1K73Q

Co-crystal structure of anisomycin bound to the 50s ribosomal subunit
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAKGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Five Antibiotics Bound at the Peptidyl Transferase Center of the Large Ribosomal Subunit
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S RRNA
total genus 47
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2001-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1k73Q02
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1k73Q01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1k73Q03
3CCRP 1NJIQ 1QVGO 3CCEP 3G4SP 3CC2P 1YHQP 3CCSP 1VQOP 1Q86Q 1K73Q 1KQSO 1QVFO 1YI2P 2OTJP 1KC8Q 3I55P 2OTLP 3CCQP 3CCLP 1S72P 1YIJP 3CCJP 1W2BO 1VQKP 3CC7P 3G71P 1VQ7P 1K9MQ 3G6EP 3CMEP 3CMAP 1Q82Q 3CXCO 1YJ9P 1YJNP 1VQNP 1KD1Q 1VQ8P 1VQLP 3I56P 1VQ6P 3CD6P 1M1KQ 1VQMP 1YITP 1N8RQ 3CCVP 1VQ4P 1YJWP 3CCUP 1VQ9P 3CC4P 2QA4P 3CCMP 1JJ2O 1VQPP 1Q7YQ 2QEXP 1VQ5P 1K8AQ 1Q81Q 3OW2O 3CPWO 1M90Q
chains in the Genus database with same CATH superfamily
1MV8A 5BU8B 1SQBE 4XA4A 1VHNA 2CQ8A 2IZ0A 3L72G 3IN6A 1JB0J 2ROQA 1AF8A 2P1JA 1CW5A 4R4LA 3G1IA 2HODA 3B71A 2Z44A 2W27A 1A02F 1NKNA 3L73E 3VTPC 3HE4B 1M57D 3H1IJ 3PJSK 2E75B 1YI2P 1FDIA 1KC8Q 2DNWA 2PRRA 2PEJA 2XV5A 1KB9H 2X2BA 2JU1A 3M06A 4XRQA 2Q3EA 1VQ8P 1YTZT 2ZYGA 4NPDA 1ZOYC 2FVAA 3JC22 1UIXA 2K9JB 2K9YA 4H2WC 4IZ6A 1MZ8A 3R2PA 3CL3D 1L4AA 4PH1A 1VF5B 2AEFA 1ZXGA 3L4FA 3CWBG 2K88A 1S5LH 4H2YC 1FZBA 5CHXA 1DEBA 2IBZG 1KFNA 2EFJA 5AW9B 3DS4A 3ABVC 3I5CA 4N78E 3B4QA 2POHA 2QE7H 1ZP0C 3HE5A 5KP8B 1BDDA 3VP8A 2E76D 3D6YA 3DS2A 2PGDA 4U3FD 1EQ7A 2M8NA 4H44C 2KZJA 3H1JJ 1VQMP 1QEXA 1USDA 3CCUP 1M6EX 1USEA 4RKUJ 2FXPA 3AECC 3GHGA 3A2AA 1JOCA 1S72P 1GL2A 2KWLA 1JCCA 2GM4A 1WT6A 1GW3A 2K92A 3V6IA 1VQ9P 3UIAA 1HQBA 3H1LG 2KOQA 1JM0A 1AYIA 1JY3O 4IOIH 2WZ7A 4GDOA 2LR2A 4LLHA 2PEQA 4H2XC 2N9YB 1S1CX 5CMZA 3WU2E 4H0LD 3H1IE 3GMAA 1FR2A 1M7LA 1W2BO 3BCCE 2RKLA 3MUDA 1SLQA 1T2KD 5CCGD 3B5NB 1VQ4P 1FZGA 2HPCA 3U43A 3L70E 1YQ3C 1ZW0A 2FYNB 2FY8A 1HGVA 1X8YA 3LMOA 2WT7A 1VL2A 1G2CA 5AVZB 4K3AA 2LKMA 2FACA 1N73A 3RK3D 1OMIA 2M5AB 3OAKA 2K0DX 3RG6C 3D70A 4I7ZB 2E1MA 3G9RA 3GF7A 2W90A 5KJ7C 1J1DB 1DNYA 1D7MA 1Y8AA 4H0LB 1SQQE 1N86A 1SQXD 2WPVB 2L5GB 1T2KC 1JMBA 4U0BA 3EFGA 3L72E 2V7QH 2PFXA 1KQSO 1FC2C 2LF4A 1LJ2A 1RQUA 3V5BA 2KGDA 1IFIA 1PEUA 1EC5A 3MZWB 1KYOD 1ZRTD 3B5NA 3E1IA 1NTZD 2IYPA 3AEAC 2Q6QA 1IK7A 2WSSH 1BXIA 1EZVE 1BCCD 2FYUE 1PP9D 3SWKA 1LWUB 3OJAB 2L9FA 3N4XA 4PV1D 5GTHE 1LTJB 1PGJA 5KJ7D 3QWOC 2LOLA 3KZIE 1DD4A 1KILC 3U59A 4HB1A 3RK2C 4F37A 1SQVD 3L72J 2OYIA 2OTKE 4HH2A 1ZR2A 3WBHA 1SQVG 1PZQA 5AVXB 1UJZA 4AYCA 2NPSA 4DCKA 2ZYDA 2BCCD 1SQPE 1LWUC 2KSEA 4EDFA 2BASA 3KHUA 5F2OA 2OGUA 3M9QA 5APQA 2MY5A 2Y0EA 2Y0DA 2R3SA 1KORA 5AW3B 2Q9IA 3H1HD 1A43A 2MD9A 1NTME 1H89A 3FXDA 3FWLA 2M5RA 3HZQA 1P84D 2CGQA 1URQA 1ACPA 2JWDA 3V2NA 2ONTA 2K94A 2K3RA 3HD7C 2AXTH 5HGOA 1J1DC 1SQVE 3PHLA 1RE4A 1NWQA 1BGYD 2OYIB 2ZXEB 2ZVNB 4WY4D 3IAOA 1BGYJ 2CG5B 1SQPG 3E1RA 1UNKA 1LGHB 1YITP 2WITA 4UB8H 1RQVA 1HBWA 3LIDA 1JJ2O 1UIIA 2RH0A 1CZQA 3HUSA 3CC2P 1M56D 4EI2A 1LP1A 4TT3H 2JKVA 1BCCE 2FYUD 3L73G 1GU4A 5B66H 3SFEC 2I1JA 5AVQB 1NTZE 1HY8A 2YXRB 2AXTE 3RL0g 1OW8A 1VPCA 5B5EE 3H1KD 2KNCA 1BE3E 4OGQC 1K05A 3CCEP 2KOOA 4JYBA 7CEIA 2JGPA 1LT1A 1RO0A 2EHSA 1EDLA 2FKWB 1SQQD 2GZIA 2QJPC 1HH0A 5HV8A 4PD4H 1QLED 3L36A 1Q81Q 2XZ1C 5AW2B 3RGUA 3PP5A 1PPJE 2GUSA 3H6PA 2OYIC 4BPGA 2N1TC 1X0TA 2O3JA 1BE3J 2E42A 3USSA 1KD1Q 2FHSC 2JQ4A 4WVZA 1Q2NA 1HJBA 2C9LY 3CCVP 1KILA 1EDJA 2R32A 2P9XA 3L70D 1KYOH 4BPHA 2QVAA 2HLOA 3DS1A 3TSIA 3G26A 3P7KA 3TGUE 5I4TG 4U0DA 5APXA 1EXIA 2GZFA 2C9NY 3L73J 1IFMA 2K0YA 1KB9D 3AE1C 3LW5J 2N98A 4U7JA 2FFDC 3RBXA 3H1IG 3CPWO 1IK9A 1NJIQ 2MVVA 1RY3A 2M8RA 1Q90D 1SQBJ 2FVFA 3JSVC 3Q2YA 1EZVG 4PD4D 3GF3A 3L75D 3CD6P 4YXWH 1N8RQ 3B8EB 1LP1B 2H88C 1GK4A 1XTGB 1XTCC 3H1KE 4L75A 1IMQA 3HTKB 3H1LD 2FYUJ 2VLQA 1G1JA 2OTJP 4COPA 2FYZA 4I2LC 1CSBA 2KOSA 1KILB 1L0LG 3VOPA 5BVZA 2YKPA 1BAJA 2G8YA 1PFIA 1ZMEC 1LT9A 4XROA 4JPZB 2J5UA 1GW4A 4N78D 3TGUG 1Q86Q 1AA0A 5AW4B 3G1GA 1BGYE 5AW5B 1SS1A 2FYUG 3ZDMA 1HWTC 3AE9C 1K04A 1T3UA 4OGQB 1J2JB 3GG2A 1BE3D 2JR8A 3CXHD 4W7YA 1HVVA 3DTJA 4U0CA 2IBZE 3A0BH 1VQKP 3AE3C 1RNIA 2KNCB 1NTMJ 4U0EA 1X3OA 2AFEA 3H1HE 1N7SA 3V4WA 2E75D 1OWAA 4PXHB 5M1BA 5CCHA 1AQTA 4U3FG 3AE2C 4GODA 1RE4C 1L4AC 5K5GB 1W2EA 1PGQA 2V7QJ 1U7MA 3HRNA 3QH9A 3WUVA 2NRGA 4IL6X 3U1CA 1IFDA 1FZCB 4JBZA 3HYBA 1KMIZ 3OW2O 3D71A 2WWWA 1BCCG 3RK2D 1DEEG 3L75J 1QVFO 2M8LA 1VF5D 1HF9A 2PENA 3CX5H 3BASA 4U3FJ 1QX8A 2K37A 2ZT9B 3L74G 1IZNB 2E75C 5APTA 2QM7A 1IFPA 2CWOA 2VLOA 1YBKA 5C39A 2Q7CA 4D6TD 3HD7B 3P8MC 2HFED 3CC7P 1URQB 1VQ7P 4DZOA 5CCHD 2KGCA 4YXDC 2E74D 4BRYB 1S3JA 5CBNA 2HODB 2XKMA 4PH0A 3Q5PA 2AVAA 1NTMG 2BEQD 2K2QA 1IUQA 1VQOP 4PD4E 1IFJA 5TISE 1T3JA 2BQ1E 2KG8A 1KV4A 1EDKA 1PP9J 4H13C 1CI6B 1NKZB 3C1LA 5AW7B 1AUMA 1KQLA 3HD7D 3G3ZA 3EQ2A 4RO0A 2WPTA 1RE3C 3EFFK 4Z1MH 1Q7YQ 5AVSB 1R8EA 1OW7A 2LXCB 1JO5A 1DX7A 1MFTA 1SQXG 4BXLA 5KKZC 1GL2C 1NGMB 1GU5A 3TGUD 1AFOA 2WSFJ 2N9BA 1VKUA 1NHLA 1OVUA 3H1JG 5HGNA 5KLIC 3WMM0 1NTZK 2M8PA 1N73C 4WYMA 2JJLA 2WPQA 2FXMA 1ZLLA 3HE4A 2Z4EA 3GKLC 4IFMA 2R5BA 2N6ZA 5AW6B 2EIAA 2I1KA 4Y99C 1Q82Q 1FZCA 5KTBA 1AVYA 4M0IA 4YTPC 1PGPA 1N7SC 3FX0A 2LIWA 3BRVB 1LNQA 2FFDB 4C7NB 2M0BA 2L4BA 2LIUA 2WSCJ 1EMVA 3TYYA 1IMPA 1OIPA 2B89A 4R4MA 3RK3B 5GTHH 2E5TA 1M6NA 4UB8E 3Q5RA 3AE5C 5EFWB 1GPJA 1VQ5P 3CXHH 2FADA 1FZAA 4D6TE 1SFCC 2FXOA 2IZ1A 2LPKA 2JO1A 2JAZA 2KB7P 3A7OA 2RN0A 2XZ0D 3BCCD 3H1KJ 4ASWA 1PPJD 2NPSC 1KQFB 2L0QA 2YKQA 1ZV8A 2QNWA 3BCCG 1PPJG 1OZHA 1KFMA 1MFZA 2JEEA 1EXJA 2P10A 3GW6A 3VMYA 1JUNA 2FBWC 5APSA 2UWJE 2J59M 2XV6A 1PV3A 1YIJP 1NU1E 2YKOA 5AW1B 3IF4A 1JY2O 4W80A 2YMKA 1CEIA 3G21A 1PP9G 3KPEA 2W6BA 1M8OB 4OVNF 1RF0C 4I6MC 3W68A 2E74B 4IPYA 1X79B 2J58A 5HGLA 3F5HA 1WMKA 4U0FA 5H2FE 3TGUJ 1NTMD 2XNDH 4Y28J 3H0DA 5KAIE 2WVRA 4R0MA 5KLIB 1DIPA 4KHXA 1LT9B 3G71P 2H8PD 2NPSD 3EWKA 1YJ9P 1URQD 1SQVK 2KK7A 2YO2A 4PJ0E 2IFMA 3L73D 2WTYA 2C0XA 3R4YA 2BCCG 3KZIH 2KG6A 2BCCE 1LWUA 2E5YA 1GDTA 2VLPA 2Y0CA 4UHPB 4H13B 4COCA 4CPGA 2OQQA 3AE8C 2B88A 2NZ2A 1N73B 2MF4A 1S4XA 4C7NA 2CK3H 1OW6A 1SQPK 4GOEA 1LTIC 2A45G 2D2CD 2L6EA 2WSFH 3CI9A 3H1LJ 4HYTB 2B87A 1URQC 1HUCA 1FBMA 5E79E 1G2CB 1ZR4A 1PEMA 1NU1G 2QEXP 1GTWA 4AUWA 3W67A 2FQ1A 3H1KG 5KLVE 4XE5B 1BCCJ 1BE3G 1NH4A 2G3AA 3CXHE 3M0AA 3M0DA 2KOGA 3TDKA 2KYVA 3O8ZA 3MHVA 3L75E 1D1DA 3KXDA 1FE6A 1SQQJ 1E0HA 3CCRP 1RF1C 1NTMK 5BS2A 1SQXE 4GOFA 1TU3F 5APWA 1NTKE 2KGAA 2OYOA 3A0BE 2MVUA 4QNBA 3AEBC 2E76C 3BVHA 3VP9A 4WBAA 1GL2B 3BRTB 4WY4A 5TISH 1LTJC 1PIXA 2FQ0A 2A06G 5H2FH 1KB9E 2IFNA 4QKOA 5L8RJ 2FFDA 3G28A 3VN0A 5AVVB 3L70G 5KAFE 1EIAA 4BRYA 3H1LE 4KJMA 3E7KA 2MR7A 2GDWA 1PGOA 2CPSA 2IBZI 1Z56A 2XDJA 1YHQP 2E74C 3F89A 3SFDC 4ZKUA 3MIWA 1HJ0A 3H1ID 4H0LC 2BHVA 3EJDA 2B87B 2WPRA 2FAEA 1NU1K 2QJPB 4N3YB 2CNRA 1VQPP 1Y47A 2QRXA 3RK3E 2BEZF 3G4SP 1S9KD 1S5LX 2NO8A 2AEMA 2D2CB 3CXHI 3NTNA 1RHZB 4WB4A 1A8OA 5APVA 2YIUC 3PTZA 4WWIA 1KLPA 2OYHC 1FZFA 1R5SA 2HR3A 4LGDE 1WRGA 1VQ6P 3AE7C 3C8VA 3CC4P 2MR8A 1EOQA 2ZT9D 3DPHA 1OVVA 2AEJA 2KS1A 2KIKA 2KR5A 3RL0B 4IL6E 3V2PA 4WY4B 3LIEA 3MD0A 1NAFA 4C46A 2JWAA 4GKGA 5CCGC 1YYCA 1NQ4A 3FXEA 2HYNA 5AW8B 4UB6H 2W8ZA 5KLVG 5APUA 2EG5A 3VMAA 1SVFA 1Z6MA 4EIJA 3WUTA 1SFCB 3FWNA 1LTSC 3GZMA 1OFCX 1J1EC 1L0NJ 2P58A 3B5NC 3Q3DA 1N7SD 1P84E 3C9IA 3RK3C 4A7PA 2RMZA 4JYCA 4YPCA 3S9OA 5JPAA 5APYA 2O01J 1K73Q 5KJ7A 1NTKG 1K30A 2QJYB 5DJUB 1FDOA 3H32B 5KLVK 3VYIA 1JY2N 2H7HA 3AEFC 2LXBA 3NXSA 5B5EH 1H0TB 1SQBG 2XNXA 3MGNA 5AVYB 2N5IA 1AJYA 1SQBD 2A45I 2O01N 1OR5A 4IL6H 2PEOA 1NTKK 2YMYA 1PEQA 2VRSA 2KGEA 2QJYC 4OH8B 1NAYA 5CJ0A 1H8AA 2WQYC 4PV1B 5CCHC 3CCSP 3L71D 3II6A 3KQGA 4D6TJ 3HTKA 2N1TD 3T97B 3OA7A 2WPSA 2I8DA 2IDBA 1KTMA 4TLFA 3CWBD 1RF1A 3IFMA 2OTLP 1KYOE 1ZRTE 3L35A 3HE5B 2IBZD 1SQPJ 2H89C 3JCUE 5AVUB 1IC2A 2IX7C 5EW5E 4KT0J 1FU1A 1RE3A 2P2UA 3CX5E 1GXHA 2K93A 2A06E 3H47A 4B86A 4WY4C 1IJDB 4IFFA 2AF8A 1SQVJ 3L72D 3A0HE 2YO3A 2PEMA 1PEOA 2IYOA 2JO0A 2K0XA 3WU2H 3Q1MA 1L0IA 3EJBA 2VLNA 2KOPA 2KW2A 1L0ND 1M1JA 1FJKA 3PRJA 2O1JA 5AVTB 1L0LE 4DOJA 1T8KA 1ZMBA 2ERHA 2PEKA 4QMAA 3NTEA 3GJNA 2QM8A 2EHTA 2PY8A 2KG9A 2JU2A 3CCQP 1PL5A 3GLMA 4UB6E 3G6EP 3CMAP 3HD7A 1A02J 1E79H 1X22A 2QA4P 1L0LK 2QJKC 3HUSC 3L37A 1EZVI 4DJGA 1SQBK 2WT7B 4PV1C 4EOTA 3P8CD 2N6YA 2YNYA 4GR2A 2XT1A 3A3YB 3S4RA 2N1TA 3Q5SA 4L73A 5HVCA 1SFCD 2DGYA 1JCDA 4IFDK 4MRTC 1EDIA 1N2DC 1H88A 4D6TG 2HG5D 3SWFA 1T8ZA 1MZ9A 1T6AA 2P7JA 5E79H 4U0AA 2Q1KA 1NOHA 3CCLP 1OXZA 3M91A 1IFNA 4LC1A 3CXCO 5DCKA 2M5AA 1LTGC 1GL2D 3KDPB 3TNUB 4GIFA 4U3FE 2ZJSE 3RK2B 2E43A 1LTAC 1AVOA 2Y9ZA 5BU5A 1JY3N 2GDYA 1RF0A 5KLVJ 3LRYA 2PP6A 2GZGA 1DD3A 3Q20A 3DS5A 2C0WA 3M9HA 4C7RA 2M3BA 4XFJA 3KYQA 3S1KA 3CCMP 1L0LJ 1W5CE 2B9BA 1FAVA 1OVRA 1G1IA 3H25A 2N5HA 2PNGA 1VF5C 3NFQA 1JMMA 1E6JP 3AE6C 4NPFX 4O9BA 3P8CE 5DJTB 1YTZI 1FOSF 1RF1B 3B5IA 1ZN5A 3I56P 1HTLC 3H1HJ 1FS0E 2K5XA 3RG2A 4W7ZA 3BATA 1J1EB 2FYUK 1GZLA 3TK1A 2BCCJ 4AQRD 3EJEA 2N1TB 2LKIA 2L91A 3AEGC 3M9BA 2FQ2A 1CI6A 2KODA 2KSJA 1MUUA 2D2CC 3H32A 4I1LA 2FVEA 3A0HH 2V4HA 2ZXXA 3V4QA 3B4SA 2LTEA 2SPZA 4H13D 3GZLA 1H0TA 1LT9C 5GTIH 3ITKA 1M1KQ 1SQQG 1FJPA 1AV1A 1JTHA 3CE7A 1NTZG 4HJGH 3DS0A 1KB9I 2QJKB 3HUSB 3SSUA 2JP3A 3AE4C 1NU1J 1NVOA 3VRLC 3K5BA 4XFXA 1S5LE 5AVWB 3V2RA 4ZMDA 1DV5A 3O6QA 1JY2P 3M1MA 3GHGB 1BSNA 3G0VA 1FDMA 3L74E 4NEOA 3CCJP 2A06D 3N7NA 3TNUA 3M0DC 2N50A 2ZYAA 4N6JA 4PJ0H 2IPPA 5CJ4A 5EJDA 2H43A 1SQPD 1M1JC 3L74J 2GYKA 2WSCH 2L22A 3NMDA 2GZJA 2QIWA 1N7LA 2WSEJ 2Z5IA 2Q5UA 4BWNA 1U57A 3L71E 2MKVA 2R5DA 1JNMA 3PLNA 1LTJA 1L0NE 1QVGO 2Z5HA 2W6JH 1GXGA 1P84H 1DH3A 3H1HG 4ZKPA 3D6ZA 4MN4C 2QG4A 1PP9E 1KILE 1LTTC 3H4EA 1EZVD 3CX5D 2KI7B 1QGKB 2ZT9C 3H1JE 1E5WA 2R44A 1M1JB 1SQQK 2LMLA 1U7JA 2NPSB 4JF7A 4H44D 5KP7B 2M3EA 2XU6A 1L0HA 2KUBA 1KYOI 3VMZA 3L71G 2WSEH 4L74A 3CMEP 2Q3IA 1QL2A 4HKGA 2QSIA 3CX5I 2AXCA 2KXPB 1M90Q 1M74A 2P67A 3PH0A 1KQGB 1OX3A 4DG9A 1JY3P 4GR6A 1NU1D 4PD4I 5F2NA 2OYHA 2GZEA 1L2PA 2KLVA 2JBGA 3L71J 1YJWP 2R3CA 5KP6B 1ZNVA 1SQXJ 3RL0D 3WUUA 1NTZJ 2GDXA 2BUOA 3JCUH 3AEDC 3CWBJ 2OARA 3I55P 1L0NG 3MTUE 3SWYA 2E76B 3RBZA 4JQ0D 2AFDA 2GUVA 3P05A 2KZIA 5HGMA 1IO4A 1X9VA 2JB0A 3A5TA 2YXQB 3NY7B 3B5ND 2ITAA 3FGAD 1L4AD 1MKMA 1VDFA 2Z46A 5AW0B 3P32A 1YQ4C 3CLQA 1S9KE 1FZEA 3VMXA 1KN7A 3DS3A 1BGYG 4GT1A 5KAFH 5TJHA 1BSHA 2ZFCA 1RH5B 2ZAEB 2KORA 1Y9BA 3AEEC 1NTKJ 2K9JA 2HPCB 3IR9A 2PEIA 4OGQD 2LL8A 2JDIH 2KP8A 1K9MQ 3V2QA 5CCGA 5BS1A 4XFYA 1NYHA 1GD2E 2FYNC 2MJZA 2W83C 1FZCC 3G29A 2Z45A 3E2DA 4I7ZC 2YIUB 4OWFA 2OYHB 2KLUA 4CA3A 1R5LA 4RJTA 5B66E 2KS1B 4ZNCA 4EYYQ 1KILD 2A45H 3L70J 4RESB 3RL0C 1F80D 2XXMA 4PWVB 1BDCA 1RO2A 2GA1A 5GTIE 1L0NK 1JEKA 1SP4A 3MGEA 2O1KA 4HKZH 3U1AA 4ASVA 2WMMA 4Y99B 2JYGA 5AVRB 4DT0A 3GHGC 3T97A 1SFCA 1SQXK 4L76A 1K8AQ 2CPBA 4NPEA 1L4AB 1KZUB 4XFZA 3L75G 4H44B 1GK6A 1JTHB 1N7SB 3BCCJ 4BPFA 2W6AA 1VQNP 2Y9YA 5KLVD 3CWBE 2XZRA 5KKZB 3H1JD 2ZVOB 3O6QB 1S2EA 2VSQA 1QRJA 1P84I 2DW3A 3L74D 1FOSE 3MP7B 5F2KA 2PAJA 1L0LD 4M3LA 1LTBC 1QL1A 5CZDB 1HGZA 1NO4A 1GMJA 2K1AA 1AQ5A 3TF5A 1YJNP 2JYLA 1VQLP 5CBOA 1NTKD 4K35A 3LW5H 2O01H 5KAIH 3MUDC
chains in the Genus database with same CATH topology
2LF4A 5JPAA 3VRLC 1YHQP 1IUQA 1VQOP 1M74A 4XFXA 1K73Q 3DS1A 1K30A 3G26A 5HGOA 3G29A 3DTJA 3M1MA 2Z45A 3E2DA 2L6EA 5I4TG 4U0CA 2BHVA 3G0VA 3LRYA 4U0DA 1S72P 1PEUA 2BQ1E 3CCJP 1VQKP 3Q20A 1RNIA 4GR6A 1AUMA 3DS5A 5F2NA 3G1IA 4U0EA 1ZMBA 2Z44A 1YITP 1YJWP 1VQ9P 3CCMP 1PEMA 1JJ2O 1VQPP 1Q7YQ 2QEXP 3CPWO 2XXMA 2PEKA 1NJIQ 3NTEA 3G4SP 3CC2P 1RO2A 2PY8A 2BUOA 1YI2P 2PEQA 2OARA 1KC8Q 3I55P 3CCQP 3MGEA 1E6JP 2XV6A 2PEJA 1YIJP 1A8OA 1W2BO 2PEOA 3G6EP 4XRQA 2JYGA 3B5IA 3CMAP 1PEQA 5HGNA 3G21A 3P05A 1VQ8P 3I56P 1VQ6P 3CD6P 2M8PA 5HGMA 1N8RQ 1VQ4P 4WYMA 3CC4P 2QA4P 1D1DA 3HYBA 1K8AQ 3OW2O 4IPYA 5HGLA 3WBHA 3CCRP 1QVGO 3CCEP 5BS2A 3CCSP 4U0FA 1QVFO 4PH1A 2M8LA 1EOQA 2OTJP 3DPHA 4COPA 4QNBA 4XFZA 1RO0A 2PENA 3H0DA 2Z46A 4GR2A 2XT1A 3G71P 2EIAA 1Q82Q 3H4EA 5F2OA 1BAJA 1YJ9P 1VQNP 2DGYA 2KODA 3DS3A 2EFJA 4M0IA 3DS4A 3RG6C 4XROA 1Q81Q 2OTLP 1QRJA 3G28A 2E1MA 1Q86Q 2CWOA 2EG5A 1A43A 5F2KA 4U0AA 2PEIA 3G1GA 3CCLP 3H47A 3CC7P 1EIAA 1VQ7P 3DS2A 1K9MQ 3CMEP 3CXCO 1YJNP 5DCKA 1M6NA 3HZQA 4COCA 1KD1Q 2JYLA 2M8NA 4XFYA 5BS1A 1VQLP 4U0BA 1M1KQ 1VQMP 3CCVP 2PEMA 1PEOA 2JO0A 3CCUP 1M6EX 4PH0A 3DS0A 2P9XA 1VQ5P 2ONTA 1KQSO 1M90Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCR P;  1NJI Q;  1QVG O;  3CCE P;  3G4S P;  3CC2 P;  1YHQ P;  3CCS P;  1VQO P;  1Q86 Q;  1K73 Q;  1KQS O;  1QVF O;  1YI2 P;  2OTJ P;  1KC8 Q;  3I55 P;  2OTL P;  3CCQ P;  3CCL P;  1S72 P;  1YIJ P;  3CCJ P;  1W2B O;  1VQK P;  3CC7 P;  3G71 P;  1VQ7 P;  1K9M Q;  3G6E P;  3CME P;  3CMA P;  1Q82 Q;  3CXC O;  1YJ9 P;  1YJN P;  1VQN P;  1KD1 Q;  1VQ8 P;  1VQL P;  3I56 P;  1VQ6 P;  3CD6 P;  1M1K Q;  1VQM P;  1YIT P;  1N8R Q;  3CCV P;  1VQ4 P;  1YJW P;  3CCU P;  1VQ9 P;  3CC4 P;  2QA4 P;  3CCM P;  1JJ2 O;  1VQP P;  1Q7Y Q;  2QEX P;  1VQ5 P;  1K8A Q;  1Q81 Q;  3OW2 O;  3CPW O;  1M90 Q; 
#chains in the Genus database with same CATH topology
 1MV8 A;  5BU8 B;  1SQB E;  4XA4 A;  1VHN A;  2CQ8 A;  2IZ0 A;  3L72 G;  3IN6 A;  1JB0 J;  2ROQ A;  1AF8 A;  2P1J A;  1CW5 A;  4R4L A;  3G1I A;  2HOD A;  3B71 A;  2Z44 A;  2W27 A;  1A02 F;  1NKN A;  3L73 E;  3VTP C;  3HE4 B;  1M57 D;  3H1I J;  3PJS K;  2E75 B;  1YI2 P;  1FDI A;  1KC8 Q;  2DNW A;  2PRR A;  2PEJ A;  2XV5 A;  1KB9 H;  2X2B A;  2JU1 A;  3M06 A;  4XRQ A;  2Q3E A;  1VQ8 P;  1YTZ T;  2ZYG A;  4NPD A;  1ZOY C;  2FVA A;  3JC2 2;  1UIX A;  2K9J B;  2K9Y A;  4H2W C;  4IZ6 A;  1MZ8 A;  3R2P A;  3CL3 D;  1L4A A;  4PH1 A;  1VF5 B;  2AEF A;  1ZXG A;  3L4F A;  3CWB G;  2K88 A;  1S5L H;  4H2Y C;  1FZB A;  5CHX A;  1DEB A;  2IBZ G;  1KFN A;  2EFJ A;  5AW9 B;  3DS4 A;  3ABV C;  3I5C A;  4N78 E;  3B4Q A;  2POH A;  2QE7 H;  1ZP0 C;  3HE5 A;  5KP8 B;  1BDD A;  3VP8 A;  2E76 D;  3D6Y A;  3DS2 A;  2PGD A;  4U3F D;  1EQ7 A;  2M8N A;  4H44 C;  2KZJ A;  3H1J J;  1VQM P;  1QEX A;  1USD A;  3CCU P;  1M6E X;  1USE A;  4RKU J;  2FXP A;  3AEC C;  3GHG A;  3A2A A;  1JOC A;  1S72 P;  1GL2 A;  2KWL A;  1JCC A;  2GM4 A;  1WT6 A;  1GW3 A;  2K92 A;  3V6I A;  1VQ9 P;  3UIA A;  1HQB A;  3H1L G;  2KOQ A;  1JM0 A;  1AYI A;  1JY3 O;  4IOI H;  2WZ7 A;  4GDO A;  2LR2 A;  4LLH A;  2PEQ A;  4H2X C;  2N9Y B;  1S1C X;  5CMZ A;  3WU2 E;  4H0L D;  3H1I E;  3GMA A;  1FR2 A;  1M7L A;  1W2B O;  3BCC E;  2RKL A;  3MUD A;  1SLQ A;  1T2K D;  5CCG D;  3B5N B;  1VQ4 P;  1FZG A;  2HPC A;  3U43 A;  3L70 E;  1YQ3 C;  1ZW0 A;  2FYN B;  2FY8 A;  1HGV A;  1X8Y A;  3LMO A;  2WT7 A;  1VL2 A;  1G2C A;  5AVZ B;  4K3A A;  2LKM A;  2FAC A;  1N73 A;  3RK3 D;  1OMI A;  2M5A B;  3OAK A;  2K0D X;  3RG6 C;  3D70 A;  4I7Z B;  2E1M A;  3G9R A;  3GF7 A;  2W90 A;  5KJ7 C;  1J1D B;  1DNY A;  1D7M A;  1Y8A A;  4H0L B;  1SQQ E;  1N86 A;  1SQX D;  2WPV B;  2L5G B;  1T2K C;  1JMB A;  4U0B A;  3EFG A;  3L72 E;  2V7Q H;  2PFX A;  1KQS O;  1FC2 C;  2LF4 A;  1LJ2 A;  1RQU A;  3V5B A;  2KGD A;  1IFI A;  1PEU A;  1EC5 A;  3MZW B;  1KYO D;  1ZRT D;  3B5N A;  3E1I A;  1NTZ D;  2IYP A;  3AEA C;  2Q6Q A;  1IK7 A;  2WSS H;  1BXI A;  1EZV E;  1BCC D;  2FYU E;  1PP9 D;  3SWK A;  1LWU B;  3OJA B;  2L9F A;  3N4X A;  4PV1 D;  5GTH E;  1LTJ B;  1PGJ A;  5KJ7 D;  3QWO C;  2LOL A;  3KZI E;  1DD4 A;  1KIL C;  3U59 A;  4HB1 A;  3RK2 C;  4F37 A;  1SQV D;  3L72 J;  2OYI A;  2OTK E;  4HH2 A;  1ZR2 A;  3WBH A;  1SQV G;  1PZQ A;  5AVX B;  1UJZ A;  4AYC A;  2NPS A;  4DCK A;  2ZYD A;  2BCC D;  1SQP E;  1LWU C;  2KSE A;  4EDF A;  2BAS A;  3KHU A;  5F2O A;  2OGU A;  3M9Q A;  5APQ A;  2MY5 A;  2Y0E A;  2Y0D A;  2R3S A;  1KOR A;  5AW3 B;  2Q9I A;  3H1H D;  1A43 A;  2MD9 A;  1NTM E;  1H89 A;  3FXD A;  3FWL A;  2M5R A;  3HZQ A;  1P84 D;  2CGQ A;  1URQ A;  1ACP A;  2JWD A;  3V2N A;  2ONT A;  2K94 A;  2K3R A;  3HD7 C;  2AXT H;  5HGO A;  1J1D C;  1SQV E;  3PHL A;  1RE4 A;  1NWQ A;  1BGY D;  2OYI B;  2ZXE B;  2ZVN B;  4WY4 D;  3IAO A;  1BGY J;  2CG5 B;  1SQP G;  3E1R A;  1UNK A;  1LGH B;  1YIT P;  2WIT A;  4UB8 H;  1RQV A;  1HBW A;  3LID A;  1JJ2 O;  1UII A;  2RH0 A;  1CZQ A;  3HUS A;  3CC2 P;  1M56 D;  4EI2 A;  1LP1 A;  4TT3 H;  2JKV A;  1BCC E;  2FYU D;  3L73 G;  1GU4 A;  5B66 H;  3SFE C;  2I1J A;  5AVQ B;  1NTZ E;  1HY8 A;  2YXR B;  2AXT E;  3RL0 g;  1OW8 A;  1VPC A;  5B5E E;  3H1K D;  2KNC A;  1BE3 E;  4OGQ C;  1K05 A;  3CCE P;  2KOO A;  4JYB A;  7CEI A;  2JGP A;  1LT1 A;  1RO0 A;  2EHS A;  1EDL A;  2FKW B;  1SQQ D;  2GZI A;  2QJP C;  1HH0 A;  5HV8 A;  4PD4 H;  1QLE D;  3L36 A;  1Q81 Q;  2XZ1 C;  5AW2 B;  3RGU A;  3PP5 A;  1PPJ E;  2GUS A;  3H6P A;  2OYI C;  4BPG A;  2N1T C;  1X0T A;  2O3J A;  1BE3 J;  2E42 A;  3USS A;  1KD1 Q;  2FHS C;  2JQ4 A;  4WVZ A;  1Q2N A;  1HJB A;  2C9L Y;  3CCV P;  1KIL A;  1EDJ A;  2R32 A;  2P9X A;  3L70 D;  1KYO H;  4BPH A;  2QVA A;  2HLO A;  3DS1 A;  3TSI A;  3G26 A;  3P7K A;  3TGU E;  5I4T G;  4U0D A;  5APX A;  1EXI A;  2GZF A;  2C9N Y;  3L73 J;  1IFM A;  2K0Y A;  1KB9 D;  3AE1 C;  3LW5 J;  2N98 A;  4U7J A;  2FFD C;  3RBX A;  3H1I G;  3CPW O;  1IK9 A;  1NJI Q;  2MVV A;  1RY3 A;  2M8R A;  1Q90 D;  1SQB J;  2FVF A;  3JSV C;  3Q2Y A;  1EZV G;  4PD4 D;  3GF3 A;  3L75 D;  3CD6 P;  4YXW H;  1N8R Q;  3B8E B;  1LP1 B;  2H88 C;  1GK4 A;  1XTG B;  1XTC C;  3H1K E;  4L75 A;  1IMQ A;  3HTK B;  3H1L D;  2FYU J;  2VLQ A;  1G1J A;  2OTJ P;  4COP A;  2FYZ A;  4I2L C;  1CSB A;  2KOS A;  1KIL B;  1L0L G;  3VOP A;  5BVZ A;  2YKP A;  1BAJ A;  2G8Y A;  1PFI A;  1ZME C;  1LT9 A;  4XRO A;  4JPZ B;  2J5U A;  1GW4 A;  4N78 D;  3TGU G;  1Q86 Q;  1AA0 A;  5AW4 B;  3G1G A;  1BGY E;  5AW5 B;  1SS1 A;  2FYU G;  3ZDM A;  1HWT C;  3AE9 C;  1K04 A;  1T3U A;  4OGQ B;  1J2J B;  3GG2 A;  1BE3 D;  2JR8 A;  3CXH D;  4W7Y A;  1HVV A;  3DTJ A;  4U0C A;  2IBZ E;  3A0B H;  1VQK P;  3AE3 C;  1RNI A;  2KNC B;  1NTM J;  4U0E A;  1X3O A;  2AFE A;  3H1H E;  1N7S A;  3V4W A;  2E75 D;  1OWA A;  4PXH B;  5M1B A;  5CCH A;  1AQT A;  4U3F G;  3AE2 C;  4GOD A;  1RE4 C;  1L4A C;  5K5G B;  1W2E A;  1PGQ A;  2V7Q J;  1U7M A;  3HRN A;  3QH9 A;  3WUV A;  2NRG A;  4IL6 X;  3U1C A;  1IFD A;  1FZC B;  4JBZ A;  3HYB A;  1KMI Z;  3OW2 O;  3D71 A;  2WWW A;  1BCC G;  3RK2 D;  1DEE G;  3L75 J;  1QVF O;  2M8L A;  1VF5 D;  1HF9 A;  2PEN A;  3CX5 H;  3BAS A;  4U3F J;  1QX8 A;  2K37 A;  2ZT9 B;  3L74 G;  1IZN B;  2E75 C;  5APT A;  2QM7 A;  1IFP A;  2CWO A;  2VLO A;  1YBK A;  5C39 A;  2Q7C A;  4D6T D;  3HD7 B;  3P8M C;  2HFE D;  3CC7 P;  1URQ B;  1VQ7 P;  4DZO A;  5CCH D;  2KGC A;  4YXD C;  2E74 D;  4BRY B;  1S3J A;  5CBN A;  2HOD B;  2XKM A;  4PH0 A;  3Q5P A;  2AVA A;  1NTM G;  2BEQ D;  2K2Q A;  1IUQ A;  1VQO P;  4PD4 E;  1IFJ A;  5TIS E;  1T3J A;  2BQ1 E;  2KG8 A;  1KV4 A;  1EDK A;  1PP9 J;  4H13 C;  1CI6 B;  1NKZ B;  3C1L A;  5AW7 B;  1AUM A;  1KQL A;  3HD7 D;  3G3Z A;  3EQ2 A;  4RO0 A;  2WPT A;  1RE3 C;  3EFF K;  4Z1M H;  1Q7Y Q;  5AVS B;  1R8E A;  1OW7 A;  2LXC B;  1JO5 A;  1DX7 A;  1MFT A;  1SQX G;  4BXL A;  5KKZ C;  1GL2 C;  1NGM B;  1GU5 A;  3TGU D;  1AFO A;  2WSF J;  2N9B A;  1VKU A;  1NHL A;  1OVU A;  3H1J G;  5HGN A;  5KLI C;  3WMM 0;  1NTZ K;  2M8P A;  1N73 C;  4WYM A;  2JJL A;  2WPQ A;  2FXM A;  1ZLL A;  3HE4 A;  2Z4E A;  3GKL C;  4IFM A;  2R5B A;  2N6Z A;  5AW6 B;  2EIA A;  2I1K A;  4Y99 C;  1Q82 Q;  1FZC A;  5KTB A;  1AVY A;  4M0I A;  4YTP C;  1PGP A;  1N7S C;  3FX0 A;  2LIW A;  3BRV B;  1LNQ A;  2FFD B;  4C7N B;  2M0B A;  2L4B A;  2LIU A;  2WSC J;  1EMV A;  3TYY A;  1IMP A;  1OIP A;  2B89 A;  4R4M A;  3RK3 B;  5GTH H;  2E5T A;  1M6N A;  4UB8 E;  3Q5R A;  3AE5 C;  5EFW B;  1GPJ A;  1VQ5 P;  3CXH H;  2FAD A;  1FZA A;  4D6T E;  1SFC C;  2FXO A;  2IZ1 A;  2LPK A;  2JO1 A;  2JAZ A;  2KB7 P;  3A7O A;  2RN0 A;  2XZ0 D;  3BCC D;  3H1K J;  4ASW A;  1PPJ D;  2NPS C;  1KQF B;  2L0Q A;  2YKQ A;  1ZV8 A;  2QNW A;  3BCC G;  1PPJ G;  1OZH A;  1KFM A;  1MFZ A;  2JEE A;  1EXJ A;  2P10 A;  3GW6 A;  3VMY A;  1JUN A;  2FBW C;  5APS A;  2UWJ E;  2J59 M;  2XV6 A;  1PV3 A;  1YIJ P;  1NU1 E;  2YKO A;  5AW1 B;  3IF4 A;  1JY2 O;  4W80 A;  2YMK A;  1CEI A;  3G21 A;  1PP9 G;  3KPE A;  2W6B A;  1M8O B;  4OVN F;  1RF0 C;  4I6M C;  3W68 A;  2E74 B;  4IPY A;  1X79 B;  2J58 A;  5HGL A;  3F5H A;  1WMK A;  4U0F A;  5H2F E;  3TGU J;  1NTM D;  2XND H;  4Y28 J;  3H0D A;  5KAI E;  2WVR A;  4R0M A;  5KLI B;  1DIP A;  4KHX A;  1LT9 B;  3G71 P;  2H8P D;  2NPS D;  3EWK A;  1YJ9 P;  1URQ D;  1SQV K;  2KK7 A;  2YO2 A;  4PJ0 E;  2IFM A;  3L73 D;  2WTY A;  2C0X A;  3R4Y A;  2BCC G;  3KZI H;  2KG6 A;  2BCC E;  1LWU A;  2E5Y A;  1GDT A;  2VLP A;  2Y0C A;  4UHP B;  4H13 B;  4COC A;  4CPG A;  2OQQ A;  3AE8 C;  2B88 A;  2NZ2 A;  1N73 B;  2MF4 A;  1S4X A;  4C7N A;  2CK3 H;  1OW6 A;  1SQP K;  4GOE A;  1LTI C;  2A45 G;  2D2C D;  2L6E A;  2WSF H;  3CI9 A;  3H1L J;  4HYT B;  2B87 A;  1URQ C;  1HUC A;  1FBM A;  5E79 E;  1G2C B;  1ZR4 A;  1PEM A;  1NU1 G;  2QEX P;  1GTW A;  4AUW A;  3W67 A;  2FQ1 A;  3H1K G;  5KLV E;  4XE5 B;  1BCC J;  1BE3 G;  1NH4 A;  2G3A A;  3CXH E;  3M0A A;  3M0D A;  2KOG A;  3TDK A;  2KYV A;  3O8Z A;  3MHV A;  3L75 E;  1D1D A;  3KXD A;  1FE6 A;  1SQQ J;  1E0H A;  3CCR P;  1RF1 C;  1NTM K;  5BS2 A;  1SQX E;  4GOF A;  1TU3 F;  5APW A;  1NTK E;  2KGA A;  2OYO A;  3A0B E;  2MVU A;  4QNB A;  3AEB C;  2E76 C;  3BVH A;  3VP9 A;  4WBA A;  1GL2 B;  3BRT B;  4WY4 A;  5TIS H;  1LTJ C;  1PIX A;  2FQ0 A;  2A06 G;  5H2F H;  1KB9 E;  2IFN A;  4QKO A;  5L8R J;  2FFD A;  3G28 A;  3VN0 A;  5AVV B;  3L70 G;  5KAF E;  1EIA A;  4BRY A;  3H1L E;  4KJM A;  3E7K A;  2MR7 A;  2GDW A;  1PGO A;  2CPS A;  2IBZ I;  1Z56 A;  2XDJ A;  1YHQ P;  2E74 C;  3F89 A;  3SFD C;  4ZKU A;  3MIW A;  1HJ0 A;  3H1I D;  4H0L C;  2BHV A;  3EJD A;  2B87 B;  2WPR A;  2FAE A;  1NU1 K;  2QJP B;  4N3Y B;  2CNR A;  1VQP P;  1Y47 A;  2QRX A;  3RK3 E;  2BEZ F;  3G4S P;  1S9K D;  1S5L X;  2NO8 A;  2AEM A;  2D2C B;  3CXH I;  3NTN A;  1RHZ B;  4WB4 A;  1A8O A;  5APV A;  2YIU C;  3PTZ A;  4WWI A;  1KLP A;  2OYH C;  1FZF A;  1R5S A;  2HR3 A;  4LGD E;  1WRG A;  1VQ6 P;  3AE7 C;  3C8V A;  3CC4 P;  2MR8 A;  1EOQ A;  2ZT9 D;  3DPH A;  1OVV A;  2AEJ A;  2KS1 A;  2KIK A;  2KR5 A;  3RL0 B;  4IL6 E;  3V2P A;  4WY4 B;  3LIE A;  3MD0 A;  1NAF A;  4C46 A;  2JWA A;  4GKG A;  5CCG C;  1YYC A;  1NQ4 A;  3FXE A;  2HYN A;  5AW8 B;  4UB6 H;  2W8Z A;  5KLV G;  5APU A;  2EG5 A;  3VMA A;  1SVF A;  1Z6M A;  4EIJ A;  3WUT A;  1SFC B;  3FWN A;  1LTS C;  3GZM A;  1OFC X;  1J1E C;  1L0N J;  2P58 A;  3B5N C;  3Q3D A;  1N7S D;  1P84 E;  3C9I A;  3RK3 C;  4A7P A;  2RMZ A;  4JYC A;  4YPC A;  3S9O A;  5JPA A;  5APY A;  2O01 J;  1K73 Q;  5KJ7 A;  1NTK G;  1K30 A;  2QJY B;  5DJU B;  1FDO A;  3H32 B;  5KLV K;  3VYI A;  1JY2 N;  2H7H A;  3AEF C;  2LXB A;  3NXS A;  5B5E H;  1H0T B;  1SQB G;  2XNX A;  3MGN A;  5AVY B;  2N5I A;  1AJY A;  1SQB D;  2A45 I;  2O01 N;  1OR5 A;  4IL6 H;  2PEO A;  1NTK K;  2YMY A;  1PEQ A;  2VRS A;  2KGE A;  2QJY C;  4OH8 B;  1NAY A;  5CJ0 A;  1H8A A;  2WQY C;  4PV1 B;  5CCH C;  3CCS P;  3L71 D;  3II6 A;  3KQG A;  4D6T J;  3HTK A;  2N1T D;  3T97 B;  3OA7 A;  2WPS A;  2I8D A;  2IDB A;  1KTM A;  4TLF A;  3CWB D;  1RF1 A;  3IFM A;  2OTL P;  1KYO E;  1ZRT E;  3L35 A;  3HE5 B;  2IBZ D;  1SQP J;  2H89 C;  3JCU E;  5AVU B;  1IC2 A;  2IX7 C;  5EW5 E;  4KT0 J;  1FU1 A;  1RE3 A;  2P2U A;  3CX5 E;  1GXH A;  2K93 A;  2A06 E;  3H47 A;  4B86 A;  4WY4 C;  1IJD B;  4IFF A;  2AF8 A;  1SQV J;  3L72 D;  3A0H E;  2YO3 A;  2PEM A;  1PEO A;  2IYO A;  2JO0 A;  2K0X A;  3WU2 H;  3Q1M A;  1L0I A;  3EJB A;  2VLN A;  2KOP A;  2KW2 A;  1L0N D;  1M1J A;  1FJK A;  3PRJ A;  2O1J A;  5AVT B;  1L0L E;  4DOJ A;  1T8K A;  1ZMB A;  2ERH A;  2PEK A;  4QMA A;  3NTE A;  3GJN A;  2QM8 A;  2EHT A;  2PY8 A;  2KG9 A;  2JU2 A;  3CCQ P;  1PL5 A;  3GLM A;  4UB6 E;  3G6E P;  3CMA P;  3HD7 A;  1A02 J;  1E79 H;  1X22 A;  2QA4 P;  1L0L K;  2QJK C;  3HUS C;  3L37 A;  1EZV I;  4DJG A;  1SQB K;  2WT7 B;  4PV1 C;  4EOT A;  3P8C D;  2N6Y A;  2YNY A;  4GR2 A;  2XT1 A;  3A3Y B;  3S4R A;  2N1T A;  3Q5S A;  4L73 A;  5HVC A;  1SFC D;  2DGY A;  1JCD A;  4IFD K;  4MRT C;  1EDI A;  1N2D C;  1H88 A;  4D6T G;  2HG5 D;  3SWF A;  1T8Z A;  1MZ9 A;  1T6A A;  2P7J A;  5E79 H;  4U0A A;  2Q1K A;  1NOH A;  3CCL P;  1OXZ A;  3M91 A;  1IFN A;  4LC1 A;  3CXC O;  5DCK A;  2M5A A;  1LTG C;  1GL2 D;  3KDP B;  3TNU B;  4GIF A;  4U3F E;  2ZJS E;  3RK2 B;  2E43 A;  1LTA C;  1AVO A;  2Y9Z A;  5BU5 A;  1JY3 N;  2GDY A;  1RF0 A;  5KLV J;  3LRY A;  2PP6 A;  2GZG A;  1DD3 A;  3Q20 A;  3DS5 A;  2C0W A;  3M9H A;  4C7R A;  2M3B A;  4XFJ A;  3KYQ A;  3S1K A;  3CCM P;  1L0L J;  1W5C E;  2B9B A;  1FAV A;  1OVR A;  1G1I A;  3H25 A;  2N5H A;  2PNG A;  1VF5 C;  3NFQ A;  1JMM A;  1E6J P;  3AE6 C;  4NPF X;  4O9B A;  3P8C E;  5DJT B;  1YTZ I;  1FOS F;  1RF1 B;  3B5I A;  1ZN5 A;  3I56 P;  1HTL C;  3H1H J;  1FS0 E;  2K5X A;  3RG2 A;  4W7Z A;  3BAT A;  1J1E B;  2FYU K;  1GZL A;  3TK1 A;  2BCC J;  4AQR D;  3EJE A;  2N1T B;  2LKI A;  2L91 A;  3AEG C;  3M9B A;  2FQ2 A;  1CI6 A;  2KOD A;  2KSJ A;  1MUU A;  2D2C C;  3H32 A;  4I1L A;  2FVE A;  3A0H H;  2V4H A;  2ZXX A;  3V4Q A;  3B4S A;  2LTE A;  2SPZ A;  4H13 D;  3GZL A;  1H0T A;  1LT9 C;  5GTI H;  3ITK A;  1M1K Q;  1SQQ G;  1FJP A;  1AV1 A;  1JTH A;  3CE7 A;  1NTZ G;  4HJG H;  3DS0 A;  1KB9 I;  2QJK B;  3HUS B;  3SSU A;  2JP3 A;  3AE4 C;  1NU1 J;  1NVO A;  3VRL C;  3K5B A;  4XFX A;  1S5L E;  5AVW B;  3V2R A;  4ZMD A;  1DV5 A;  3O6Q A;  1JY2 P;  3M1M A;  3GHG B;  1BSN A;  3G0V A;  1FDM A;  3L74 E;  4NEO A;  3CCJ P;  2A06 D;  3N7N A;  3TNU A;  3M0D C;  2N50 A;  2ZYA A;  4N6J A;  4PJ0 H;  2IPP A;  5CJ4 A;  5EJD A;  2H43 A;  1SQP D;  1M1J C;  3L74 J;  2GYK A;  2WSC H;  2L22 A;  3NMD A;  2GZJ A;  2QIW A;  1N7L A;  2WSE J;  2Z5I A;  2Q5U A;  4BWN A;  1U57 A;  3L71 E;  2MKV A;  2R5D A;  1JNM A;  3PLN A;  1LTJ A;  1L0N E;  1QVG O;  2Z5H A;  2W6J H;  1GXG A;  1P84 H;  1DH3 A;  3H1H G;  4ZKP A;  3D6Z A;  4MN4 C;  2QG4 A;  1PP9 E;  1KIL E;  1LTT C;  3H4E A;  1EZV D;  3CX5 D;  2KI7 B;  1QGK B;  2ZT9 C;  3H1J E;  1E5W A;  2R44 A;  1M1J B;  1SQQ K;  2LML A;  1U7J A;  2NPS B;  4JF7 A;  4H44 D;  5KP7 B;  2M3E A;  2XU6 A;  1L0H A;  2KUB A;  1KYO I;  3VMZ A;  3L71 G;  2WSE H;  4L74 A;  3CME P;  2Q3I A;  1QL2 A;  4HKG A;  2QSI A;  3CX5 I;  2AXC A;  2KXP B;  1M90 Q;  1M74 A;  2P67 A;  3PH0 A;  1KQG B;  1OX3 A;  4DG9 A;  1JY3 P;  4GR6 A;  1NU1 D;  4PD4 I;  5F2N A;  2OYH A;  2GZE A;  1L2P A;  2KLV A;  2JBG A;  3L71 J;  1YJW P;  2R3C A;  5KP6 B;  1ZNV A;  1SQX J;  3RL0 D;  3WUU A;  1NTZ J;  2GDX A;  2BUO A;  3JCU H;  3AED C;  3CWB J;  2OAR A;  3I55 P;  1L0N G;  3MTU E;  3SWY A;  2E76 B;  3RBZ A;  4JQ0 D;  2AFD A;  2GUV A;  3P05 A;  2KZI A;  5HGM A;  1IO4 A;  1X9V A;  2JB0 A;  3A5T A;  2YXQ B;  3NY7 B;  3B5N D;  2ITA A;  3FGA D;  1L4A D;  1MKM A;  1VDF A;  2Z46 A;  5AW0 B;  3P32 A;  1YQ4 C;  3CLQ A;  1S9K E;  1FZE A;  3VMX A;  1KN7 A;  3DS3 A;  1BGY G;  4GT1 A;  5KAF H;  5TJH A;  1BSH A;  2ZFC A;  1RH5 B;  2ZAE B;  2KOR A;  1Y9B A;  3AEE C;  1NTK J;  2K9J A;  2HPC B;  3IR9 A;  2PEI A;  4OGQ D;  2LL8 A;  2JDI H;  2KP8 A;  1K9M Q;  3V2Q A;  5CCG A;  5BS1 A;  4XFY A;  1NYH A;  1GD2 E;  2FYN C;  2MJZ A;  2W83 C;  1FZC C;  3G29 A;  2Z45 A;  3E2D A;  4I7Z C;  2YIU B;  4OWF A;  2OYH B;  2KLU A;  4CA3 A;  1R5L A;  4RJT A;  5B66 E;  2KS1 B;  4ZNC A;  4EYY Q;  1KIL D;  2A45 H;  3L70 J;  4RES B;  3RL0 C;  1F80 D;  2XXM A;  4PWV B;  1BDC A;  1RO2 A;  2GA1 A;  5GTI E;  1L0N K;  1JEK A;  1SP4 A;  3MGE A;  2O1K A;  4HKZ H;  3U1A A;  4ASV A;  2WMM A;  4Y99 B;  2JYG A;  5AVR B;  4DT0 A;  3GHG C;  3T97 A;  1SFC A;  1SQX K;  4L76 A;  1K8A Q;  2CPB A;  4NPE A;  1L4A B;  1KZU B;  4XFZ A;  3L75 G;  4H44 B;  1GK6 A;  1JTH B;  1N7S B;  3BCC J;  4BPF A;  2W6A A;  1VQN P;  2Y9Y A;  5KLV D;  3CWB E;  2XZR A;  5KKZ B;  3H1J D;  2ZVO B;  3O6Q B;  1S2E A;  2VSQ A;  1QRJ A;  1P84 I;  2DW3 A;  3L74 D;  1FOS E;  3MP7 B;  5F2K A;  2PAJ A;  1L0L D;  4M3L A;  1LTB C;  1QL1 A;  5CZD B;  1HGZ A;  1NO4 A;  1GMJ A;  2K1A A;  1AQ5 A;  3TF5 A;  1YJN P;  2JYL A;  1VQL P;  5CBO A;  1NTK D;  4K35 A;  3LW5 H;  2O01 H;  5KAI H;  3MUD C; 
#chains in the Genus database with same CATH homology
 2LF4 A;  5JPA A;  3VRL C;  1YHQ P;  1IUQ A;  1VQO P;  1M74 A;  4XFX A;  1K73 Q;  3DS1 A;  1K30 A;  3G26 A;  5HGO A;  3G29 A;  3DTJ A;  3M1M A;  2Z45 A;  3E2D A;  2L6E A;  5I4T G;  4U0C A;  2BHV A;  3G0V A;  3LRY A;  4U0D A;  1S72 P;  1PEU A;  2BQ1 E;  3CCJ P;  1VQK P;  3Q20 A;  1RNI A;  4GR6 A;  1AUM A;  3DS5 A;  5F2N A;  3G1I A;  4U0E A;  1ZMB A;  2Z44 A;  1YIT P;  1YJW P;  1VQ9 P;  3CCM P;  1PEM A;  1JJ2 O;  1VQP P;  1Q7Y Q;  2QEX P;  3CPW O;  2XXM A;  2PEK A;  1NJI Q;  3NTE A;  3G4S P;  3CC2 P;  1RO2 A;  2PY8 A;  2BUO A;  1YI2 P;  2PEQ A;  2OAR A;  1KC8 Q;  3I55 P;  3CCQ P;  3MGE A;  1E6J P;  2XV6 A;  2PEJ A;  1YIJ P;  1A8O A;  1W2B O;  2PEO A;  3G6E P;  4XRQ A;  2JYG A;  3B5I A;  3CMA P;  1PEQ A;  5HGN A;  3G21 A;  3P05 A;  1VQ8 P;  3I56 P;  1VQ6 P;  3CD6 P;  2M8P A;  5HGM A;  1N8R Q;  1VQ4 P;  4WYM A;  3CC4 P;  2QA4 P;  1D1D A;  3HYB A;  1K8A Q;  3OW2 O;  4IPY A;  5HGL A;  3WBH A;  3CCR P;  1QVG O;  3CCE P;  5BS2 A;  3CCS P;  4U0F A;  1QVF O;  4PH1 A;  2M8L A;  1EOQ A;  2OTJ P;  3DPH A;  4COP A;  4QNB A;  4XFZ A;  1RO0 A;  2PEN A;  3H0D A;  2Z46 A;  4GR2 A;  2XT1 A;  3G71 P;  2EIA A;  1Q82 Q;  3H4E A;  5F2O A;  1BAJ A;  1YJ9 P;  1VQN P;  2DGY A;  2KOD A;  3DS3 A;  2EFJ A;  4M0I A;  3DS4 A;  3RG6 C;  4XRO A;  1Q81 Q;  2OTL P;  1QRJ A;  3G28 A;  2E1M A;  1Q86 Q;  2CWO A;  2EG5 A;  1A43 A;  5F2K A;  4U0A A;  2PEI A;  3G1G A;  3CCL P;  3H47 A;  3CC7 P;  1EIA A;  1VQ7 P;  3DS2 A;  1K9M Q;  3CME P;  3CXC O;  1YJN P;  5DCK A;  1M6N A;  3HZQ A;  4COC A;  1KD1 Q;  2JYL A;  2M8N A;  4XFY A;  5BS1 A;  1VQL P;  4U0B A;  1M1K Q;  1VQM P;  3CCV P;  2PEM A;  1PEO A;  2JO0 A;  3CCU P;  1M6E X;  4PH0 A;  3DS0 A;  2P9X A;  1VQ5 P;  2ONT A;  1KQS O;  1M90 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...