1K73Q

Co-crystal structure of anisomycin bound to the 50s ribosomal subunit
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAKGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title Structures of Five Antibiotics Bound at the Peptidyl Transferase Center of the Large Ribosomal Subunit
pubmed doi rcsb
molecule tags Ribosome
total genus 47
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2001-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1k73Q02
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1k73Q01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1k73Q03
3CMEP 1S72P 1VQPP 3CCQP 1YJNP 1K9MQ 1KD1Q 1VQLP 3CCJP 3G6EP 3CMAP 1NJIQ 1K73Q 1JJ2O 1Q82Q 1YI2P 1YITP 1VQ4P 1VQNP 1YHQP 1Q86Q 1W2BO 1KC8Q 1N8RQ 3I56P 2QA4P 3CCEP 1QVFO 1VQKP 3CCVP 3CD6P 1K8AQ 3CCSP 1KQSO 1VQ5P 1VQ9P 3CC7P 3CC2P 3G4SP 1M1KQ 3G71P 1Q7YQ 3CCLP 1Q81Q 3CXCO 2OTLP 2OTJP 2QEXP 1YJWP 3CPWO 3CCRP 1VQMP 1VQOP 1YIJP 1VQ7P 3CC4P 1VQ8P 1QVGO 1VQ6P 3CCMP 3I55P 3OW2O 3CCUP 1YJ9P 1M90Q
chains in the Genus database with same CATH superfamily
1SS1A 1AVYA 2C0WA 1NJIQ 4UB8E 5HGNA 2KS1A 2E76B 1NTKK 4I7ZB 3H1IE 1GL2B 5HVCA 4GODA 3SFEC 4UB6E 1K05A 4JYBA 3GHGC 4HH2A 4IFFA 2G3AA 1Z56A 3HTKB 5BS1A 1NU1K 1LT9A 5TISH 1RE4A 1AF8A 5BU8B 5DJUB 2AXTE 2Z4EA 2M0BA 3H1HJ 1YBKA 5KP7B 5KLIC 4U0BA 1IO4A 3BVHA 1MKMA 1PGOA 1S1CX 1OVUA 2FFDC 1YJNP 2FYUG 1IC2A 3HUSC 4PJ0H 2WSFH 2N9BA 3NTNA 1NVOA 1CZQA 2PNGA 1JY2P 3AE6C 4PV1B 3C8VA 4H13B 5H2FE 3S4RA 1NGMB 2LKIA 3AE3C 2VLNA 1S72P 1DEBA 3H1HD 5HGOA 1RH5B 2YXQB 2Y9ZA 2FVFA 2XKMA 1PGJA 2Q5UA 1M8OB 1LGHB 4H0LD 2KG9A 4M0IA 2KLVA 1NTZE 2DNWA 5AVUB 2KNCB 1BE3J 2PAJA 5BS2A 2ZYGA 2V7QJ 3L71E 3H1KE 5E79E 1RF1C 1VQ4P 1ZRTE 2WSCH 2O01N 1A02J 1OIPA 2QSIA 3D71A 3VRLC 1FZFA 3CL3D 2IDBA 1IZNB 1OMIA 1CW5A 3CCUP 4OVNF 4Y28J 4U0EA 1SQBE 3B4QA 1Q82Q 1D7MA 5GTHE 2KG8A 4IPYA 3PLNA 4Y99B 2JR8A 2GDYA 2M5AB 1BE3D 4WVZA 2N6YA 3BRTB 2K9YA 2K5XA 3KHUA 3CWBD 5AW2B 3B5NB 3TNUA 2A45I 5APQA 3WBHA 3L4FA 1SFCD 3CXHH 1FBMA 2E43A 5EW5E 3RK2D 1YJWP 1NTZG 2RKLA 2OYOA 3CI9A 1K9MQ 3DPHA 3RBZA 5CCGA 1HJ0A 1AV1A 1N7SA 3V2PA 1ZV8A 1OWAA 2R3CA 2ZFCA 3HE4A 3P7KA 1NKNA 1USDA 2ONTA 1IFDA 4RO0A 2PENA 3EFGA 1Q7YQ 4AQRD 4UB6H 2LXBA 1LTJC 1OW7A 1MZ8A 2EG5A 2ZXXA 3H32B 2K94A 1Y8AA 2HPCB 1SQBG 2YO3A 2N9YB 1X79B 2BASA 4C7RA 2WPQA 4L75A 4PD4I 1URQA 2L22A 1VQ5P 3H1HE 3V2RA 2K0XA 3G29A 2NPSB 3TYYA 1FOSE 1FJPA 3DS2A 3DS0A 2Y0CA 4QMAA 1VKUA 2KGAA 2B87B 2RN0A 4CPGA 1JY3O 1N7SD 1LT9C 2ROQA 1RO2A 1MUUA 1RE4C 3GHGB 3FX0A 2D2CD 2IFMA 3UIAA 3CX5D 2M8LA 1NAFA 1L0LJ 3HE5B 4ZKPA 2XT1A 2KW2A 2Z44A 2KUBA 3AE5C 3L73J 1K04A 2LMLA 1Q2NA 5APYA 1FJKA 1K73Q 4WY4D 1PPJD 2E5TA 3GF7A 5E79H 3USSA 1BE3E 3CCEP 2JO0A 3V4WA 1GW3A 3HUSB 1M57D 3CWBE 1IFIA 3SWKA 1E5WA 3VOPA 2Q3EA 2K0DX 1EZVI 2BEZF 2P7JA 3MTUE 1JOCA 3CLQA 2BQ1E 3R2PA 1XTCC 1L0LD 1EDJA 3H1HG 1JCDA 1VPCA 4K35A 5GTHH 1FOSF 1HUCA 1L2PA 2ZVOB 2M8RA 2QM8A 2J59M 1T3JA 5AW4B 3RK2C 3WU2E 2WSSH 2E42A 3HZQA 3A7OA 2M3EA 3II6A 1GU5A 4OH8B 2LR2A 1KILA 1HGVA 1R8EA 4MN4C 2C0XA 1N8RQ 4XFYA 2LPKA 4LLHA 1MFTA 3PTZA 3AEAC 1JUNA 1KYOI 3BCCJ 1BGYG 5AVWB 3EQ2A 1QGKB 1EXIA 3M9BA 3L37A 1VQ6P 2GZIA 4R4LA 1G1JA 2R5BA 5AVVB 2ZT9B 1AJYA 3MHVA 2FYUD 3GZLA 2QRXA 3MZWB 1BE3G 2EHSA 2MVUA 3KQGA 3SWYA 1X8YA 2R3SA 2QM7A 1N86A 2EIAA 2P2UA 3FWNA 1N73A 3VMYA 1CI6A 3F89A 1Y9BA 3BCCD 2PEMA 2AFEA 1U7MA 2CQ8A 4EYYQ 1IMPA 1S5LX 1K8AQ 2K9JA 3S9OA 2GA1A 2A06G 2WITA 1L4AA 1H0TB 4WBAA 1JY3P 4HKZH 4L73A 5CCGC 3HYBA 3F5HA 3HRNA 1YQ4C 1N7SC 1VQLP 1EIAA 2DW3A 2WZ7A 1L0LK 4BRYB 4U7JA 3CX5E 3DTJA 1RF1A 2MJZA 1EDKA 1MV8A 2YMKA 1D1DA 3T97A 2YIUB 1FAVA 3E1IA 2H8PD 1RHZB 2Z5HA 4Z1MH 2HFED 2PY8A 1ZMEC 1PPJE 2KZIA 4U3FG 3Q5PA 3G6EP 1UIXA 1LTJB 1Q86Q 2W83C 1A8OA 1S3JA 2XZ1C 2FXMA 1JO5A 1URQC 2NRGA 2VSQA 1SQXJ 1L0LE 1ACPA 4NEOA 4HKGA 2CPSA 2M8NA 1YTZT 3FXDA 5BU5A 2I8DA 2FYUK 1M6NA 2V7QH 1LP1A 2KS1B 2CWOA 1SQPJ 1VL2A 2YKPA 1R5LA 1VQOP 4BPGA 4N6JA 1E0HA 4H0LB 2KOGA 2IZ1A 1JNMA 1LTAC 1FZCA 4D6TJ 3L72J 2QA4P 2FHSC 1QL1A 3PJSK 1VQKP 1SQXD 1LT9B 3G3ZA 1KLPA 1BCCJ 3MGNA 3VYIA 1VF5D 1JM0A 5HGMA 2FYNB 4HB1A 3WU2H 4IL6E 4AUWA 2GYKA 3V2QA 1HH0A 1JMMA 4XFJA 3SFDC 3VTPC 2C9LY 1R5SA 3L75G 2E75C 4PD4D 2W8ZA 3EFFK 1SQBD 2O01H 2MR8A 1JY3N 2L5GB 1NOHA 3GZMA 4U0FA 1WMKA 3KPEA 3G4SP 3RK3C 4IFDK 1OFCX 2HODB 2NZ2A 3L74G 3GLMA 4DJGA 1KQFB 1KB9I 3BCCE 2YNYA 4R0MA 2Q6QA 3N7NA 2JDIH 1JB0J 2KOSA 1GW4A 3NXSA 2YMYA 3L73G 4XE5B 1SFCB 3D6ZA 3I55P 3RK2B 1KORA 1KILC 3IF4A 2MY5A 2IBZI 2K2QA 3PRJA 2WT7A 5I4TG 2KGCA 3P8MC 2GUVA 4M3LA 3H6PA 4N3YB 4PH0A 1VQ7P 1L0NJ 3E7KA 1NTZK 2WPSA 2DGYA 2K1AA 3U1AA 3Q1MA 1W2BO 2M8PA 3CX5H 1M1JA 2P10A 2KSEA 1M1KQ 2EHTA 1N73C 1QLED 2X2BA 2VRSA 1NHLA 3CXCO 5AW0B 2BCCJ 2FVAA 4U0AA 2QE7H 3G0VA 2M3BA 3BCCG 1BGYJ 3VP8A 3L35A 5CJ0A 1SQBK 3RBXA 1L4AC 3CCSP 1J1EC 1L0ND 2ITAA 4RKUJ 1LWUC 3MD0A 1LTIC 1VQMP 3DS3A 1P84D 3CXHI 3HD7C 5KKZB 1UNKA 3NTEA 1SQXE 5KAIH 4PWVB 1GL2A 2VLOA 4ASWA 2BCCD 1N7SB 2V4HA 2KYVA 1VF5C 2QJKC 3AEGC 3GJNA 1EMVA 2JKVA 2IYOA 2D2CB 2QVAA 2LKMA 1GK6A 1HGZA 1BGYD 1KFNA 4BWNA 2Z46A 1PL5A 3C1LA 4PD4E 1X0TA 1NQ4A 2BHVA 1AQTA 4NPDA 1QVFO 4WY4B 3KXDA 1AA0A 2QJPC 1GK4A 1ZR4A 1LTBC 5CBOA 1GZLA 3LW5J 3L72E 2P67A 3EJBA 2A45G 4IL6H 2SPZA 2C9NY 3H0DA 2IX7C 4JBZA 4RJTA 3FGAD 2JWAA 1JMBA 4GOFA 2MD9A 1HVVA 1GDTA 2MF4A 2KR5A 3LMOA 2O3JA 4U3FJ 2B89A 2A06D 3NMDA 5EFWB 1KV4A 1A43A 2L4BA 4H44D 2PEIA 3AEBC 1LTGC 1G2CA 3WUTA 2PFXA 2OYHC 3QWOC 1JY2N 1FZCC 2E1MA 1T8KA 1JTHB 4UB8H 3JCUE 2JJLA 4OGQC 1SQXG 2KNCA 1GPJA 2XDJA 2JYLA 2GZFA 2E5YA 1YIJP 2CNRA 2KOQA 1DD3A 1M74A 2FAEA 4U3FD 2OQQA 2W6BA 1NYHA 1SQPG 1H89A 2AF8A 2R44A 4A7PA 1FR2A 2FXOA 2KK7A 2AXTH 1FE6A 5L8RJ 1NO4A 4KHXA 2WPVB 5F2OA 4D6TG 3L72G 3W67A 4JYCA 4H2WC 3CCQP 1BCCG 2M5AA 1KC8Q 2PEQA 1L0NE 1SVFA 2LIUA 1SQQJ 2PGDA 1P84E 3L75J 1KN7A 2VLPA 2K88A 5B66E 5H2FH 2MVVA 5CCGD 1GXGA 4KT0J 2BCCE 2OTKE 1KTMA 3PH0A 3L74J 3SSUA 2JQ4A 2N1TA 3G71P 5CMZA 1BGYE 3ZDMA 3E2DA 5AW7B 1QVGO 5CCHA 1OR5A 4WYMA 5DCKA 5KLIB 1SQVJ 1VQNP 3L75D 2WWWA 1M1JC 2FFDB 1EZVG 2JO1A 4JPZB 2ZAEB 1ZNVA 1HJBA 1KB9D 3ITKA 3H32A 1IUQA 1URQD 1L0HA 1S9KD 2QIWA 3RL0D 1VDFA 3L74D 2YO2A 4PD4H 1JEKA 1J1DC 3DS4A 3GG2A 1BXIA 1CI6B 3I56P 2W6JH 2A06E 1L0NG 1RO0A 3L73D 2IYPA 2KP8A 3VMAA 1Z6MA 1SQVD 2K9JB 4H44C 2GZGA 2E76C 2XXMA 3AE4C 4I7ZC 1E6JP 2FYZA 3M0AA 1QEXA 3AEDC 5APVA 4NPFX 1GL2C 3DS5A 1ZLLA 2BCCG 2H89C 1ZOYC 2XZ0D 2N1TD 2B87A 1RF1B 3ABVC 3O6QA 1NTMJ 1PP9J 1PZQA 3CPWO 3PHLA 3SWFA 4PH1A 4U3FE 2LL8A 1VF5B 2QJKB 2LF4A 3T97B 5KLVJ 1IMQA 2H43A 2KIKA 1DNYA 3H25A 3H1LJ 4XROA 5AVXB 3HE5A 2E75D 4COPA 1IFMA 4U0CA 3VP9A 3CC2P 3RG6C 4C7NB 5F2KA 1A02F 3RK3D 4K3AA 3OJAB 1YTZI 2QJPB 5B5EE 4IFMA 2RMZA 4PV1C 3H1IJ 1NTMD 1PP9D 2KGEA 3L70J 2JP3A 2Z5IA 5KLVD 4WB4A 3LIEA 2IFNA 1PEUA 3H1LD 1QRJA 1LP1B 1LWUA 3H47A 3OW2O 1FC2C 2Y0EA 1JJ2O 1PIXA 3HD7A 1KILD 1NKZB 2GUSA 5KAFE 2KOPA 4GR2A 1EC5A 7CEIA 1KQGB 1W5CE 3U1CA 1VHNA 2JAZA 1FS0E 1FZCB 1F80D 1NTKJ 1P84H 5B66H 3L70D 3R4YA 3KZIE 4LGDE 4PJ0E 3L75E 3WUVA 3OAKA 2LOLA 2Q1KA 1NU1J 1IJDB 3Q5RA 2AXCA 1KB9E 4IZ6A 1NWQA 1S9KE 3V6IA 1BSNA 4I2LC 2I1JA 3L74E 1ZXGA 3RL0C 3CE7A 4Y99C 5AVZB 1GU4A 1HF9A 3L73E 2OYIA 4I6MC 1L4AD 4BXLA 1SQVE 1X3OA 3B71A 2YKQA 2IBZE 2P1JA 3L71J 3H1KJ 2Y0DA 5AW5B 2Q7CA 2I1KA 1HWTC 1YYCA 3IFMA 1ZW0A 5APXA 3HD7D 1CEIA 3VMXA 2GZJA 1KZUB 1MZ9A 5K5GB 1OZHA 2OYHA 1DX7A 2KSJA 1PGPA 4RESB 3RL0g 3EJDA 2N1TC 2KG6A 1X9VA 2N6ZA 1SLQA 2WT7B 4XA4A 1BDCA 2OTJP 4GR6A 3JSVC 5CCHC 4BRYA 4W7ZA 2K92A 2B88A 4ZNCA 3OA7A 3A0BE 3LW5H 1SQQG 2GZEA 1SQPD 4W7YA 2WQYC 4YXWH 4L74A 1OVRA 1BSHA 4DZOA 1RQUA 2G8YA 3GKLC 2ZYAA 1AUMA 3RK3E 3CX5I 1M1JB 2B9BA 2Q3IA 1QX8A 1XTGB 2R5DA 3CCMP 4D6TD 1YJ9P 3L72D 2XZRA 1KD1Q 1NTME 1PP9E 2H7HA 2JWDA 1BCCD 1IK9A 3W68A 1H88A 4UHPB 1AFOA 5KLVE 5APWA 3Q3DA 2L6EA 1U57A 1LTTC 2ERHA 1FDMA 3H1LE 2PP6A 3NY7B 1J1DB 3TF5A 4C46A 1SQVG 2IBZG 3NFQA 3CC4P 2GDXA 4H2YC 4N78D 1BDDA 1KILE 2P58A 2J5UA 1GXHA 2WMMA 5B5EH 4H44B 3WMM0 5AW9B 3CD6P 4OGQD 1IK7A 1OW6A 4MRTC 2WTYA 1GTWA 3L70E 1G1IA 3CCRP 4JQ0D 2Y9YA 4DCKA 1PV3A 4L76A 2FKWB 4HYTB 3AE9C 2Z45A 2XNDH 4DOJA 1S4XA 3GMAA 5KAFH 4EDFA 5APSA 1WRGA 2LIWA 1EZVD 1RF0C 1LTSC 1SQXK 2RH0A 3M9QA 3A3YB 3TGUG 1NTKE 1HTLC 3KZIH 3TK1A 5JPAA 1NTMG 1PP9G 3M91A 2N50A 1SQPK 3A2AA 1IFNA 2HODA 5KLVG 3TNUB 4GT1A 1KB9H 2FXPA 3H1LG 5AVSB 2YXRB 1KMIZ 1NU1E 2POHA 1M6EX 5KP6B 1PEMA 2ZYDA 2XV5A 3M0DA 2WSEJ 1M90Q 2L9FA 1AQ5A 3MIWA 2FADA 5KTBA 1H8AA 1J2JB 1E79H 1G2CB 1KYOD 1SFCA 3M1MA 3MGEA 2FY8A 2FQ0A 1S5LE 2E74D 4TT3H 3HE4B 3H1IG 2OTLP 4HJGH 3IN6A 3HTKA 3L70G 1FU1A 1JCCA 1USEA 1SQPE 4XFXA 3CWBJ 3V4QA 2ZJSE 2YKOA 3MP7B 1QL2A 5BVZA 3P8CE 1NH4A 3AEEC 5M1BA 4O9BA 2ZT9C 1N2DC 3AE8C 4D6TE 2LXCB 1BCCE 3L36A 1FZEA 1URQB 5AVTB 3A0BH 4LC1A 1NTKG 3RL0B 2K93A 1OXZA 2K37A 2HLOA 2OYIC 3MUDC 2J58A 3IR9A 2W90A 3H1JJ 4ZMDA 2BUOA 4EOTA 4N78E 3BATA 2O01J 1NU1G 2WVRA 1ZMBA 2E76D 2AFDA 2JGPA 1EQ7A 1EDIA 1T2KD 1EXJA 2MKVA 2O1KA 2Q9IA 5GTIE 2JYGA 1AYIA 1GL2D 5CZDB 1VQ9P 3AE7C 1S2EA 2KXPB 3M9HA 1FZBA 3Q20A 1L0NK 2IZ0A 3P05A 2N1TB 1FDIA 3CMEP 2AVAA 2FVEA 3H1JD 4B86A 1DH3A 2XU6A 3L71G 3H1KG 3AECC 2JB0A 2FACA 2YIUC 1ZR2A 1EZVE 5AVQB 4CA3A 1CSBA 4QKOA 2VLQA 4F37A 2E75B 2GDWA 2H88C 1OVVA 1VQ8P 3EWKA 1IFJA 4WY4A 3RK3B 4R4MA 2WPRA 4PV1D 1M7LA 1WT6A 2KZJA 2M5RA 4H13D 5APTA 1PFIA 3CC7P 3U43A 3B5NA 5C39A 1T3UA 5TJHA 3P32A 2A45H 2K3RA 2WSFJ 5APUA 4OWFA 3GF3A 2ZXEB 3D70A 1KYOE 2JBGA 1HBWA 3B8EB 3N4XA 3AE2C 1IFPA 4H0LC 3A0HE 1KILB 2KGDA 4IL6X 2QJYC 2UWJE 2E74C 1ZN5A 4GKGA 4YPCA 3O6QB 4GOEA 1GD2E 1JTHA 3JC22 1NAYA 1L0IA 1YI2P 1SQQD 2FYNC 3GW6A 2P9XA 5KJ7A 1TU3F 3M06A 4IOIH 1S5LH 1PEOA 1EOQA 4W80A 2N98A 3G1IA 2HPCA 2WSCJ 3BASA 2MR7A 1N73B 1LJ2A 5CHXA 2L0QA 1DIPA 1KQSO 3B5ND 2AEMA 2JEEA 1GMJA 3CCLP 2IBZD 1L4AB 1J1EB 3FXEA 2NPSA 3M0DC 1FDOA 5AVRB 1RE3A 3B5IA 2L91A 1T2KC 1LWUB 3RGUA 1KFMA 1YITP 1SFCC 1Q90D 3HD7B 1ZP0C 2K0YA 1OW8A 3TGUJ 2KOOA 2FYUJ 4YTPC 5HV8A 4U0DA 5CCHD 3H1JE 3GHGA 1N7LA 2IPPA 4H2XC 1P84I 3PP5A 2PEOA 5GTIH 4PXHB 5AW1B 1W2EA 1K30A 5KJ7D 3JCUH 2AEFA 5CJ4A 3V5BA 1BAJA 2WPTA 2QG4A 1RF0A 3AE1C 4DT0A 1MFZA 1FZAA 3KYQA 4WWIA 1U7JA 1RY3A 3TGUD 2HYNA 2FFDA 2CG5B 2JU1A 3HUSA 4H13C 1SQQK 3CXHD 2OYIB 3CWBG 2FQ1A 2CK3H 4EIJA 1HY8A 3EJEA 2N5HA 2NPSD 5AVYB 3BRVB 3V2NA 4AYCA 2QNWA 1VQPP 3CCJP 1T6AA 3AEFC 1AVOA 5TISE 2FBWC 4TLFA 1DEEG 3K5BA 2KB7P 5AW6B 3H4EA 5AW8B 3D6YA 1HQBA 2FQ2A 3G1GA 4QNBA 2OYHB 4ASVA 4KJMA 5KKZC 2NO8A 1Q81Q 2QEXP 3H1ID 4OGQB 1DV5A 2W27A 3S1KA 1OX3A 1SQVK 2CGQA 2W6AA 2XNXA 3H1JG 1SQQE 4EI2A 3DS1A 3KDPB 2EFJA 3VMZA 1KYOH 2PEKA 2D2CC 1M56D 4XFZA 2OGUA 4DG9A 5HGLA 1FZGA 3A0HH 4ZKUA 1UJZA 4YXDC 5F2NA 2HG5D 3IAOA 5DJTB 2R32A 1UIIA 2ZVNB 4WY4C 2LTEA 3CMAP 3C9IA 2PEJA 3TDKA 2AEJA 1YHQP 4XRQA 1NTKD 1NTZJ 4C7NA 2HR3A 2XV6A 2WSEH 3B5NC 3G9RA 3MUDA 2N5IA 1PGQA 1JY2O 2GM4A 2PRRA 3G21A 1NU1D 3VN0A 3Q2YA 1PEQA 5KAIE 3B4SA 3U59A 1H0TA 1RQVA 4GIFA 3TSIA 1NTMK 1Y47A 2KWLA 3LIDA 1SQBJ 5KLVK 2KLUA 1NTZD 4BPFA 3I5CA 2QJYB 2E74B 1KQLA 5KP8B 3LRYA 2O1JA 1DD4A 4GDOA 4NPEA 4BPHA 3L71D 3H1KD 5KJ7C 1ZRTD 2BEQD 2JU2A 3O8ZA 5CBNA 3P8CD 2ZT9D 1X22A 3WUUA 3Q5SA 5EJDA 1YQ3C 3TGUE 2KORA 1LTJA 1EDLA 2FYUE 1LNQA 1PPJG 3A5TA 3G26A 2KI7B 1T8ZA 3E1RA 3FWLA 1LT1A 4COCA 2KODA 1RNIA 3CCVP 3CXHE 2CPBA 5AW3B 2OARA 4JF7A 3G28A 3RG2A 3QH9A 4I1LA 1SP4A 2NPSC 1RE3C 1L0LG
chains in the Genus database with same CATH topology
5BS2A 1VQLP 1EIAA 1NJIQ 3CMAP 2PEJA 2Z45A 3G0VA 5DCKA 1VQ4P 1VQNP 1YHQP 5HGNA 4XRQA 2PEOA 2E1MA 3DTJA 3VRLC 1K30A 2XV6A 3CCSP 4U0FA 2BUOA 3G4SP 1PEUA 1BAJA 1D1DA 2JYLA 1QRJA 1IUQA 2OTJP 3HZQA 4GR6A 1YIJP 1VQMP 3DS3A 3H47A 2PY8A 1ZMBA 3G21A 3OW2O 3CCUP 1M74A 1VQ5P 4U0EA 3G6EP 1JJ2O 1Q82Q 3G29A 5BS1A 3NTEA 1YI2P 1PEQA 5JPAA 2JYGA 1Q86Q 4IPYA 3DS4A 4GR2A 1N8RQ 1A8OA 3I56P 4XFYA 3DS2A 1VQ9P 2P9XA 3DS0A 1RO0A 1AUMA 3Q20A 1PEOA 1EOQA 3P05A 4U0BA 5F2OA 3G1IA 1M6EX 1VQ6P 2Z46A 3CCMP 3I55P 1YJ9P 2XXMA 1PEMA 1M90Q 3CMEP 2M8NA 3CCQP 3LRYA 1VQPP 1YJNP 1KD1Q 3CCJP 1E6JP 1RO2A 2BHVA 3DS5A 1KC8Q 2PEQA 3WBHA 2L6EA 3H4EA 1QVFO 1M6NA 3M1MA 3MGEA 2M8LA 5I4TG 1KQSO 3G1GA 4QNBA 2CWOA 3CCLP 2EIAA 1Q81Q 2OTLP 2QEXP 1YJWP 4PH0A 3CPWO 1VQ7P 2XT1A 1VQOP 3CC4P 2Z44A 1VQ8P 4PH1A 3H0DA 2LF4A 1K9MQ 3DPHA 3B5IA 1S72P 2DGYA 1K73Q 3DS1A 3G26A 4XFXA 4XROA 5HGOA 2EFJA 1YITP 2PEMA 1W2BO 2M8PA 2PEKA 4XFZA 2QA4P 3CCEP 4COCA 2JO0A 2KODA 5HGLA 4U0CA 1RNIA 4COPA 3CCVP 1K8AQ 1VQKP 3CD6P 2ONTA 3CC7P 2OARA 3CC2P 3G28A 2PENA 4M0IA 3RG6C 3G71P 1M1KQ 5HGMA 1Q7YQ 3E2DA 5F2KA 3CXCO 1A43A 3CCRP 4U0DA 2PEIA 1QVGO 2EG5A 4U0AA 5F2NA 3HYBA 4WYMA 2BQ1E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CME P;  1S72 P;  1VQP P;  3CCQ P;  1YJN P;  1K9M Q;  1KD1 Q;  1VQL P;  3CCJ P;  3G6E P;  3CMA P;  1NJI Q;  1K73 Q;  1JJ2 O;  1Q82 Q;  1YI2 P;  1YIT P;  1VQ4 P;  1VQN P;  1YHQ P;  1Q86 Q;  1W2B O;  1KC8 Q;  1N8R Q;  3I56 P;  2QA4 P;  3CCE P;  1QVF O;  1VQK P;  3CCV P;  3CD6 P;  1K8A Q;  3CCS P;  1KQS O;  1VQ5 P;  1VQ9 P;  3CC7 P;  3CC2 P;  3G4S P;  1M1K Q;  3G71 P;  1Q7Y Q;  3CCL P;  1Q81 Q;  3CXC O;  2OTL P;  2OTJ P;  2QEX P;  1YJW P;  3CPW O;  3CCR P;  1VQM P;  1VQO P;  1YIJ P;  1VQ7 P;  3CC4 P;  1VQ8 P;  1QVG O;  1VQ6 P;  3CCM P;  3I55 P;  3OW2 O;  3CCU P;  1YJ9 P;  1M90 Q; 
#chains in the Genus database with same CATH topology
 1SS1 A;  1AVY A;  2C0W A;  1NJI Q;  4UB8 E;  5HGN A;  2KS1 A;  2E76 B;  1NTK K;  4I7Z B;  3H1I E;  1GL2 B;  5HVC A;  4GOD A;  3SFE C;  4UB6 E;  1K05 A;  4JYB A;  3GHG C;  4HH2 A;  4IFF A;  2G3A A;  1Z56 A;  3HTK B;  5BS1 A;  1NU1 K;  1LT9 A;  5TIS H;  1RE4 A;  1AF8 A;  5BU8 B;  5DJU B;  2AXT E;  2Z4E A;  2M0B A;  3H1H J;  1YBK A;  5KP7 B;  5KLI C;  4U0B A;  1IO4 A;  3BVH A;  1MKM A;  1PGO A;  1S1C X;  1OVU A;  2FFD C;  1YJN P;  2FYU G;  1IC2 A;  3HUS C;  4PJ0 H;  2WSF H;  2N9B A;  3NTN A;  1NVO A;  1CZQ A;  2PNG A;  1JY2 P;  3AE6 C;  4PV1 B;  3C8V A;  4H13 B;  5H2F E;  3S4R A;  1NGM B;  2LKI A;  3AE3 C;  2VLN A;  1S72 P;  1DEB A;  3H1H D;  5HGO A;  1RH5 B;  2YXQ B;  2Y9Z A;  2FVF A;  2XKM A;  1PGJ A;  2Q5U A;  1M8O B;  1LGH B;  4H0L D;  2KG9 A;  4M0I A;  2KLV A;  1NTZ E;  2DNW A;  5AVU B;  2KNC B;  1BE3 J;  2PAJ A;  5BS2 A;  2ZYG A;  2V7Q J;  3L71 E;  3H1K E;  5E79 E;  1RF1 C;  1VQ4 P;  1ZRT E;  2WSC H;  2O01 N;  1A02 J;  1OIP A;  2QSI A;  3D71 A;  3VRL C;  1FZF A;  3CL3 D;  2IDB A;  1IZN B;  1OMI A;  1CW5 A;  3CCU P;  4OVN F;  4Y28 J;  4U0E A;  1SQB E;  3B4Q A;  1Q82 Q;  1D7M A;  5GTH E;  2KG8 A;  4IPY A;  3PLN A;  4Y99 B;  2JR8 A;  2GDY A;  2M5A B;  1BE3 D;  4WVZ A;  2N6Y A;  3BRT B;  2K9Y A;  2K5X A;  3KHU A;  3CWB D;  5AW2 B;  3B5N B;  3TNU A;  2A45 I;  5APQ A;  3WBH A;  3L4F A;  1SFC D;  3CXH H;  1FBM A;  2E43 A;  5EW5 E;  3RK2 D;  1YJW P;  1NTZ G;  2RKL A;  2OYO A;  3CI9 A;  1K9M Q;  3DPH A;  3RBZ A;  5CCG A;  1HJ0 A;  1AV1 A;  1N7S A;  3V2P A;  1ZV8 A;  1OWA A;  2R3C A;  2ZFC A;  3HE4 A;  3P7K A;  1NKN A;  1USD A;  2ONT A;  1IFD A;  4RO0 A;  2PEN A;  3EFG A;  1Q7Y Q;  4AQR D;  4UB6 H;  2LXB A;  1LTJ C;  1OW7 A;  1MZ8 A;  2EG5 A;  2ZXX A;  3H32 B;  2K94 A;  1Y8A A;  2HPC B;  1SQB G;  2YO3 A;  2N9Y B;  1X79 B;  2BAS A;  4C7R A;  2WPQ A;  4L75 A;  4PD4 I;  1URQ A;  2L22 A;  1VQ5 P;  3H1H E;  3V2R A;  2K0X A;  3G29 A;  2NPS B;  3TYY A;  1FOS E;  1FJP A;  3DS2 A;  3DS0 A;  2Y0C A;  4QMA A;  1VKU A;  2KGA A;  2B87 B;  2RN0 A;  4CPG A;  1JY3 O;  1N7S D;  1LT9 C;  2ROQ A;  1RO2 A;  1MUU A;  1RE4 C;  3GHG B;  3FX0 A;  2D2C D;  2IFM A;  3UIA A;  3CX5 D;  2M8L A;  1NAF A;  1L0L J;  3HE5 B;  4ZKP A;  2XT1 A;  2KW2 A;  2Z44 A;  2KUB A;  3AE5 C;  3L73 J;  1K04 A;  2LML A;  1Q2N A;  5APY A;  1FJK A;  1K73 Q;  4WY4 D;  1PPJ D;  2E5T A;  3GF7 A;  5E79 H;  3USS A;  1BE3 E;  3CCE P;  2JO0 A;  3V4W A;  1GW3 A;  3HUS B;  1M57 D;  3CWB E;  1IFI A;  3SWK A;  1E5W A;  3VOP A;  2Q3E A;  2K0D X;  1EZV I;  2BEZ F;  2P7J A;  3MTU E;  1JOC A;  3CLQ A;  2BQ1 E;  3R2P A;  1XTC C;  1L0L D;  1EDJ A;  3H1H G;  1JCD A;  1VPC A;  4K35 A;  5GTH H;  1FOS F;  1HUC A;  1L2P A;  2ZVO B;  2M8R A;  2QM8 A;  2J59 M;  1T3J A;  5AW4 B;  3RK2 C;  3WU2 E;  2WSS H;  2E42 A;  3HZQ A;  3A7O A;  2M3E A;  3II6 A;  1GU5 A;  4OH8 B;  2LR2 A;  1KIL A;  1HGV A;  1R8E A;  4MN4 C;  2C0X A;  1N8R Q;  4XFY A;  2LPK A;  4LLH A;  1MFT A;  3PTZ A;  3AEA C;  1JUN A;  1KYO I;  3BCC J;  1BGY G;  5AVW B;  3EQ2 A;  1QGK B;  1EXI A;  3M9B A;  3L37 A;  1VQ6 P;  2GZI A;  4R4L A;  1G1J A;  2R5B A;  5AVV B;  2ZT9 B;  1AJY A;  3MHV A;  2FYU D;  3GZL A;  2QRX A;  3MZW B;  1BE3 G;  2EHS A;  2MVU A;  3KQG A;  3SWY A;  1X8Y A;  2R3S A;  2QM7 A;  1N86 A;  2EIA A;  2P2U A;  3FWN A;  1N73 A;  3VMY A;  1CI6 A;  3F89 A;  1Y9B A;  3BCC D;  2PEM A;  2AFE A;  1U7M A;  2CQ8 A;  4EYY Q;  1IMP A;  1S5L X;  1K8A Q;  2K9J A;  3S9O A;  2GA1 A;  2A06 G;  2WIT A;  1L4A A;  1H0T B;  4WBA A;  1JY3 P;  4HKZ H;  4L73 A;  5CCG C;  3HYB A;  3F5H A;  3HRN A;  1YQ4 C;  1N7S C;  1VQL P;  1EIA A;  2DW3 A;  2WZ7 A;  1L0L K;  4BRY B;  4U7J A;  3CX5 E;  3DTJ A;  1RF1 A;  2MJZ A;  1EDK A;  1MV8 A;  2YMK A;  1D1D A;  3T97 A;  2YIU B;  1FAV A;  3E1I A;  2H8P D;  1RHZ B;  2Z5H A;  4Z1M H;  2HFE D;  2PY8 A;  1ZME C;  1PPJ E;  2KZI A;  4U3F G;  3Q5P A;  3G6E P;  1UIX A;  1LTJ B;  1Q86 Q;  2W83 C;  1A8O A;  1S3J A;  2XZ1 C;  2FXM A;  1JO5 A;  1URQ C;  2NRG A;  2VSQ A;  1SQX J;  1L0L E;  1ACP A;  4NEO A;  4HKG A;  2CPS A;  2M8N A;  1YTZ T;  3FXD A;  5BU5 A;  2I8D A;  2FYU K;  1M6N A;  2V7Q H;  1LP1 A;  2KS1 B;  2CWO A;  1SQP J;  1VL2 A;  2YKP A;  1R5L A;  1VQO P;  4BPG A;  4N6J A;  1E0H A;  4H0L B;  2KOG A;  2IZ1 A;  1JNM A;  1LTA C;  1FZC A;  4D6T J;  3L72 J;  2QA4 P;  2FHS C;  1QL1 A;  3PJS K;  1VQK P;  1SQX D;  1LT9 B;  3G3Z A;  1KLP A;  1BCC J;  3MGN A;  3VYI A;  1VF5 D;  1JM0 A;  5HGM A;  2FYN B;  4HB1 A;  3WU2 H;  4IL6 E;  4AUW A;  2GYK A;  3V2Q A;  1HH0 A;  1JMM A;  4XFJ A;  3SFD C;  3VTP C;  2C9L Y;  1R5S A;  3L75 G;  2E75 C;  4PD4 D;  2W8Z A;  3EFF K;  1SQB D;  2O01 H;  2MR8 A;  1JY3 N;  2L5G B;  1NOH A;  3GZM A;  4U0F A;  1WMK A;  3KPE A;  3G4S P;  3RK3 C;  4IFD K;  1OFC X;  2HOD B;  2NZ2 A;  3L74 G;  3GLM A;  4DJG A;  1KQF B;  1KB9 I;  3BCC E;  2YNY A;  4R0M A;  2Q6Q A;  3N7N A;  2JDI H;  1JB0 J;  2KOS A;  1GW4 A;  3NXS A;  2YMY A;  3L73 G;  4XE5 B;  1SFC B;  3D6Z A;  3I55 P;  3RK2 B;  1KOR A;  1KIL C;  3IF4 A;  2MY5 A;  2IBZ I;  2K2Q A;  3PRJ A;  2WT7 A;  5I4T G;  2KGC A;  3P8M C;  2GUV A;  4M3L A;  3H6P A;  4N3Y B;  4PH0 A;  1VQ7 P;  1L0N J;  3E7K A;  1NTZ K;  2WPS A;  2DGY A;  2K1A A;  3U1A A;  3Q1M A;  1W2B O;  2M8P A;  3CX5 H;  1M1J A;  2P10 A;  2KSE A;  1M1K Q;  2EHT A;  1N73 C;  1QLE D;  2X2B A;  2VRS A;  1NHL A;  3CXC O;  5AW0 B;  2BCC J;  2FVA A;  4U0A A;  2QE7 H;  3G0V A;  2M3B A;  3BCC G;  1BGY J;  3VP8 A;  3L35 A;  5CJ0 A;  1SQB K;  3RBX A;  1L4A C;  3CCS P;  1J1E C;  1L0N D;  2ITA A;  4RKU J;  1LWU C;  3MD0 A;  1LTI C;  1VQM P;  3DS3 A;  1P84 D;  3CXH I;  3HD7 C;  5KKZ B;  1UNK A;  3NTE A;  1SQX E;  5KAI H;  4PWV B;  1GL2 A;  2VLO A;  4ASW A;  2BCC D;  1N7S B;  2V4H A;  2KYV A;  1VF5 C;  2QJK C;  3AEG C;  3GJN A;  1EMV A;  2JKV A;  2IYO A;  2D2C B;  2QVA A;  2LKM A;  1GK6 A;  1HGZ A;  1BGY D;  1KFN A;  4BWN A;  2Z46 A;  1PL5 A;  3C1L A;  4PD4 E;  1X0T A;  1NQ4 A;  2BHV A;  1AQT A;  4NPD A;  1QVF O;  4WY4 B;  3KXD A;  1AA0 A;  2QJP C;  1GK4 A;  1ZR4 A;  1LTB C;  5CBO A;  1GZL A;  3LW5 J;  3L72 E;  2P67 A;  3EJB A;  2A45 G;  4IL6 H;  2SPZ A;  2C9N Y;  3H0D A;  2IX7 C;  4JBZ A;  4RJT A;  3FGA D;  2JWA A;  1JMB A;  4GOF A;  2MD9 A;  1HVV A;  1GDT A;  2MF4 A;  2KR5 A;  3LMO A;  2O3J A;  4U3F J;  2B89 A;  2A06 D;  3NMD A;  5EFW B;  1KV4 A;  1A43 A;  2L4B A;  4H44 D;  2PEI A;  3AEB C;  1LTG C;  1G2C A;  3WUT A;  2PFX A;  2OYH C;  3QWO C;  1JY2 N;  1FZC C;  2E1M A;  1T8K A;  1JTH B;  4UB8 H;  3JCU E;  2JJL A;  4OGQ C;  1SQX G;  2KNC A;  1GPJ A;  2XDJ A;  2JYL A;  2GZF A;  2E5Y A;  1YIJ P;  2CNR A;  2KOQ A;  1DD3 A;  1M74 A;  2FAE A;  4U3F D;  2OQQ A;  2W6B A;  1NYH A;  1SQP G;  1H89 A;  2AF8 A;  2R44 A;  4A7P A;  1FR2 A;  2FXO A;  2KK7 A;  2AXT H;  1FE6 A;  5L8R J;  1NO4 A;  4KHX A;  2WPV B;  5F2O A;  4D6T G;  3L72 G;  3W67 A;  4JYC A;  4H2W C;  3CCQ P;  1BCC G;  2M5A A;  1KC8 Q;  2PEQ A;  1L0N E;  1SVF A;  2LIU A;  1SQQ J;  2PGD A;  1P84 E;  3L75 J;  1KN7 A;  2VLP A;  2K88 A;  5B66 E;  5H2F H;  2MVV A;  5CCG D;  1GXG A;  4KT0 J;  2BCC E;  2OTK E;  1KTM A;  3PH0 A;  3L74 J;  3SSU A;  2JQ4 A;  2N1T A;  3G71 P;  5CMZ A;  1BGY E;  3ZDM A;  3E2D A;  5AW7 B;  1QVG O;  5CCH A;  1OR5 A;  4WYM A;  5DCK A;  5KLI B;  1SQV J;  1VQN P;  3L75 D;  2WWW A;  1M1J C;  2FFD B;  1EZV G;  2JO1 A;  4JPZ B;  2ZAE B;  1ZNV A;  1HJB A;  1KB9 D;  3ITK A;  3H32 A;  1IUQ A;  1URQ D;  1L0H A;  1S9K D;  2QIW A;  3RL0 D;  1VDF A;  3L74 D;  2YO2 A;  4PD4 H;  1JEK A;  1J1D C;  3DS4 A;  3GG2 A;  1BXI A;  1CI6 B;  3I56 P;  2W6J H;  2A06 E;  1L0N G;  1RO0 A;  3L73 D;  2IYP A;  2KP8 A;  3VMA A;  1Z6M A;  1SQV D;  2K9J B;  4H44 C;  2GZG A;  2E76 C;  2XXM A;  3AE4 C;  4I7Z C;  1E6J P;  2FYZ A;  3M0A A;  1QEX A;  3AED C;  5APV A;  4NPF X;  1GL2 C;  3DS5 A;  1ZLL A;  2BCC G;  2H89 C;  1ZOY C;  2XZ0 D;  2N1T D;  2B87 A;  1RF1 B;  3ABV C;  3O6Q A;  1NTM J;  1PP9 J;  1PZQ A;  3CPW O;  3PHL A;  3SWF A;  4PH1 A;  4U3F E;  2LL8 A;  1VF5 B;  2QJK B;  2LF4 A;  3T97 B;  5KLV J;  1IMQ A;  2H43 A;  2KIK A;  1DNY A;  3H25 A;  3H1L J;  4XRO A;  5AVX B;  3HE5 A;  2E75 D;  4COP A;  1IFM A;  4U0C A;  3VP9 A;  3CC2 P;  3RG6 C;  4C7N B;  5F2K A;  1A02 F;  3RK3 D;  4K3A A;  3OJA B;  1YTZ I;  2QJP B;  5B5E E;  4IFM A;  2RMZ A;  4PV1 C;  3H1I J;  1NTM D;  1PP9 D;  2KGE A;  3L70 J;  2JP3 A;  2Z5I A;  5KLV D;  4WB4 A;  3LIE A;  2IFN A;  1PEU A;  3H1L D;  1QRJ A;  1LP1 B;  1LWU A;  3H47 A;  3OW2 O;  1FC2 C;  2Y0E A;  1JJ2 O;  1PIX A;  3HD7 A;  1KIL D;  1NKZ B;  2GUS A;  5KAF E;  2KOP A;  4GR2 A;  1EC5 A;  7CEI A;  1KQG B;  1W5C E;  3U1C A;  1VHN A;  2JAZ A;  1FS0 E;  1FZC B;  1F80 D;  1NTK J;  1P84 H;  5B66 H;  3L70 D;  3R4Y A;  3KZI E;  4LGD E;  4PJ0 E;  3L75 E;  3WUV A;  3OAK A;  2LOL A;  2Q1K A;  1NU1 J;  1IJD B;  3Q5R A;  2AXC A;  1KB9 E;  4IZ6 A;  1NWQ A;  1S9K E;  3V6I A;  1BSN A;  4I2L C;  2I1J A;  3L74 E;  1ZXG A;  3RL0 C;  3CE7 A;  4Y99 C;  5AVZ B;  1GU4 A;  1HF9 A;  3L73 E;  2OYI A;  4I6M C;  1L4A D;  4BXL A;  1SQV E;  1X3O A;  3B71 A;  2YKQ A;  2IBZ E;  2P1J A;  3L71 J;  3H1K J;  2Y0D A;  5AW5 B;  2Q7C A;  2I1K A;  1HWT C;  1YYC A;  3IFM A;  1ZW0 A;  5APX A;  3HD7 D;  1CEI A;  3VMX A;  2GZJ A;  1KZU B;  1MZ9 A;  5K5G B;  1OZH A;  2OYH A;  1DX7 A;  2KSJ A;  1PGP A;  4RES B;  3RL0 g;  3EJD A;  2N1T C;  2KG6 A;  1X9V A;  2N6Z A;  1SLQ A;  2WT7 B;  4XA4 A;  1BDC A;  2OTJ P;  4GR6 A;  3JSV C;  5CCH C;  4BRY A;  4W7Z A;  2K92 A;  2B88 A;  4ZNC A;  3OA7 A;  3A0B E;  3LW5 H;  1SQQ G;  2GZE A;  1SQP D;  4W7Y A;  2WQY C;  4YXW H;  4L74 A;  1OVR A;  1BSH A;  4DZO A;  1RQU A;  2G8Y A;  3GKL C;  2ZYA A;  1AUM A;  3RK3 E;  3CX5 I;  1M1J B;  2B9B A;  2Q3I A;  1QX8 A;  1XTG B;  2R5D A;  3CCM P;  4D6T D;  1YJ9 P;  3L72 D;  2XZR A;  1KD1 Q;  1NTM E;  1PP9 E;  2H7H A;  2JWD A;  1BCC D;  1IK9 A;  3W68 A;  1H88 A;  4UHP B;  1AFO A;  5KLV E;  5APW A;  3Q3D A;  2L6E A;  1U57 A;  1LTT C;  2ERH A;  1FDM A;  3H1L E;  2PP6 A;  3NY7 B;  1J1D B;  3TF5 A;  4C46 A;  1SQV G;  2IBZ G;  3NFQ A;  3CC4 P;  2GDX A;  4H2Y C;  4N78 D;  1BDD A;  1KIL E;  2P58 A;  2J5U A;  1GXH A;  2WMM A;  5B5E H;  4H44 B;  3WMM 0;  5AW9 B;  3CD6 P;  4OGQ D;  1IK7 A;  1OW6 A;  4MRT C;  2WTY A;  1GTW A;  3L70 E;  1G1I A;  3CCR P;  4JQ0 D;  2Y9Y A;  4DCK A;  1PV3 A;  4L76 A;  2FKW B;  4HYT B;  3AE9 C;  2Z45 A;  2XND H;  4DOJ A;  1S4X A;  3GMA A;  5KAF H;  4EDF A;  5APS A;  1WRG A;  2LIW A;  1EZV D;  1RF0 C;  1LTS C;  1SQX K;  2RH0 A;  3M9Q A;  3A3Y B;  3TGU G;  1NTK E;  1HTL C;  3KZI H;  3TK1 A;  5JPA A;  1NTM G;  1PP9 G;  3M91 A;  2N50 A;  1SQP K;  3A2A A;  1IFN A;  2HOD A;  5KLV G;  3TNU B;  4GT1 A;  1KB9 H;  2FXP A;  3H1L G;  5AVS B;  2YXR B;  1KMI Z;  1NU1 E;  2POH A;  1M6E X;  5KP6 B;  1PEM A;  2ZYD A;  2XV5 A;  3M0D A;  2WSE J;  1M90 Q;  2L9F A;  1AQ5 A;  3MIW A;  2FAD A;  5KTB A;  1H8A A;  1J2J B;  1E79 H;  1G2C B;  1KYO D;  1SFC A;  3M1M A;  3MGE A;  2FY8 A;  2FQ0 A;  1S5L E;  2E74 D;  4TT3 H;  3HE4 B;  3H1I G;  2OTL P;  4HJG H;  3IN6 A;  3HTK A;  3L70 G;  1FU1 A;  1JCC A;  1USE A;  1SQP E;  4XFX A;  3CWB J;  3V4Q A;  2ZJS E;  2YKO A;  3MP7 B;  1QL2 A;  5BVZ A;  3P8C E;  1NH4 A;  3AEE C;  5M1B A;  4O9B A;  2ZT9 C;  1N2D C;  3AE8 C;  4D6T E;  2LXC B;  1BCC E;  3L36 A;  1FZE A;  1URQ B;  5AVT B;  3A0B H;  4LC1 A;  1NTK G;  3RL0 B;  2K93 A;  1OXZ A;  2K37 A;  2HLO A;  2OYI C;  3MUD C;  2J58 A;  3IR9 A;  2W90 A;  3H1J J;  4ZMD A;  2BUO A;  4EOT A;  4N78 E;  3BAT A;  2O01 J;  1NU1 G;  2WVR A;  1ZMB A;  2E76 D;  2AFD A;  2JGP A;  1EQ7 A;  1EDI A;  1T2K D;  1EXJ A;  2MKV A;  2O1K A;  2Q9I A;  5GTI E;  2JYG A;  1AYI A;  1GL2 D;  5CZD B;  1VQ9 P;  3AE7 C;  1S2E A;  2KXP B;  3M9H A;  1FZB A;  3Q20 A;  1L0N K;  2IZ0 A;  3P05 A;  2N1T B;  1FDI A;  3CME P;  2AVA A;  2FVE A;  3H1J D;  4B86 A;  1DH3 A;  2XU6 A;  3L71 G;  3H1K G;  3AEC C;  2JB0 A;  2FAC A;  2YIU C;  1ZR2 A;  1EZV E;  5AVQ B;  4CA3 A;  1CSB A;  4QKO A;  2VLQ A;  4F37 A;  2E75 B;  2GDW A;  2H88 C;  1OVV A;  1VQ8 P;  3EWK A;  1IFJ A;  4WY4 A;  3RK3 B;  4R4M A;  2WPR A;  4PV1 D;  1M7L A;  1WT6 A;  2KZJ A;  2M5R A;  4H13 D;  5APT A;  1PFI A;  3CC7 P;  3U43 A;  3B5N A;  5C39 A;  1T3U A;  5TJH A;  3P32 A;  2A45 H;  2K3R A;  2WSF J;  5APU A;  4OWF A;  3GF3 A;  2ZXE B;  3D70 A;  1KYO E;  2JBG A;  1HBW A;  3B8E B;  3N4X A;  3AE2 C;  1IFP A;  4H0L C;  3A0H E;  1KIL B;  2KGD A;  4IL6 X;  2QJY C;  2UWJ E;  2E74 C;  1ZN5 A;  4GKG A;  4YPC A;  3O6Q B;  4GOE A;  1GD2 E;  1JTH A;  3JC2 2;  1NAY A;  1L0I A;  1YI2 P;  1SQQ D;  2FYN C;  3GW6 A;  2P9X A;  5KJ7 A;  1TU3 F;  3M06 A;  4IOI H;  1S5L H;  1PEO A;  1EOQ A;  4W80 A;  2N98 A;  3G1I A;  2HPC A;  2WSC J;  3BAS A;  2MR7 A;  1N73 B;  1LJ2 A;  5CHX A;  2L0Q A;  1DIP A;  1KQS O;  3B5N D;  2AEM A;  2JEE A;  1GMJ A;  3CCL P;  2IBZ D;  1L4A B;  1J1E B;  3FXE A;  2NPS A;  3M0D C;  1FDO A;  5AVR B;  1RE3 A;  3B5I A;  2L91 A;  1T2K C;  1LWU B;  3RGU A;  1KFM A;  1YIT P;  1SFC C;  1Q90 D;  3HD7 B;  1ZP0 C;  2K0Y A;  1OW8 A;  3TGU J;  2KOO A;  2FYU J;  4YTP C;  5HV8 A;  4U0D A;  5CCH D;  3H1J E;  3GHG A;  1N7L A;  2IPP A;  4H2X C;  1P84 I;  3PP5 A;  2PEO A;  5GTI H;  4PXH B;  5AW1 B;  1W2E A;  1K30 A;  5KJ7 D;  3JCU H;  2AEF A;  5CJ4 A;  3V5B A;  1BAJ A;  2WPT A;  2QG4 A;  1RF0 A;  3AE1 C;  4DT0 A;  1MFZ A;  1FZA A;  3KYQ A;  4WWI A;  1U7J A;  1RY3 A;  3TGU D;  2HYN A;  2FFD A;  2CG5 B;  2JU1 A;  3HUS A;  4H13 C;  1SQQ K;  3CXH D;  2OYI B;  3CWB G;  2FQ1 A;  2CK3 H;  4EIJ A;  1HY8 A;  3EJE A;  2N5H A;  2NPS D;  5AVY B;  3BRV B;  3V2N A;  4AYC A;  2QNW A;  1VQP P;  3CCJ P;  1T6A A;  3AEF C;  1AVO A;  5TIS E;  2FBW C;  4TLF A;  1DEE G;  3K5B A;  2KB7 P;  5AW6 B;  3H4E A;  5AW8 B;  3D6Y A;  1HQB A;  2FQ2 A;  3G1G A;  4QNB A;  2OYH B;  4ASV A;  4KJM A;  5KKZ C;  2NO8 A;  1Q81 Q;  2QEX P;  3H1I D;  4OGQ B;  1DV5 A;  2W27 A;  3S1K A;  1OX3 A;  1SQV K;  2CGQ A;  2W6A A;  2XNX A;  3H1J G;  1SQQ E;  4EI2 A;  3DS1 A;  3KDP B;  2EFJ A;  3VMZ A;  1KYO H;  2PEK A;  2D2C C;  1M56 D;  4XFZ A;  2OGU A;  4DG9 A;  5HGL A;  1FZG A;  3A0H H;  4ZKU A;  1UJZ A;  4YXD C;  5F2N A;  2HG5 D;  3IAO A;  5DJT B;  2R32 A;  1UII A;  2ZVN B;  4WY4 C;  2LTE A;  3CMA P;  3C9I A;  2PEJ A;  3TDK A;  2AEJ A;  1YHQ P;  4XRQ A;  1NTK D;  1NTZ J;  4C7N A;  2HR3 A;  2XV6 A;  2WSE H;  3B5N C;  3G9R A;  3MUD A;  2N5I A;  1PGQ A;  1JY2 O;  2GM4 A;  2PRR A;  3G21 A;  1NU1 D;  3VN0 A;  3Q2Y A;  1PEQ A;  5KAI E;  3B4S A;  3U59 A;  1H0T A;  1RQV A;  4GIF A;  3TSI A;  1NTM K;  1Y47 A;  2KWL A;  3LID A;  1SQB J;  5KLV K;  2KLU A;  1NTZ D;  4BPF A;  3I5C A;  2QJY B;  2E74 B;  1KQL A;  5KP8 B;  3LRY A;  2O1J A;  1DD4 A;  4GDO A;  4NPE A;  4BPH A;  3L71 D;  3H1K D;  5KJ7 C;  1ZRT D;  2BEQ D;  2JU2 A;  3O8Z A;  5CBN A;  3P8C D;  2ZT9 D;  1X22 A;  3WUU A;  3Q5S A;  5EJD A;  1YQ3 C;  3TGU E;  2KOR A;  1LTJ A;  1EDL A;  2FYU E;  1LNQ A;  1PPJ G;  3A5T A;  3G26 A;  2KI7 B;  1T8Z A;  3E1R A;  3FWL A;  1LT1 A;  4COC A;  2KOD A;  1RNI A;  3CCV P;  3CXH E;  2CPB A;  5AW3 B;  2OAR A;  4JF7 A;  3G28 A;  3RG2 A;  3QH9 A;  4I1L A;  1SP4 A;  2NPS C;  1RE3 C;  1L0L G; 
#chains in the Genus database with same CATH homology
 5BS2 A;  1VQL P;  1EIA A;  1NJI Q;  3CMA P;  2PEJ A;  2Z45 A;  3G0V A;  5DCK A;  1VQ4 P;  1VQN P;  1YHQ P;  5HGN A;  4XRQ A;  2PEO A;  2E1M A;  3DTJ A;  3VRL C;  1K30 A;  2XV6 A;  3CCS P;  4U0F A;  2BUO A;  3G4S P;  1PEU A;  1BAJ A;  1D1D A;  2JYL A;  1QRJ A;  1IUQ A;  2OTJ P;  3HZQ A;  4GR6 A;  1YIJ P;  1VQM P;  3DS3 A;  3H47 A;  2PY8 A;  1ZMB A;  3G21 A;  3OW2 O;  3CCU P;  1M74 A;  1VQ5 P;  4U0E A;  3G6E P;  1JJ2 O;  1Q82 Q;  3G29 A;  5BS1 A;  3NTE A;  1YI2 P;  1PEQ A;  5JPA A;  2JYG A;  1Q86 Q;  4IPY A;  3DS4 A;  4GR2 A;  1N8R Q;  1A8O A;  3I56 P;  4XFY A;  3DS2 A;  1VQ9 P;  2P9X A;  3DS0 A;  1RO0 A;  1AUM A;  3Q20 A;  1PEO A;  1EOQ A;  3P05 A;  4U0B A;  5F2O A;  3G1I A;  1M6E X;  1VQ6 P;  2Z46 A;  3CCM P;  3I55 P;  1YJ9 P;  2XXM A;  1PEM A;  1M90 Q;  3CME P;  2M8N A;  3CCQ P;  3LRY A;  1VQP P;  1YJN P;  1KD1 Q;  3CCJ P;  1E6J P;  1RO2 A;  2BHV A;  3DS5 A;  1KC8 Q;  2PEQ A;  3WBH A;  2L6E A;  3H4E A;  1QVF O;  1M6N A;  3M1M A;  3MGE A;  2M8L A;  5I4T G;  1KQS O;  3G1G A;  4QNB A;  2CWO A;  3CCL P;  2EIA A;  1Q81 Q;  2OTL P;  2QEX P;  1YJW P;  4PH0 A;  3CPW O;  1VQ7 P;  2XT1 A;  1VQO P;  3CC4 P;  2Z44 A;  1VQ8 P;  4PH1 A;  3H0D A;  2LF4 A;  1K9M Q;  3DPH A;  3B5I A;  1S72 P;  2DGY A;  1K73 Q;  3DS1 A;  3G26 A;  4XFX A;  4XRO A;  5HGO A;  2EFJ A;  1YIT P;  2PEM A;  1W2B O;  2M8P A;  2PEK A;  4XFZ A;  2QA4 P;  3CCE P;  4COC A;  2JO0 A;  2KOD A;  5HGL A;  4U0C A;  1RNI A;  4COP A;  3CCV P;  1K8A Q;  1VQK P;  3CD6 P;  2ONT A;  3CC7 P;  2OAR A;  3CC2 P;  3G28 A;  2PEN A;  4M0I A;  3RG6 C;  3G71 P;  1M1K Q;  5HGM A;  1Q7Y Q;  3E2D A;  5F2K A;  3CXC O;  1A43 A;  3CCR P;  4U0D A;  2PEI A;  1QVG O;  2EG5 A;  4U0A A;  5F2N A;  3HYB A;  4WYM A;  2BQ1 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...