1K73Q

Co-crystal structure of anisomycin bound to the 50s ribosomal subunit
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAKGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Five Antibiotics Bound at the Peptidyl Transferase Center of the Large Ribosomal Subunit
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S RRNA
total genus 47
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2001-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1k73Q02
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1k73Q01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1k73Q03
3G71P 3CD6P 3G4SP 2QA4P 1YITP 1VQOP 1K9MQ 1VQ6P 1W2BO 1VQNP 1YJWP 1QVGO 1K73Q 3CCVP 1Q86Q 1YIJP 3OW2O 3CC2P 3CMEP 3CMAP 3CCUP 1VQLP 1VQ9P 1QVFO 1VQ4P 1KQSO 3CCQP 1K8AQ 3CCLP 3CXCO 3CCSP 2OTLP 1N8RQ 1VQMP 1YHQP 3CCRP 1YJNP 1JJ2O 1YI2P 3CCEP 3G6EP 3CC4P 3CCJP 1NJIQ 1S72P 1KD1Q 1VQ8P 1VQ7P 1KC8Q 1VQ5P 3I55P 1M1KQ 3CPWO 1Q82Q 1VQPP 1YJ9P 1M90Q 3CCMP 3I56P 1VQKP 2QEXP 3CC7P 1Q81Q 1Q7YQ 2OTJP
chains in the Genus database with same CATH superfamily
1FZGA 1YTZT 4QNBA 1MFTA 4L73A 1KB9I 3L74E 5DJTB 3HUSC 2RMZA 1SFCA 3S4RA 4HH2A 4U3FJ 2IBZE 4C46A 3CPWO 4LC1A 2LIWA 1VL2A 1JM0A 1HGZA 1JUNA 1EDJA 1YJWP 1SQBK 4TLFA 1J1EC 1FDOA 1MUUA 3GG2A 1USDA 2E75B 4I7ZC 1MV8A 1LT9A 2KGEA 1CSBA 3H1IG 4U7JA 2AEJA 2W6JH 3U59A 1ZW0A 2KXPB 1SQQG 1YQ3C 3MD0A 2P2UA 2ZJSE 3HUSB 1M1JC 2VRSA 3L72E 2P7JA 3G3ZA 1AFOA 2GM4A 1PPJG 3FWLA 3CX5H 3DS0A 2YMYA 2K0YA 4R4LA 3BCCD 3B5ND 3B5NA 1EZVI 2Z5HA 3A0BE 3H1KD 1K05A 5B5EE 4C7NA 1E0HA 5HGNA 2ZYAA 1S5LE 2M3EA 2G8YA 2K88A 1RQUA 5AW4B 1SP4A 5CCHC 1EZVE 1NTKJ 5KKZB 2PEJA 2EG5A 2Z45A 4IOIH 2ERHA 2QIWA 2YKPA 3H1JD 3BATA 4WB4A 2YIUB 3T97B 4UB8H 3H1KJ 5JPAA 4DG9A 1AV1A 3U1CA 4UHPB 1RF0C 1VPCA 2JR8A 1L0NK 5KAIE 3TNUA 2CQ8A 2FHSC 1OMIA 3MP7B 1VQKP 3H1HE 3TNUB 2KGDA 2X2BA 4D6TE 2WSSH 2WSEH 1BCCG 1WMKA 2P9XA 2KORA 2DW3A 1SQXE 3CCUP 1OVRA 2R5BA 2EHSA 2FVFA 2LXBA 4OGQB 3B71A 3H32B 2KSEA 3Q20A 1KB9E 2N9YB 1RF1B 1QGKB 3FGAD 3H25A 2GZFA 1GU5A 3LRYA 1FBMA 3CLQA 3F5HA 3H1LE 2PAJA 2WSFH 3H1HJ 3RK3C 3G6EP 4EIJA 1VQ8P 4D6TJ 3H1JG 2Q9IA 1DH3A 1S9KD 2E76B 1TU3F 3G21A 1VF5C 5KLVE 5GTIH 2HLOA 1FJPA 2B88A 2E5YA 1OVVA 3CCSP 1L0HA 1FZCC 3RK2D 1UJZA 3L70E 5KLIB 3P8CE 4PD4I 1KILA 2QM8A 3M91A 2K9YA 4GOEA 5AW6B 2LPKA 3CD6P 2JYGA 2K9JB 1K30A 4H0LB 2O3JA 4D6TG 2K9JA 2JQ4A 2Q1KA 4HKZH 1JY2O 1J1EB 2KG9A 2JYLA 5KP7B 2Z5IA 3C9IA 3EWKA 4KT0J 2FAEA 2B87B 2LF4A 1LTTC 2GA1A 2R32A 3IN6A 1JNMA 3G29A 1URQD 1EIAA 2GUVA 2POHA 3TGUD 1KFMA 2FYUE 1XTCC 1BCCJ 3JSVC 4PH0A 1SS1A 2XV6A 2PEQA 3U43A 2P1JA 1GXHA 1AQTA 3TYYA 3MUDC 3L75J 1Q82Q 1IZNB 1EZVG 1LT1A 1ZR4A 3PTZA 3G4SP 2VSQA 1KILC 1HBWA 1EZVD 2JWDA 3RBZA 1KQSO 5AVVB 1SQPK 1KTMA 5KKZC 1NJIQ 3L74J 1KB9D 2IBZD 3AE2C 2KK7A 2GUSA 3B4SA 2OYOA 1S3JA 2WSCH 3SWYA 2FYUJ 1BGYG 1BE3E 1LT9B 2JU1A 1RF1C 2M5AA 1IMPA 1QVFO 1VQ4P 3N4XA 2OYHB 4LLHA 2XNXA 3R2PA 3L36A 1YBKA 2ITAA 4BPHA 2IX7C 1DD3A 5I4TG 1VHNA 4OGQD 3CC7P 2ROQA 3WBHA 1GL2D 4KJMA 3RK3B 2L0QA 3G1GA 2FYUD 3CWBG 1P84I 3H1JJ 1IFDA 1EQ7A 2FXPA 1JY2P 5K5GB 2FYUG 3CWBD 2JEEA 2XKMA 3B8EB 1RH5B 5AW9B 1RNIA 1FZBA 2CNRA 1KORA 3DS2A 3MIWA 1JEKA 5KP6B 1URQB 3CX5I 2IFMA 1LTSC 1L0LD 2FQ1A 3CMEP 2W83C 1RY3A 4Y99B 1NKZB 2CK3H 5AW2B 2W6BA 4RESB 2M8NA 1GU4A 3L73J 1PGOA 1T8KA 1AA0A 1L0LG 3CMAP 3L35A 1YQ4C 1FZAA 2B89A 5KAFE 1FR2A 3JC22 4HB1A 1CW5A 2OTLP 1GL2C 5CCHD 2JWAA 3BVHA 2Q7CA 1GMJA 2KP8A 2IBZI 2ZYGA 1E79H 1N73A 1LTJC 2BCCG 4GR6A 3II6A 4WBAA 1BXIA 2AEMA 3KXDA 3M0AA 1H0TB 1U57A 2PNGA 3IFMA 1H0TA 1E6JP 3MGNA 1RF1A 5F2OA 3MZWB 1BGYJ 2I1KA 2FVEA 3H32A 2CGQA 1NOHA 1NTZD 3KPEA 3L71E 3L71G 1NAYA 4I1LA 1GTWA 1DEBA 2GDYA 1M74A 1T3JA 4WY4A 2M8RA 2H8PD 3CCLP 2WMMA 4H44D 2OYIB 2Q5UA 3AEAC 1OR5A 3GHGC 2GZGA 3PLNA 2AEFA 1NTZJ 3B5NC 3H1HG 4IL6E 3KQGA 1FZFA 1UIXA 1VQ6P 1KV4A 1S5LH 2Q3EA 2E76C 1L0ND 1FOSE 3A0BH 1PV3A 4GT1A 2R44A 5EFWB 2H89C 5GTHH 1SQVJ 5HGOA 3BRTB 3TGUJ 1PPJD 1Y47A 2QJYB 1JCCA 2B9BA 2EIAA 3Q5SA 2R5DA 1PEMA 1FOSF 1L2PA 1SVFA 2PEMA 3H1KG 3KDPB 1OZHA 2M0BA 2I8DA 1S72P 4H2YC 1FU1A 3M06A 1VQ5P 1GK6A 3M9HA 3L74G 3B5IA 5DCKA 4PJ0H 1HY8A 1XTGB 3L74D 4N78D 2OGUA 3G26A 2N1TB 2GDXA 4W7ZA 1QLED 2AFDA 4Y99C 1PIXA 1Z6MA 2FVAA 1FAVA 2FY8A 5M1BA 4F37A 1Q7YQ 3VRLC 4XRQA 3AE5C 4BRYA 2XT1A 3VP8A 1HJBA 3CC2P 2RH0A 1A02F 5APVA 3FX0A 1ZMBA 2ZT9C 3AEDC 3CWBE 1ZV8A 2OTKE 4BWNA 1NU1J 2M5AB 4U3FG 1FE6A 4XFZA 2OYHA 5AW3B 1S2EA 5APSA 1VQLP 1AQ5A 5KAIH 1IFNA 1SQQD 5APXA 1SFCD 2K93A 2JP3A 3RL0C 3GZMA 7CEIA 1SQPJ 1Q81Q 2FBWC 3WU2E 3AEEC 4PD4E 3CWBJ 1K8AQ 1HTLC 3UIAA 2K94A 3L73D 3MHVA 1NU1E 1OW6A 3DS3A 4NEOA 3WUVA 3L72G 4RKUJ 1QEXA 1M57D 2LMLA 2MR8A 1NTKD 2ZT9D 2JO1A 2Y9ZA 2M8LA 1QRJA 2XV5A 2JGPA 2E74C 5AVWB 2JO0A 4QKOA 1N7SC 2OYHC 3KHUA 2MY5A 1PGPA 1SQPE 5APWA 3HTKA 2MVVA 4HKGA 2A45I 2AF8A 3GF7A 1OW7A 4WY4D 1W2BO 2IBZG 3L75G 5KTBA 2N1TD 2R3SA 2MD9A 2IFNA 3EJEA 5HV8A 3L70J 3FXDA 2VLOA 2AXCA 2KOQA 5KLVK 1DX7A 2E75D 1N73B 3HE4B 3A0HH 2KR5A 5C39A 1L4AB 3EQ2A 2BCCD 3G9RA 5AW5B 3H0DA 2HR3A 3L71D 4U0FA 1VKUA 1JTHA 4ZKUA 4XE5B 3E1RA 2KUBA 2KNCA 3DS4A 2JJLA 1N86A 2WSCJ 1X79B 1GD2E 1CZQA 2YXQB 3U1AA 3P05A 5KLVG 2Y0CA 1LGHB 1UIIA 3Q3DA 3H6PA 1P84D 4MN4C 1URQC 1GXGA 1VF5B 1RO2A 2YNYA 3HD7D 2V7QH 2AVAA 1QVGO 3L71J 3BCCG 3H1LD 4K3AA 4RJTA 2FYNC 3CL3D 2ONTA 2IYPA 4DZOA 3TDKA 1QX8A 3NY7B 1AJYA 2L5GB 4YXWH 4CPGA 2E1MA 1KZUB 5AW7B 2O1KA 3CX5D 1M1JB 3FWNA 4C7NB 3AE4C 3VOPA 2QG4A 3HRNA 2IYOA 2ZVOB 2CPBA 3HE5A 4OH8B 3CCQP 3VMYA 2XDJA 4IL6X 2KLUA 1SQVD 1PGJA 4ZKPA 1NTKG 3M9QA 3A5TA 3BCCJ 1KYOE 1BE3J 2FYNB 1NTMJ 5AVYB 5EJDA 3TGUE 4O9BA 2K3RA 2YO3A 1OIPA 2BHVA 4PH1A 4XFXA 1N8RQ 1RE4A 1R5SA 1VQ7P 1GDTA 1LWUC 3C8VA 2V7QJ 1NTKK 2GZJA 1YYCA 3HE4A 1FC2C 1VQNP 2LTEA 2E42A 2PY8A 5B5EH 3AE3C 2PEOA 3BCCE 3NXSA 2D2CB 3S9OA 3RK3D 1NTME 2AFEA 3Q1MA 3N7NA 5BU8B 1NTZG 3LIEA 3MTUE 3SFDC 4BRYB 4ZNCA 4EI2A 1PP9E 3OW2O 3DPHA 3CXCO 3M1MA 3AEBC 3L73E 3GKLC 4XA4A 2PEKA 3CCMP 4U3FD 3L72J 4N3YB 2LOLA 2QJPC 4PD4H 3PP5A 5GTIE 1A02J 2E74B 5DJUB 1OFCX 1EOQA 2L4BA 1AYIA 3WMM0 1FZCB 3VMAA 1KC8Q 1M1KQ 2CG5B 3G0VA 1W5CE 1M6EX 3HUSA 1RE3A 2C9NY 3NMDA 2HPCB 1KILD 3VTPC 5L8RJ 1LT9C 1L0NJ 1HUCA 3H1KE 2SPZA 2Q6QA 1JY3N 4L76A 1HQBA 5KAFH 2KG6A 4R4MA 4YPCA 3RK2C 4PV1D 1ZP0C 3WUTA 2P67A 1G1JA 1ZNVA 1G2CA 2WPTA 1BSNA 2XZ1C 1G2CB 3SFEC 1J1DC 1NTZE 1LTAC 3RG6C 2KB7P 1LNQA 1RF0A 2QA4P 4ASWA 4CA3A 1IK7A 3IAOA 4B86A 2A45G 1OXZA 1GL2A 1LWUB 2LR2A 2O1JA 3RBXA 4U0CA 1L4AA 1GL2B 1LWUA 4JBZA 4TT3H 4NPFX 2WT7A 2L91A 1H8AA 1RE4C 4H0LC 3EFGA 3RL0B 3L70G 3NTNA 1USEA 3I55P 1RHZB 2HODA 3H1LJ 4XROA 3VYIA 3GZLA 3RGUA 2CWOA 1N7LA 2KGAA 1H89A 2ZYDA 1IO4A 1KQFB 2KZJA 5BVZA 1T2KD 1Q2NA 4Y28J 2K1AA 2VLQA 1T6AA 4AUWA 1KMIZ 4GR2A 4W7YA 2ZXXA 1DD4A 4U3FE 2JB0A 4AQRD 2YKQA 2LL8A 2PEIA 1S1CX 1JO5A 2OYIA 1NTZK 4COCA 1NTMK 2BEZF 2N9BA 4N6JA 2NPSA 1YHQP 1NYHA 2N50A 4W80A 4BXLA 2BASA 2IPPA 5APTA 1N7SD 2RN0A 1M7LA 1SQQJ 3G1IA 4ASVA 1URQA 3AE8C 1IMQA 4N78E 5AVSB 3AE9C 1DIPA 1KYOH 2QJPB 1EDKA 4BPGA 5CBOA 1LTJA 1K04A 1HWTC 3G71P 1S5LX 2Q3IA 1NKNA 1FS0E 2KWLA 1K73Q 1SQVG 3HD7B 1BCCE 1L0NG 2EHTA 3P7KA 1N7SA 1T3UA 5KP8B 2DGYA 4UB6H 2KODA 5H2FH 1FJKA 3RL0D 2N1TC 2B87A 2M8PA 3H47A 2KS1A 3I56P 4H44C 3E1IA 2L22A 1ZRTE 2N1TA 2K2QA 2J59M 2JBGA 1AUMA 2K5XA 1HF9A 4H13D 2FFDA 5CCGD 1L0LK 1H88A 3HYBA 3C1LA 1E5WA 4YTPC 2WPVB 1CI6B 2WTYA 3CI9A 3HD7C 2KG8A 4U0BA 2W8ZA 2WVRA 1SQXG 3V2PA 1R8EA 1YTZI 5F2KA 2Z44A 2K37A 2QE7H 1IK9A 3O8ZA 3ABVC 2KOOA 1PP9J 2AXTH 1NU1D 5AVXB 3CC4P 1KILE 2XXMA 3H4EA 1BGYD 3A0HE 2GYKA 4WY4C 4YXDC 3FXEA 3SWFA 4HJGH 2K0XA 3W67A 5CCGC 2H43A 4PWVB 2EFJA 4WWIA 4KHXA 3A7OA 2E75C 2FXOA 4U0DA 3V5BA 2JU2A 3HE5B 1F80D 2QJKB 3D71A 1FDMA 2KGCA 4NPEA 3AEFC 2MR7A 2BCCE 1Y9BA 1EXJA 4GKGA 2KW2A 1FDIA 2YO2A 3Q5RA 5CJ0A 1X0TA 1ZXGA 3CXHH 2H88C 2NRGA 1SQXK 2WZ7A 4H2XC 1JB0J 2FXMA 3K5BA 4GIFA 1A8OA 1RO0A 3LW5J 2GDWA 2KOSA 2RKLA 1HH0A 2YMKA 4NPDA 3JCUE 2E76D 3AECC 1DNYA 3HTKB 3CCVP 3I5CA 2XZRA 3WU2H 1BE3D 1ZOYC 1WRGA 4UB8E 2LKMA 4IZ6A 2QJYC 3RK2B 3E2DA 3ZDMA 2WWWA 1PFIA 2NPSD 1HGVA 1QL1A 1Y8AA 2NZ2A 1PEOA 1KQGB 2N5HA 1M6NA 2YIUC 5E79E 3H1ID 4R0MA 1JY3O 2JKVA 2LIUA 2MKVA 1U7MA 2MVUA 1P84H 2WT7B 3CCEP 2HODB 1JJ2O 1MFZA 2Z4EA 4Z1MH 1W2EA 5CJ4A 2KLVA 4DOJA 5AVZB 4EOTA 5HGMA 1OWAA 4XFJA 1L0IA 3DS1A 2Z46A 2E5TA 3H1IJ 2WITA 3RG2A 1DV5A 1OVUA 2LXCB 3AE1C 2BUOA 2CPSA 1M56D 3CE7A 4EDFA 2P58A 4JPZB 2R3CA 1IFIA 1IFJA 4UB6E 3V4WA 3DTJA 4BPFA 1GZLA 3PH0A 1LTBC 3BASA 4PJ0E 3A3YB 3TSIA 2ZAEB 5E79H 3M0DC 1EDLA 5F2NA 3OJAB 4WY4B 4JQ0D 2PGDA 3VN0A 1SQVE 1M1JA 2HFED 2H7HA 5KLIC 4MRTC 2HPCA 1IFMA 2XNDH 3L37A 5CCGA 5EW5E 1AF8A 4H44B 1LJ2A 2OQQA 2L6EA 1EXIA 2J5UA 5BU5A 1KLPA 2JAZA 3TF5A 1OW8A 5BS1A 5GTHE 1KILB 1KYOD 3PHLA 2OARA 5AW0B 3LIDA 1SQBG 4GOFA 1RQVA 2M5RA 2J58A 2E74D 4DT0A 4C7RA 1D7MA 1SQQK 3HD7A 2L9FA 1BCCD 4IFMA 1N7SB 4IL6H 3E7KA 1JMMA 3EFFK 2FFDC 2WSFJ 2UWJE 1PEQA 3L75D 1MZ8A 4H2WC 2QM7A 3S1KA 2D2CC 3KYQA 4ZMDA 3G28A 2V4HA 2C0XA 1NHLA 4H0LD 3WUUA 4GODA 2JDIH 2FKWB 1SQXD 1YIJP 1A43A 1JTHB 2KYVA 3P8MC 1X22A 1L0NE 3L70D 1EDIA 2D2CD 2KNCB 2PENA 1NU1G 1QL2A 4H13C 1YJ9P 1PGQA 2FQ2A 3F89A 5APQA 1X9VA 2WSEJ 2GZIA 3TK1A 3BRVB 3SSUA 1ZMEC 1LTIC 5B66H 3W68A 3QH9A 3AE6C 1SQBE 1NQ4A 3M0DA 5TISE 5AVTB 2W90A 3PRJA 1AVYA 3GMAA 1IFPA 3V6IA 1NAFA 1BGYE 2N6YA 5AVUB 3D6ZA 5KLVD 1N73C 3AE7C 2ZT9B 1N2DC 1CEIA 3L72D 2QRXA 2A06E 4H13B 2O01N 1RE3C 3MGEA 1SQVK 1FZEA 5AW1B 4IFDK 2HG5D 3P8CD 4A7PA 1PZQA 1JMBA 5BS2A 1J2JB 1KYOI 3LW5H 2M3BA 3VMXA 1AVOA 4DJGA 1SQBJ 2WQYC 1DEEG 1M8OB 2BQ1E 2HYNA 2KSJA 5CBNA 1JY2N 1OX3A 3A2AA 2WPRA 3L73G 5AW8B 4AYCA 5KJ7A 3RL0g 1M90Q 1J1DB 1EC5A 4IFFA 3SWKA 2IZ1A 3V2QA 4EYYQ 2KS1B 2WPQA 2Y0EA 1SQBD 1EMVA 1Z56A 1BAJA 3JCUH 3KZIH 1IC2A 1PEUA 3T97A 4PXHB 1GK4A 1NO4A 1KB9H 2O01J 1LP1B 2KIKA 1SQQE 2XU6A 3D70A 4M3LA 1YITP 1VF5D 3AEGC 5APYA 3V4QA 4PD4D 5KJ7C 2NPSC 3L4FA 1PL5A 1G1IA 1GW3A 2KI7B 1X8YA 2KOGA 3NFQA 1PP9G 1SFCB 1NGMB 1JY3P 3R4YA 3OAKA 2BEQD 2WPSA 4I7ZB 3ITKA 2K92A 2N6ZA 1BDDA 4I2LC 2I1JA 2YKOA 4QMAA 4K35A 1YI2P 5APUA 1FZCA 1SQPD 4I6MC 4JF7A 2Y9YA 2FACA 2A45H 1U7JA 3P32A 5TJHA 2W6AA 4WVZA 3HZQA 2Y0DA 3CCRP 5KJ7D 3GHGA 2E43A 1SQPG 3GHGB 3Q5PA 4M0IA 3CX5E 3B5NB 1NTKE 4DCKA 1BSHA 3Q2YA 2FQ0A 2PRRA 3CXHD 5AVQB 1GPJA 1ZR2A 1LTJB 1MKMA 1Q90D 1YJNP 1R5LA 2LKIA 3TGUG 3GJNA 5H2FE 1P84E 2FADA 2QEXP 3MUDA 4L75A 3PJSK 4U0EA 2FYUK 2A06D 2QVAA 1NVOA 1IJDB 3V2NA 1KFNA 1JOCA 2BCCJ 1LTGC 1ZRTD 2FFDB 1SQXJ 3IF4A 1JCDA 2XZ0D 1HJ0A 1CI6A 1NH4A 1SLQA 1VDFA 1ACPA 4OVNF 1VQ9P 2KZIA 2O01H 1NU1K 2VLNA 2KOPA 2ZVNB 3H1JE 3CXHI 1HVVA 3CCJP 2C9LY 1BDCA 4HYTB 1KD1Q 1T8ZA 5CCHA 3GLMA 3CXHE 1L0LE 3M9BA 3H1LG 1PP9D 3GW6A 4U0AA 1S4XA 2ZXEB 3GF3A 1NWQA 1IUQA 5AVRB 4PV1B 2OYIC 2PP6A 2NPSB 2C0WA 5KLVJ 4XFYA 1VQPP 1S9KE 4D6TD 5TISH 4COPA 2VLPA 2K0DX 2DNWA 2QNWA 1K9MQ 5B66E 5HGLA 2P10A 4RO0A 3B4QA 2NO8A 3EJDA 3NTEA 2YXRB 3USSA 1KN7A 3OA7A 2GZEA 1KQLA 5CZDB 1WT6A 2AXTE 1L0LJ 1T2KC 3RK3E 4OWFA 1NTMD 3H1HD 1ZLLA 1D1DA 3H1IE 2MF4A 4WYMA 3EJBA 1VQOP 4PV1C 2N5IA 2W27A 2IZ0A 1Q86Q 3O6QB 1L4AC 3V2RA 3O6QA 1X3OA 2G3AA 1SFCC 5CHXA 2QSIA 2ZFCA 1MZ9A 2FYZA 1NTMG 4OGQC 5CMZA 1ZN5A 1BE3G 4L74A 3VMZA 2QJKC 1GW4A 2MJZA 5HVCA 1UNKA 3DS5A 2IDBA 1LP1A 3L75E 1VQMP 4LGDE 4JYBA 3LMOA 4IPYA 3QWOC 3VP9A 4GDOA 1L4AD 4JYCA 3D6YA 2A06G 2OTJP 1PPJE 3IR9A 2PFXA 3KZIE 2N98A
chains in the Genus database with same CATH topology
2PEIA 2JYGA 3CD6P 1M6EX 1K30A 5JPAA 1W2BO 2XT1A 3G1GA 3CC2P 4QNBA 2BQ1E 5F2KA 4U0AA 4COCA 1M74A 2Z44A 3CCLP 2BHVA 3HZQA 4PH1A 4XFXA 1N8RQ 1IUQA 2JYLA 3CCEP 1YHQP 3CCRP 1JJ2O 1PEQA 3CC4P 1ZMBA 2XXMA 1VQ7P 3H4EA 2LF4A 4XFYA 3CPWO 1M90Q 1VQPP 1VQKP 1RNIA 3G28A 3DS2A 3G29A 4M0IA 4COPA 3H0DA 4U0FA 5HGMA 4XFZA 3DS1A 3G1IA 1K9MQ 1VQ6P 1VQNP 1YJWP 2P9XA 3CMEP 1EIAA 2Z46A 1YIJP 2EFJA 5HGLA 2PY8A 3CCUP 1VQLP 1BAJA 1A43A 3NTEA 2BUOA 2PEOA 4PH0A 4U0DA 1YJNP 3DS4A 1PEUA 2M8NA 3Q20A 2XV6A 2PEQA 2PENA 5HGOA 3P05A 1Q82Q 1YJ9P 3DTJA 3RG6C 2QEXP 1Q81Q 1D1DA 4WYMA 3LRYA 3G71P 1RO2A 3G4SP 2QA4P 1VQOP 1YITP 2EIAA 4U0EA 1QVGO 1K73Q 1Q86Q 3OW2O 3CMAP 3DPHA 5F2NA 1PEMA 3DS0A 1KQSO 1K8AQ 2OTLP 4U0CA 3CXCO 2DGYA 2PEMA 2KODA 2ONTA 3M1MA 1A8OA 3G6EP 1NJIQ 1S72P 3DS3A 1VQ8P 2M8PA 1RO0A 3H47A 3I55P 1VQ5P 2PEKA 3CCMP 3I56P 4XROA 3G21A 2E1MA 5HGNA 4GR6A 3B5IA 2CWOA 2M8LA 1QRJA 3CCVP 5DCKA 2L6EA 2JO0A 1AUMA 1VQ9P 1QVFO 1VQ4P 3CCQP 3DS5A 1E6JP 3CCSP 1EOQA 3MGEA 2PEJA 5F2OA 2EG5A 1VQMP 2Z45A 1YI2P 3G26A 3HYBA 4IPYA 5BS1A 3CCJP 3E2DA 1KD1Q 5BS2A 1KC8Q 4GR2A 2OARA 1M1KQ 4U0BA 3G0VA 5I4TG 1PEOA 3CC7P 1Q7YQ 3VRLC 3WBHA 2OTJP 1M6NA 4XRQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G71 P;  3CD6 P;  3G4S P;  2QA4 P;  1YIT P;  1VQO P;  1K9M Q;  1VQ6 P;  1W2B O;  1VQN P;  1YJW P;  1QVG O;  1K73 Q;  3CCV P;  1Q86 Q;  1YIJ P;  3OW2 O;  3CC2 P;  3CME P;  3CMA P;  3CCU P;  1VQL P;  1VQ9 P;  1QVF O;  1VQ4 P;  1KQS O;  3CCQ P;  1K8A Q;  3CCL P;  3CXC O;  3CCS P;  2OTL P;  1N8R Q;  1VQM P;  1YHQ P;  3CCR P;  1YJN P;  1JJ2 O;  1YI2 P;  3CCE P;  3G6E P;  3CC4 P;  3CCJ P;  1NJI Q;  1S72 P;  1KD1 Q;  1VQ8 P;  1VQ7 P;  1KC8 Q;  1VQ5 P;  3I55 P;  1M1K Q;  3CPW O;  1Q82 Q;  1VQP P;  1YJ9 P;  1M90 Q;  3CCM P;  3I56 P;  1VQK P;  2QEX P;  3CC7 P;  1Q81 Q;  1Q7Y Q;  2OTJ P; 
#chains in the Genus database with same CATH topology
 1FZG A;  1YTZ T;  4QNB A;  1MFT A;  4L73 A;  1KB9 I;  3L74 E;  5DJT B;  3HUS C;  2RMZ A;  1SFC A;  3S4R A;  4HH2 A;  4U3F J;  2IBZ E;  4C46 A;  3CPW O;  4LC1 A;  2LIW A;  1VL2 A;  1JM0 A;  1HGZ A;  1JUN A;  1EDJ A;  1YJW P;  1SQB K;  4TLF A;  1J1E C;  1FDO A;  1MUU A;  3GG2 A;  1USD A;  2E75 B;  4I7Z C;  1MV8 A;  1LT9 A;  2KGE A;  1CSB A;  3H1I G;  4U7J A;  2AEJ A;  2W6J H;  3U59 A;  1ZW0 A;  2KXP B;  1SQQ G;  1YQ3 C;  3MD0 A;  2P2U A;  2ZJS E;  3HUS B;  1M1J C;  2VRS A;  3L72 E;  2P7J A;  3G3Z A;  1AFO A;  2GM4 A;  1PPJ G;  3FWL A;  3CX5 H;  3DS0 A;  2YMY A;  2K0Y A;  4R4L A;  3BCC D;  3B5N D;  3B5N A;  1EZV I;  2Z5H A;  3A0B E;  3H1K D;  1K05 A;  5B5E E;  4C7N A;  1E0H A;  5HGN A;  2ZYA A;  1S5L E;  2M3E A;  2G8Y A;  2K88 A;  1RQU A;  5AW4 B;  1SP4 A;  5CCH C;  1EZV E;  1NTK J;  5KKZ B;  2PEJ A;  2EG5 A;  2Z45 A;  4IOI H;  2ERH A;  2QIW A;  2YKP A;  3H1J D;  3BAT A;  4WB4 A;  2YIU B;  3T97 B;  4UB8 H;  3H1K J;  5JPA A;  4DG9 A;  1AV1 A;  3U1C A;  4UHP B;  1RF0 C;  1VPC A;  2JR8 A;  1L0N K;  5KAI E;  3TNU A;  2CQ8 A;  2FHS C;  1OMI A;  3MP7 B;  1VQK P;  3H1H E;  3TNU B;  2KGD A;  2X2B A;  4D6T E;  2WSS H;  2WSE H;  1BCC G;  1WMK A;  2P9X A;  2KOR A;  2DW3 A;  1SQX E;  3CCU P;  1OVR A;  2R5B A;  2EHS A;  2FVF A;  2LXB A;  4OGQ B;  3B71 A;  3H32 B;  2KSE A;  3Q20 A;  1KB9 E;  2N9Y B;  1RF1 B;  1QGK B;  3FGA D;  3H25 A;  2GZF A;  1GU5 A;  3LRY A;  1FBM A;  3CLQ A;  3F5H A;  3H1L E;  2PAJ A;  2WSF H;  3H1H J;  3RK3 C;  3G6E P;  4EIJ A;  1VQ8 P;  4D6T J;  3H1J G;  2Q9I A;  1DH3 A;  1S9K D;  2E76 B;  1TU3 F;  3G21 A;  1VF5 C;  5KLV E;  5GTI H;  2HLO A;  1FJP A;  2B88 A;  2E5Y A;  1OVV A;  3CCS P;  1L0H A;  1FZC C;  3RK2 D;  1UJZ A;  3L70 E;  5KLI B;  3P8C E;  4PD4 I;  1KIL A;  2QM8 A;  3M91 A;  2K9Y A;  4GOE A;  5AW6 B;  2LPK A;  3CD6 P;  2JYG A;  2K9J B;  1K30 A;  4H0L B;  2O3J A;  4D6T G;  2K9J A;  2JQ4 A;  2Q1K A;  4HKZ H;  1JY2 O;  1J1E B;  2KG9 A;  2JYL A;  5KP7 B;  2Z5I A;  3C9I A;  3EWK A;  4KT0 J;  2FAE A;  2B87 B;  2LF4 A;  1LTT C;  2GA1 A;  2R32 A;  3IN6 A;  1JNM A;  3G29 A;  1URQ D;  1EIA A;  2GUV A;  2POH A;  3TGU D;  1KFM A;  2FYU E;  1XTC C;  1BCC J;  3JSV C;  4PH0 A;  1SS1 A;  2XV6 A;  2PEQ A;  3U43 A;  2P1J A;  1GXH A;  1AQT A;  3TYY A;  3MUD C;  3L75 J;  1Q82 Q;  1IZN B;  1EZV G;  1LT1 A;  1ZR4 A;  3PTZ A;  3G4S P;  2VSQ A;  1KIL C;  1HBW A;  1EZV D;  2JWD A;  3RBZ A;  1KQS O;  5AVV B;  1SQP K;  1KTM A;  5KKZ C;  1NJI Q;  3L74 J;  1KB9 D;  2IBZ D;  3AE2 C;  2KK7 A;  2GUS A;  3B4S A;  2OYO A;  1S3J A;  2WSC H;  3SWY A;  2FYU J;  1BGY G;  1BE3 E;  1LT9 B;  2JU1 A;  1RF1 C;  2M5A A;  1IMP A;  1QVF O;  1VQ4 P;  3N4X A;  2OYH B;  4LLH A;  2XNX A;  3R2P A;  3L36 A;  1YBK A;  2ITA A;  4BPH A;  2IX7 C;  1DD3 A;  5I4T G;  1VHN A;  4OGQ D;  3CC7 P;  2ROQ A;  3WBH A;  1GL2 D;  4KJM A;  3RK3 B;  2L0Q A;  3G1G A;  2FYU D;  3CWB G;  1P84 I;  3H1J J;  1IFD A;  1EQ7 A;  2FXP A;  1JY2 P;  5K5G B;  2FYU G;  3CWB D;  2JEE A;  2XKM A;  3B8E B;  1RH5 B;  5AW9 B;  1RNI A;  1FZB A;  2CNR A;  1KOR A;  3DS2 A;  3MIW A;  1JEK A;  5KP6 B;  1URQ B;  3CX5 I;  2IFM A;  1LTS C;  1L0L D;  2FQ1 A;  3CME P;  2W83 C;  1RY3 A;  4Y99 B;  1NKZ B;  2CK3 H;  5AW2 B;  2W6B A;  4RES B;  2M8N A;  1GU4 A;  3L73 J;  1PGO A;  1T8K A;  1AA0 A;  1L0L G;  3CMA P;  3L35 A;  1YQ4 C;  1FZA A;  2B89 A;  5KAF E;  1FR2 A;  3JC2 2;  4HB1 A;  1CW5 A;  2OTL P;  1GL2 C;  5CCH D;  2JWA A;  3BVH A;  2Q7C A;  1GMJ A;  2KP8 A;  2IBZ I;  2ZYG A;  1E79 H;  1N73 A;  1LTJ C;  2BCC G;  4GR6 A;  3II6 A;  4WBA A;  1BXI A;  2AEM A;  3KXD A;  3M0A A;  1H0T B;  1U57 A;  2PNG A;  3IFM A;  1H0T A;  1E6J P;  3MGN A;  1RF1 A;  5F2O A;  3MZW B;  1BGY J;  2I1K A;  2FVE A;  3H32 A;  2CGQ A;  1NOH A;  1NTZ D;  3KPE A;  3L71 E;  3L71 G;  1NAY A;  4I1L A;  1GTW A;  1DEB A;  2GDY A;  1M74 A;  1T3J A;  4WY4 A;  2M8R A;  2H8P D;  3CCL P;  2WMM A;  4H44 D;  2OYI B;  2Q5U A;  3AEA C;  1OR5 A;  3GHG C;  2GZG A;  3PLN A;  2AEF A;  1NTZ J;  3B5N C;  3H1H G;  4IL6 E;  3KQG A;  1FZF A;  1UIX A;  1VQ6 P;  1KV4 A;  1S5L H;  2Q3E A;  2E76 C;  1L0N D;  1FOS E;  3A0B H;  1PV3 A;  4GT1 A;  2R44 A;  5EFW B;  2H89 C;  5GTH H;  1SQV J;  5HGO A;  3BRT B;  3TGU J;  1PPJ D;  1Y47 A;  2QJY B;  1JCC A;  2B9B A;  2EIA A;  3Q5S A;  2R5D A;  1PEM A;  1FOS F;  1L2P A;  1SVF A;  2PEM A;  3H1K G;  3KDP B;  1OZH A;  2M0B A;  2I8D A;  1S72 P;  4H2Y C;  1FU1 A;  3M06 A;  1VQ5 P;  1GK6 A;  3M9H A;  3L74 G;  3B5I A;  5DCK A;  4PJ0 H;  1HY8 A;  1XTG B;  3L74 D;  4N78 D;  2OGU A;  3G26 A;  2N1T B;  2GDX A;  4W7Z A;  1QLE D;  2AFD A;  4Y99 C;  1PIX A;  1Z6M A;  2FVA A;  1FAV A;  2FY8 A;  5M1B A;  4F37 A;  1Q7Y Q;  3VRL C;  4XRQ A;  3AE5 C;  4BRY A;  2XT1 A;  3VP8 A;  1HJB A;  3CC2 P;  2RH0 A;  1A02 F;  5APV A;  3FX0 A;  1ZMB A;  2ZT9 C;  3AED C;  3CWB E;  1ZV8 A;  2OTK E;  4BWN A;  1NU1 J;  2M5A B;  4U3F G;  1FE6 A;  4XFZ A;  2OYH A;  5AW3 B;  1S2E A;  5APS A;  1VQL P;  1AQ5 A;  5KAI H;  1IFN A;  1SQQ D;  5APX A;  1SFC D;  2K93 A;  2JP3 A;  3RL0 C;  3GZM A;  7CEI A;  1SQP J;  1Q81 Q;  2FBW C;  3WU2 E;  3AEE C;  4PD4 E;  3CWB J;  1K8A Q;  1HTL C;  3UIA A;  2K94 A;  3L73 D;  3MHV A;  1NU1 E;  1OW6 A;  3DS3 A;  4NEO A;  3WUV A;  3L72 G;  4RKU J;  1QEX A;  1M57 D;  2LML A;  2MR8 A;  1NTK D;  2ZT9 D;  2JO1 A;  2Y9Z A;  2M8L A;  1QRJ A;  2XV5 A;  2JGP A;  2E74 C;  5AVW B;  2JO0 A;  4QKO A;  1N7S C;  2OYH C;  3KHU A;  2MY5 A;  1PGP A;  1SQP E;  5APW A;  3HTK A;  2MVV A;  4HKG A;  2A45 I;  2AF8 A;  3GF7 A;  1OW7 A;  4WY4 D;  1W2B O;  2IBZ G;  3L75 G;  5KTB A;  2N1T D;  2R3S A;  2MD9 A;  2IFN A;  3EJE A;  5HV8 A;  3L70 J;  3FXD A;  2VLO A;  2AXC A;  2KOQ A;  5KLV K;  1DX7 A;  2E75 D;  1N73 B;  3HE4 B;  3A0H H;  2KR5 A;  5C39 A;  1L4A B;  3EQ2 A;  2BCC D;  3G9R A;  5AW5 B;  3H0D A;  2HR3 A;  3L71 D;  4U0F A;  1VKU A;  1JTH A;  4ZKU A;  4XE5 B;  3E1R A;  2KUB A;  2KNC A;  3DS4 A;  2JJL A;  1N86 A;  2WSC J;  1X79 B;  1GD2 E;  1CZQ A;  2YXQ B;  3U1A A;  3P05 A;  5KLV G;  2Y0C A;  1LGH B;  1UII A;  3Q3D A;  3H6P A;  1P84 D;  4MN4 C;  1URQ C;  1GXG A;  1VF5 B;  1RO2 A;  2YNY A;  3HD7 D;  2V7Q H;  2AVA A;  1QVG O;  3L71 J;  3BCC G;  3H1L D;  4K3A A;  4RJT A;  2FYN C;  3CL3 D;  2ONT A;  2IYP A;  4DZO A;  3TDK A;  1QX8 A;  3NY7 B;  1AJY A;  2L5G B;  4YXW H;  4CPG A;  2E1M A;  1KZU B;  5AW7 B;  2O1K A;  3CX5 D;  1M1J B;  3FWN A;  4C7N B;  3AE4 C;  3VOP A;  2QG4 A;  3HRN A;  2IYO A;  2ZVO B;  2CPB A;  3HE5 A;  4OH8 B;  3CCQ P;  3VMY A;  2XDJ A;  4IL6 X;  2KLU A;  1SQV D;  1PGJ A;  4ZKP A;  1NTK G;  3M9Q A;  3A5T A;  3BCC J;  1KYO E;  1BE3 J;  2FYN B;  1NTM J;  5AVY B;  5EJD A;  3TGU E;  4O9B A;  2K3R A;  2YO3 A;  1OIP A;  2BHV A;  4PH1 A;  4XFX A;  1N8R Q;  1RE4 A;  1R5S A;  1VQ7 P;  1GDT A;  1LWU C;  3C8V A;  2V7Q J;  1NTK K;  2GZJ A;  1YYC A;  3HE4 A;  1FC2 C;  1VQN P;  2LTE A;  2E42 A;  2PY8 A;  5B5E H;  3AE3 C;  2PEO A;  3BCC E;  3NXS A;  2D2C B;  3S9O A;  3RK3 D;  1NTM E;  2AFE A;  3Q1M A;  3N7N A;  5BU8 B;  1NTZ G;  3LIE A;  3MTU E;  3SFD C;  4BRY B;  4ZNC A;  4EI2 A;  1PP9 E;  3OW2 O;  3DPH A;  3CXC O;  3M1M A;  3AEB C;  3L73 E;  3GKL C;  4XA4 A;  2PEK A;  3CCM P;  4U3F D;  3L72 J;  4N3Y B;  2LOL A;  2QJP C;  4PD4 H;  3PP5 A;  5GTI E;  1A02 J;  2E74 B;  5DJU B;  1OFC X;  1EOQ A;  2L4B A;  1AYI A;  3WMM 0;  1FZC B;  3VMA A;  1KC8 Q;  1M1K Q;  2CG5 B;  3G0V A;  1W5C E;  1M6E X;  3HUS A;  1RE3 A;  2C9N Y;  3NMD A;  2HPC B;  1KIL D;  3VTP C;  5L8R J;  1LT9 C;  1L0N J;  1HUC A;  3H1K E;  2SPZ A;  2Q6Q A;  1JY3 N;  4L76 A;  1HQB A;  5KAF H;  2KG6 A;  4R4M A;  4YPC A;  3RK2 C;  4PV1 D;  1ZP0 C;  3WUT A;  2P67 A;  1G1J A;  1ZNV A;  1G2C A;  2WPT A;  1BSN A;  2XZ1 C;  1G2C B;  3SFE C;  1J1D C;  1NTZ E;  1LTA C;  3RG6 C;  2KB7 P;  1LNQ A;  1RF0 A;  2QA4 P;  4ASW A;  4CA3 A;  1IK7 A;  3IAO A;  4B86 A;  2A45 G;  1OXZ A;  1GL2 A;  1LWU B;  2LR2 A;  2O1J A;  3RBX A;  4U0C A;  1L4A A;  1GL2 B;  1LWU A;  4JBZ A;  4TT3 H;  4NPF X;  2WT7 A;  2L91 A;  1H8A A;  1RE4 C;  4H0L C;  3EFG A;  3RL0 B;  3L70 G;  3NTN A;  1USE A;  3I55 P;  1RHZ B;  2HOD A;  3H1L J;  4XRO A;  3VYI A;  3GZL A;  3RGU A;  2CWO A;  1N7L A;  2KGA A;  1H89 A;  2ZYD A;  1IO4 A;  1KQF B;  2KZJ A;  5BVZ A;  1T2K D;  1Q2N A;  4Y28 J;  2K1A A;  2VLQ A;  1T6A A;  4AUW A;  1KMI Z;  4GR2 A;  4W7Y A;  2ZXX A;  1DD4 A;  4U3F E;  2JB0 A;  4AQR D;  2YKQ A;  2LL8 A;  2PEI A;  1S1C X;  1JO5 A;  2OYI A;  1NTZ K;  4COC A;  1NTM K;  2BEZ F;  2N9B A;  4N6J A;  2NPS A;  1YHQ P;  1NYH A;  2N50 A;  4W80 A;  4BXL A;  2BAS A;  2IPP A;  5APT A;  1N7S D;  2RN0 A;  1M7L A;  1SQQ J;  3G1I A;  4ASV A;  1URQ A;  3AE8 C;  1IMQ A;  4N78 E;  5AVS B;  3AE9 C;  1DIP A;  1KYO H;  2QJP B;  1EDK A;  4BPG A;  5CBO A;  1LTJ A;  1K04 A;  1HWT C;  3G71 P;  1S5L X;  2Q3I A;  1NKN A;  1FS0 E;  2KWL A;  1K73 Q;  1SQV G;  3HD7 B;  1BCC E;  1L0N G;  2EHT A;  3P7K A;  1N7S A;  1T3U A;  5KP8 B;  2DGY A;  4UB6 H;  2KOD A;  5H2F H;  1FJK A;  3RL0 D;  2N1T C;  2B87 A;  2M8P A;  3H47 A;  2KS1 A;  3I56 P;  4H44 C;  3E1I A;  2L22 A;  1ZRT E;  2N1T A;  2K2Q A;  2J59 M;  2JBG A;  1AUM A;  2K5X A;  1HF9 A;  4H13 D;  2FFD A;  5CCG D;  1L0L K;  1H88 A;  3HYB A;  3C1L A;  1E5W A;  4YTP C;  2WPV B;  1CI6 B;  2WTY A;  3CI9 A;  3HD7 C;  2KG8 A;  4U0B A;  2W8Z A;  2WVR A;  1SQX G;  3V2P A;  1R8E A;  1YTZ I;  5F2K A;  2Z44 A;  2K37 A;  2QE7 H;  1IK9 A;  3O8Z A;  3ABV C;  2KOO A;  1PP9 J;  2AXT H;  1NU1 D;  5AVX B;  3CC4 P;  1KIL E;  2XXM A;  3H4E A;  1BGY D;  3A0H E;  2GYK A;  4WY4 C;  4YXD C;  3FXE A;  3SWF A;  4HJG H;  2K0X A;  3W67 A;  5CCG C;  2H43 A;  4PWV B;  2EFJ A;  4WWI A;  4KHX A;  3A7O A;  2E75 C;  2FXO A;  4U0D A;  3V5B A;  2JU2 A;  3HE5 B;  1F80 D;  2QJK B;  3D71 A;  1FDM A;  2KGC A;  4NPE A;  3AEF C;  2MR7 A;  2BCC E;  1Y9B A;  1EXJ A;  4GKG A;  2KW2 A;  1FDI A;  2YO2 A;  3Q5R A;  5CJ0 A;  1X0T A;  1ZXG A;  3CXH H;  2H88 C;  2NRG A;  1SQX K;  2WZ7 A;  4H2X C;  1JB0 J;  2FXM A;  3K5B A;  4GIF A;  1A8O A;  1RO0 A;  3LW5 J;  2GDW A;  2KOS A;  2RKL A;  1HH0 A;  2YMK A;  4NPD A;  3JCU E;  2E76 D;  3AEC C;  1DNY A;  3HTK B;  3CCV P;  3I5C A;  2XZR A;  3WU2 H;  1BE3 D;  1ZOY C;  1WRG A;  4UB8 E;  2LKM A;  4IZ6 A;  2QJY C;  3RK2 B;  3E2D A;  3ZDM A;  2WWW A;  1PFI A;  2NPS D;  1HGV A;  1QL1 A;  1Y8A A;  2NZ2 A;  1PEO A;  1KQG B;  2N5H A;  1M6N A;  2YIU C;  5E79 E;  3H1I D;  4R0M A;  1JY3 O;  2JKV A;  2LIU A;  2MKV A;  1U7M A;  2MVU A;  1P84 H;  2WT7 B;  3CCE P;  2HOD B;  1JJ2 O;  1MFZ A;  2Z4E A;  4Z1M H;  1W2E A;  5CJ4 A;  2KLV A;  4DOJ A;  5AVZ B;  4EOT A;  5HGM A;  1OWA A;  4XFJ A;  1L0I A;  3DS1 A;  2Z46 A;  2E5T A;  3H1I J;  2WIT A;  3RG2 A;  1DV5 A;  1OVU A;  2LXC B;  3AE1 C;  2BUO A;  2CPS A;  1M56 D;  3CE7 A;  4EDF A;  2P58 A;  4JPZ B;  2R3C A;  1IFI A;  1IFJ A;  4UB6 E;  3V4W A;  3DTJ A;  4BPF A;  1GZL A;  3PH0 A;  1LTB C;  3BAS A;  4PJ0 E;  3A3Y B;  3TSI A;  2ZAE B;  5E79 H;  3M0D C;  1EDL A;  5F2N A;  3OJA B;  4WY4 B;  4JQ0 D;  2PGD A;  3VN0 A;  1SQV E;  1M1J A;  2HFE D;  2H7H A;  5KLI C;  4MRT C;  2HPC A;  1IFM A;  2XND H;  3L37 A;  5CCG A;  5EW5 E;  1AF8 A;  4H44 B;  1LJ2 A;  2OQQ A;  2L6E A;  1EXI A;  2J5U A;  5BU5 A;  1KLP A;  2JAZ A;  3TF5 A;  1OW8 A;  5BS1 A;  5GTH E;  1KIL B;  1KYO D;  3PHL A;  2OAR A;  5AW0 B;  3LID A;  1SQB G;  4GOF A;  1RQV A;  2M5R A;  2J58 A;  2E74 D;  4DT0 A;  4C7R A;  1D7M A;  1SQQ K;  3HD7 A;  2L9F A;  1BCC D;  4IFM A;  1N7S B;  4IL6 H;  3E7K A;  1JMM A;  3EFF K;  2FFD C;  2WSF J;  2UWJ E;  1PEQ A;  3L75 D;  1MZ8 A;  4H2W C;  2QM7 A;  3S1K A;  2D2C C;  3KYQ A;  4ZMD A;  3G28 A;  2V4H A;  2C0X A;  1NHL A;  4H0L D;  3WUU A;  4GOD A;  2JDI H;  2FKW B;  1SQX D;  1YIJ P;  1A43 A;  1JTH B;  2KYV A;  3P8M C;  1X22 A;  1L0N E;  3L70 D;  1EDI A;  2D2C D;  2KNC B;  2PEN A;  1NU1 G;  1QL2 A;  4H13 C;  1YJ9 P;  1PGQ A;  2FQ2 A;  3F89 A;  5APQ A;  1X9V A;  2WSE J;  2GZI A;  3TK1 A;  3BRV B;  3SSU A;  1ZME C;  1LTI C;  5B66 H;  3W68 A;  3QH9 A;  3AE6 C;  1SQB E;  1NQ4 A;  3M0D A;  5TIS E;  5AVT B;  2W90 A;  3PRJ A;  1AVY A;  3GMA A;  1IFP A;  3V6I A;  1NAF A;  1BGY E;  2N6Y A;  5AVU B;  3D6Z A;  5KLV D;  1N73 C;  3AE7 C;  2ZT9 B;  1N2D C;  1CEI A;  3L72 D;  2QRX A;  2A06 E;  4H13 B;  2O01 N;  1RE3 C;  3MGE A;  1SQV K;  1FZE A;  5AW1 B;  4IFD K;  2HG5 D;  3P8C D;  4A7P A;  1PZQ A;  1JMB A;  5BS2 A;  1J2J B;  1KYO I;  3LW5 H;  2M3B A;  3VMX A;  1AVO A;  4DJG A;  1SQB J;  2WQY C;  1DEE G;  1M8O B;  2BQ1 E;  2HYN A;  2KSJ A;  5CBN A;  1JY2 N;  1OX3 A;  3A2A A;  2WPR A;  3L73 G;  5AW8 B;  4AYC A;  5KJ7 A;  3RL0 g;  1M90 Q;  1J1D B;  1EC5 A;  4IFF A;  3SWK A;  2IZ1 A;  3V2Q A;  4EYY Q;  2KS1 B;  2WPQ A;  2Y0E A;  1SQB D;  1EMV A;  1Z56 A;  1BAJ A;  3JCU H;  3KZI H;  1IC2 A;  1PEU A;  3T97 A;  4PXH B;  1GK4 A;  1NO4 A;  1KB9 H;  2O01 J;  1LP1 B;  2KIK A;  1SQQ E;  2XU6 A;  3D70 A;  4M3L A;  1YIT P;  1VF5 D;  3AEG C;  5APY A;  3V4Q A;  4PD4 D;  5KJ7 C;  2NPS C;  3L4F A;  1PL5 A;  1G1I A;  1GW3 A;  2KI7 B;  1X8Y A;  2KOG A;  3NFQ A;  1PP9 G;  1SFC B;  1NGM B;  1JY3 P;  3R4Y A;  3OAK A;  2BEQ D;  2WPS A;  4I7Z B;  3ITK A;  2K92 A;  2N6Z A;  1BDD A;  4I2L C;  2I1J A;  2YKO A;  4QMA A;  4K35 A;  1YI2 P;  5APU A;  1FZC A;  1SQP D;  4I6M C;  4JF7 A;  2Y9Y A;  2FAC A;  2A45 H;  1U7J A;  3P32 A;  5TJH A;  2W6A A;  4WVZ A;  3HZQ A;  2Y0D A;  3CCR P;  5KJ7 D;  3GHG A;  2E43 A;  1SQP G;  3GHG B;  3Q5P A;  4M0I A;  3CX5 E;  3B5N B;  1NTK E;  4DCK A;  1BSH A;  3Q2Y A;  2FQ0 A;  2PRR A;  3CXH D;  5AVQ B;  1GPJ A;  1ZR2 A;  1LTJ B;  1MKM A;  1Q90 D;  1YJN P;  1R5L A;  2LKI A;  3TGU G;  3GJN A;  5H2F E;  1P84 E;  2FAD A;  2QEX P;  3MUD A;  4L75 A;  3PJS K;  4U0E A;  2FYU K;  2A06 D;  2QVA A;  1NVO A;  1IJD B;  3V2N A;  1KFN A;  1JOC A;  2BCC J;  1LTG C;  1ZRT D;  2FFD B;  1SQX J;  3IF4 A;  1JCD A;  2XZ0 D;  1HJ0 A;  1CI6 A;  1NH4 A;  1SLQ A;  1VDF A;  1ACP A;  4OVN F;  1VQ9 P;  2KZI A;  2O01 H;  1NU1 K;  2VLN A;  2KOP A;  2ZVN B;  3H1J E;  3CXH I;  1HVV A;  3CCJ P;  2C9L Y;  1BDC A;  4HYT B;  1KD1 Q;  1T8Z A;  5CCH A;  3GLM A;  3CXH E;  1L0L E;  3M9B A;  3H1L G;  1PP9 D;  3GW6 A;  4U0A A;  1S4X A;  2ZXE B;  3GF3 A;  1NWQ A;  1IUQ A;  5AVR B;  4PV1 B;  2OYI C;  2PP6 A;  2NPS B;  2C0W A;  5KLV J;  4XFY A;  1VQP P;  1S9K E;  4D6T D;  5TIS H;  4COP A;  2VLP A;  2K0D X;  2DNW A;  2QNW A;  1K9M Q;  5B66 E;  5HGL A;  2P10 A;  4RO0 A;  3B4Q A;  2NO8 A;  3EJD A;  3NTE A;  2YXR B;  3USS A;  1KN7 A;  3OA7 A;  2GZE A;  1KQL A;  5CZD B;  1WT6 A;  2AXT E;  1L0L J;  1T2K C;  3RK3 E;  4OWF A;  1NTM D;  3H1H D;  1ZLL A;  1D1D A;  3H1I E;  2MF4 A;  4WYM A;  3EJB A;  1VQO P;  4PV1 C;  2N5I A;  2W27 A;  2IZ0 A;  1Q86 Q;  3O6Q B;  1L4A C;  3V2R A;  3O6Q A;  1X3O A;  2G3A A;  1SFC C;  5CHX A;  2QSI A;  2ZFC A;  1MZ9 A;  2FYZ A;  1NTM G;  4OGQ C;  5CMZ A;  1ZN5 A;  1BE3 G;  4L74 A;  3VMZ A;  2QJK C;  1GW4 A;  2MJZ A;  5HVC A;  1UNK A;  3DS5 A;  2IDB A;  1LP1 A;  3L75 E;  1VQM P;  4LGD E;  4JYB A;  3LMO A;  4IPY A;  3QWO C;  3VP9 A;  4GDO A;  1L4A D;  4JYC A;  3D6Y A;  2A06 G;  2OTJ P;  1PPJ E;  3IR9 A;  2PFX A;  3KZI E;  2N98 A; 
#chains in the Genus database with same CATH homology
 2PEI A;  2JYG A;  3CD6 P;  1M6E X;  1K30 A;  5JPA A;  1W2B O;  2XT1 A;  3G1G A;  3CC2 P;  4QNB A;  2BQ1 E;  5F2K A;  4U0A A;  4COC A;  1M74 A;  2Z44 A;  3CCL P;  2BHV A;  3HZQ A;  4PH1 A;  4XFX A;  1N8R Q;  1IUQ A;  2JYL A;  3CCE P;  1YHQ P;  3CCR P;  1JJ2 O;  1PEQ A;  3CC4 P;  1ZMB A;  2XXM A;  1VQ7 P;  3H4E A;  2LF4 A;  4XFY A;  3CPW O;  1M90 Q;  1VQP P;  1VQK P;  1RNI A;  3G28 A;  3DS2 A;  3G29 A;  4M0I A;  4COP A;  3H0D A;  4U0F A;  5HGM A;  4XFZ A;  3DS1 A;  3G1I A;  1K9M Q;  1VQ6 P;  1VQN P;  1YJW P;  2P9X A;  3CME P;  1EIA A;  2Z46 A;  1YIJ P;  2EFJ A;  5HGL A;  2PY8 A;  3CCU P;  1VQL P;  1BAJ A;  1A43 A;  3NTE A;  2BUO A;  2PEO A;  4PH0 A;  4U0D A;  1YJN P;  3DS4 A;  1PEU A;  2M8N A;  3Q20 A;  2XV6 A;  2PEQ A;  2PEN A;  5HGO A;  3P05 A;  1Q82 Q;  1YJ9 P;  3DTJ A;  3RG6 C;  2QEX P;  1Q81 Q;  1D1D A;  4WYM A;  3LRY A;  3G71 P;  1RO2 A;  3G4S P;  2QA4 P;  1VQO P;  1YIT P;  2EIA A;  4U0E A;  1QVG O;  1K73 Q;  1Q86 Q;  3OW2 O;  3CMA P;  3DPH A;  5F2N A;  1PEM A;  3DS0 A;  1KQS O;  1K8A Q;  2OTL P;  4U0C A;  3CXC O;  2DGY A;  2PEM A;  2KOD A;  2ONT A;  3M1M A;  1A8O A;  3G6E P;  1NJI Q;  1S72 P;  3DS3 A;  1VQ8 P;  2M8P A;  1RO0 A;  3H47 A;  3I55 P;  1VQ5 P;  2PEK A;  3CCM P;  3I56 P;  4XRO A;  3G21 A;  2E1M A;  5HGN A;  4GR6 A;  3B5I A;  2CWO A;  2M8L A;  1QRJ A;  3CCV P;  5DCK A;  2L6E A;  2JO0 A;  1AUM A;  1VQ9 P;  1QVF O;  1VQ4 P;  3CCQ P;  3DS5 A;  1E6J P;  3CCS P;  1EOQ A;  3MGE A;  2PEJ A;  5F2O A;  2EG5 A;  1VQM P;  2Z45 A;  1YI2 P;  3G26 A;  3HYB A;  4IPY A;  5BS1 A;  3CCJ P;  3E2D A;  1KD1 Q;  5BS2 A;  1KC8 Q;  4GR2 A;  2OAR A;  1M1K Q;  4U0B A;  3G0V A;  5I4T G;  1PEO A;  3CC7 P;  1Q7Y Q;  3VRL C;  3WBH A;  2OTJ P;  1M6N A;  4XRQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...