1K9M Q;  3L72 G;  1UNK A;  3H1L G;  3H1I J;  3SWK A;  4YXD C;  2HPC B;  1SFC D;  1LWU C;  1S5L X;  3HD7 B;  1QGK B;  1FZC B;  1MUU A;  4TLF A;  4HJG H;  2ITA A;  2YXQ B;  3JCU E;  1YJN P;  2LF4 A;  2W6B A;  2K93 A;  4PV1 C;  4A7P A;  2WTY A;  1MZ9 A;  1NU1 D;  1RE3 C;  3A0H E;  7CEI A;  1PP9 J;  2PEM A;  2I8D A;  1LT9 B;  3HTK B;  3KZI E;  1J1D B;  1CEI A;  1BCC D;  3VN0 A;  2O01 J;  1NU1 K;  5B66 H;  1NTM J;  2WQY C;  3L73 J;  3CXC O;  2HOD A;  5C39 A;  5AVT B;  1KZU B;  2WSE J;  4ASV A;  1MKM A;  1PGO A;  1SS1 A;  2P58 A;  2Q6Q A;  4L73 A;  3NTN A;  2N1T D;  1HF9 A;  3L71 D;  2WZ7 A;  1M1J C;  1M57 D;  2Q3I A;  2PNG A;  2JWA A;  2NPS A;  1ZOY C;  2FVA A;  4ASW A;  3H1I D;  3H1H G;  1OW7 A;  2OYH A;  3M1M A;  1HY8 A;  1Q2N A;  1JY2 O;  1KFM A;  4GT1 A;  1PGP A;  2JYL A;  2P10 A;  1VQ9 P;  1QL2 A;  3Q5R A;  2KWL A;  1OWA A;  2YMK A;  1N7S A;  3SFD C;  1FZA A;  1YQ3 C;  1M74 A;  1NHL A;  1JTH A;  1E0H A;  3WMM 0;  2FQ0 A;  3MTU E;  2QJP C;  2K0X A;  5EW5 E;  3NXS A;  4U0C A;  1U7J A;  5CCG A;  3S4R A;  2E74 D;  3AED C;  2OGU A;  5AW8 B;  2L6E A;  1JO5 A;  4I7Z C;  3AEC C;  1LTJ C;  2KLU A;  2FXO A;  1DEB A;  2LR2 A;  1NTM D;  3L73 D;  3B5N D;  3GG2 A;  3SWF A;  2KGD A;  4UB8 H;  3BRT B;  2E75 D;  1IMP A;  4XA4 A;  1JY2 P;  2FYZ A;  1IK7 A;  2BCC G;  1LGH B;  3DS4 A;  2KS1 A;  2L0Q A;  1SQX E;  4JQ0 D;  1QX8 A;  1NTM K;  5CCH C;  4H2Y C;  5AVV B;  3N4X A;  3O8Z A;  1LTS C;  3II6 A;  2KGC A;  4DJG A;  1IUQ A;  1VHN A;  3MZW B;  3CWB G;  3VRL C;  1DX7 A;  3IFM A;  3G21 A;  2KNC A;  3CME P;  1KYO H;  2A06 E;  1NTK J;  4D6T G;  1OR5 A;  1UII A;  1N7L A;  2H43 A;  4MN4 C;  1KIL B;  2N50 A;  3L70 E;  2K1A A;  1BE3 G;  3L37 A;  2ZYA A;  5APV A;  2YO3 A;  1MZ8 A;  2CPB A;  3I5C A;  3ABV C;  4N3Y B;  1JM0 A;  4JF7 A;  1LP1 B;  5APX A;  5APQ A;  2M5R A;  1BGY E;  2HYN A;  2FYU G;  3SWY A;  2QM7 A;  4R0M A;  3CX5 H;  4PV1 B;  1RO2 A;  1OXZ A;  2J59 M;  1KQL A;  1J1E B;  2KK7 A;  4OWF A;  2L4B A;  1NU1 E;  3EJD A;  1VQ5 P;  2AEM A;  1VQ7 P;  2DW3 A;  2XT1 A;  1FU1 A;  5BVZ A;  2IZ0 A;  1EZV I;  2KW2 A;  1IFN A;  5F2O A;  4JYC A;  3M0A A;  3ZDM A;  1SQQ E;  2H89 C;  1EZV D;  3L75 E;  2GM4 A;  2IYP A;  2KB7 P;  2L91 A;  3HE4 B;  1NTZ J;  1N73 A;  3HD7 D;  2OYH C;  3HUS A;  1NTK D;  2K0Y A;  2KUB A;  3H1L E;  1UIX A;  1YJW P;  4C7N B;  2E76 B;  3G0V A;  3NFQ A;  3VOP A;  1LTI C;  1M1J B;  1HGZ A;  1LTA C;  2NO8 A;  5E79 E;  2WVR A;  3H1J G;  5KJ7 C;  1QLE D;  2FFD C;  3DS1 A;  1PPJ D;  4EIJ A;  1GU4 A;  1KQF B;  2E42 A;  4WY4 A;  3RK3 C;  3NY7 B;  1M8O B;  5CCG C;  3GKL C;  2P9X A;  3MUD A;  1UJZ A;  1L4A D;  3DS5 A;  5KLV J;  1FE6 A;  2E5Y A;  4HH2 A;  4IL6 E;  3PHL A;  4GOD A;  3B8E B;  4U0D A;  4CPG A;  2RH0 A;  2ERH A;  3GZL A;  4I7Z B;  4HKZ H;  2XND H;  2QG4 A;  2IZ1 A;  4GOE A;  4BRY B;  1LTJ B;  2N98 A;  3DS0 A;  1VQL P;  2K9J B;  2Q9I A;  1S5L H;  2M8P A;  2VSQ A;  3MGN A;  1VQN P;  2GZE A;  2PEI A;  1NTZ D;  3ITK A;  2KG9 A;  1NQ4 A;  2ZT9 D;  1KQG B;  4PJ0 E;  2A45 G;  3L73 E;  1P84 I;  3H1H E;  4NPD A;  2N5H A;  2LIU A;  1HWT C;  1VQ8 P;  4LLH A;  1P84 D;  1J2J B;  1FZC C;  2QJY C;  3EJE A;  1XTC C;  4WB4 A;  4H0L D;  2ROQ A;  1NTZ K;  1VQ4 P;  2JJL A;  3TSI A;  1CI6 A;  1VF5 D;  5HGL A;  5KLV D;  5AW5 B;  3MHV A;  1K30 A;  3CC2 P;  5HGM A;  2AFD A;  1LT9 C;  2V7Q H;  1OVU A;  4N6J A;  1YTZ I;  1ZMB A;  4U7J A;  4OH8 B;  1S72 P;  3HRN A;  1GL2 D;  2M8R A;  2LL8 A;  1S9K D;  4I1L A;  1T8Z A;  2OYI A;  3PTZ A;  1F80 D;  2FVF A;  3B4S A;  1YBK A;  1CZQ A;  2XV6 A;  2ZVN B;  2ZYD A;  4EOT A;  3JCU H;  3AEB C;  4DT0 A;  2BCC E;  1Q82 Q;  1FS0 E;  3TK1 A;  5APY A;  2L22 A;  1CW5 A;  3A0H H;  1A8O A;  4U0B A;  2O01 N;  1FOS E;  4C7R A;  1NOH A;  3V2N A;  2KOO A;  3PH0 A;  3GLM A;  3KZI H;  3O6Q A;  2N9Y B;  2G8Y A;  4IFM A;  1NO4 A;  3VP9 A;  1M56 D;  2L5G B;  2P67 A;  1KN7 A;  3A2A A;  1JY3 P;  3AE8 C;  3CXH I;  1X0T A;  5F2N A;  2FKW B;  3CXH D;  4RJT A;  2A45 H;  1PEO A;  4HYT B;  2YO2 A;  2HOD B;  1IFM A;  2MKV A;  3AE2 C;  3GF7 A;  1N73 C;  3CWB E;  2LKI A;  3CCU P;  5KAF E;  4OGQ D;  1Y8A A;  4COP A;  4COC A;  3HUS C;  5AVX B;  4GOF A;  1L0N J;  1USE A;  2KOR A;  3C8V A;  2AFE A;  2Q5U A;  4U0A A;  4RO0 A;  2NPS B;  4EI2 A;  2GDW A;  4TT3 H;  1D7M A;  2OYH B;  2P1J A;  3VMA A;  1T3J A;  2A06 G;  1OW6 A;  3OW2 O;  4PV1 D;  3MIW A;  2FXM A;  4XFZ A;  1N7S B;  1RF0 A;  3WUV A;  2Y9Z A;  1QEX A;  1JTH B;  3H6P A;  4BXL A;  1T2K C;  1W2E A;  2VLP A;  3RK2 C;  1GPJ A;  3D70 A;  1FOS F;  1SQP D;  3JC2 2;  2KYV A;  1RQU A;  3L74 E;  5CJ4 A;  2QSI A;  1BGY G;  2CK3 H;  4DOJ A;  2LXC B;  1KQS O;  1Z56 A;  4GKG A;  2WT7 A;  2BQ1 E;  3PP5 A;  4YPC A;  3Q3D A;  2EG5 A;  1AA0 A;  1SQP K;  2JO1 A;  3CPW O;  1VDF A;  1NU1 G;  1IFI A;  2DGY A;  3A3Y B;  1PIX A;  2KS1 B;  4CA3 A;  1MFZ A;  2XDJ A;  1M6N A;  3CCL P;  2R3S A;  3L72 J;  3TGU D;  2QM8 A;  5B5E E;  2BEZ F;  5KP6 B;  4K3A A;  2Z5I A;  4H44 C;  3I56 P;  2GZF A;  2QJY B;  4WBA A;  2UWJ E;  3KHU A;  3AEE C;  2KI7 B;  2GUS A;  1GD2 E;  3AE6 C;  3L71 G;  2QVA A;  2W6A A;  3BCC E;  5CZD B;  4PXH B;  3CCV P;  1J1E C;  3H1I G;  2KNC B;  3KYQ A;  3P8C E;  3CCJ P;  2WIT A;  2O1J A;  2M0B A;  4RES B;  2IPP A;  3B5N A;  2AEF A;  1KLP A;  3GHG C;  2FHS C;  2WSC H;  2MR7 A;  3B4Q A;  2KG8 A;  2SPZ A;  3H4E A;  1H89 A;  1JOC A;  5CCH D;  1NGM B;  1YIT P;  1S4X A;  2ONT A;  2E76 C;  3L72 D;  5BU5 A;  3CD6 P;  3EFF K;  1NTM G;  3L73 G;  1ZN5 A;  1RNI A;  2BEQ D;  2D2C B;  3V5B A;  1WRG A;  2YNY A;  4DCK A;  1VQ6 P;  1OMI A;  2AF8 A;  2XXM A; 
#chains in the Genus database with same CATH homology
 5I4T G;  5F2K A;  2M8P A;  5F2N A;  1M6N A;  1YJN P;  1RO2 A;  3CCL P;  2LF4 A;  2Z44 A;  3CC7 P;  1VQN P;  5BS1 A;  1BAJ A;  2PEI A;  3Q20 A;  4U0E A;  1PEO A;  3G26 A;  2Z46 A;  2PEK A;  1EIA A;  5JPA A;  2Z45 A;  1D1D A;  2PEM A;  3CCU P;  3I55 P;  2OTJ P;  4COP A;  5HGN A;  1QRJ A;  4COC A;  1VQ8 P;  1VQ5 P;  3DS4 A;  5DCK A;  1VQ7 P;  2PEJ A;  2XT1 A;  3I56 P;  1K8A Q;  3B5I A;  2PY8 A;  3DS2 A;  1A43 A;  5F2O A;  3HYB A;  3G6E P;  5BS2 A;  3CCM P;  1VQ4 P;  1YI2 P;  4U0A A;  4GR2 A;  3MGE A;  2OAR A;  3G29 A;  5HGL A;  3G28 A;  1Q86 Q;  3CXC O;  2M8L A;  1K30 A;  3CC2 P;  1PEU A;  1K73 Q;  3CCV P;  3NTE A;  4GR6 A;  5HGO A;  5HGM A;  2EIA A;  3OW2 O;  1YJW P;  2EFJ A;  3DS3 A;  3G0V A;  1JJ2 O;  4XFX A;  1ZMB A;  4XFZ A;  1S72 P;  2CWO A;  2PEO A;  1PEM A;  3CCJ P;  2JYG A;  1IUQ A;  4WYM A;  1NJI Q;  3LRY A;  3DS1 A;  3CC4 P;  1M90 Q;  1QVF O;  3E2D A;  2QEX P;  3CCE P;  3VRL C;  3H47 A;  3RG6 C;  2KOD A;  3M1M A;  4PH1 A;  2XV6 A;  1YIJ P;  1N8R Q;  3G1G A;  3G21 A;  2P9X A;  2E1M A;  3DS5 A;  2JYL A;  3CME P;  3HZQ A;  3H4E A;  1M6E X;  1VQP P;  1VQ9 P;  1Q81 Q;  4QNB A;  1YIT P;  1KQS O;  1M1K Q;  1E6J P;  1Q82 Q;  1RO0 A;  2ONT A;  4XRO A;  1AUM A;  1EOQ A;  1YJ9 P;  1KC8 Q;  2BQ1 E;  3G1I A;  3G71 P;  2OTL P;  2M8N A;  3P05 A;  1M74 A;  1A8O A;  4U0B A;  3G4S P;  3CMA P;  4PH0 A;  1KD1 Q;  2QA4 P;  3CCS P;  2EG5 A;  4XFY A;  2PEQ A;  3CD6 P;  4U0D A;  4U0C A;  2JO0 A;  1K9M Q;  1Q7Y Q;  3DPH A;  3CPW O;  1RNI A;  2L6E A;  1W2B O;  1YHQ P;  3DTJ A;  3CCR P;  4IPY A;  4XRQ A;  1VQO P;  1VQK P;  2BUO A;  2DGY A;  3H0D A;  1VQM P;  3WBH A;  3CCQ P;  1QVG O;  4U0F A;  2PEN A;  3DS0 A;  1VQ6 P;  1PEQ A;  2BHV A;  1VQL P;  4M0I A;  2XXM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...