1K73Q

Co-crystal structure of anisomycin bound to the 50s ribosomal subunit
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAKGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title Structures of Five Antibiotics Bound at the Peptidyl Transferase Center of the Large Ribosomal Subunit
pubmed doi rcsb
molecule tags Ribosome
total genus 47
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2001-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1k73Q02
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1k73Q01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1k73Q03
3G6EP 3CXCO 1YIJP 3CCUP 3G4SP 1VQOP 1VQ6P 1VQ7P 3CC7P 1N8RQ 3CPWO 3CC2P 1YHQP 1KC8Q 3CCVP 1VQLP 1YI2P 1YITP 1Q81Q 3CCLP 1VQPP 3CMEP 3OW2O 1YJWP 1M90Q 3G71P 3CMAP 3CCRP 1YJ9P 1VQ8P 1W2BO 1M1KQ 1NJIQ 1VQ4P 1VQMP 1K8AQ 1QVFO 1K73Q 1S72P 1KD1Q 1YJNP 1VQ9P 2OTJP 1VQ5P 3CCSP 1Q82Q 3I56P 3CD6P 1QVGO 3CCQP 1K9MQ 1VQNP 2QA4P 3CCEP 1Q7YQ 2QEXP 3CC4P 1Q86Q 3CCMP 1VQKP 3I55P 2OTLP 3CCJP 1KQSO 1JJ2O
chains in the Genus database with same CATH superfamily
3LRYA 2KGAA 1KB9E 1GXHA 2V7QJ 4BPGA 2ONTA 3DTJA 4GODA 1DD3A 1P84D 3CLQA 1N7SD 4WYMA 2GZIA 3I56P 5I4TG 2HLOA 3AE1C 2GUSA 2PFXA 1KB9I 1TU3F 1NAFA 1GU4A 1HH0A 5CCHA 2PP6A 3L72E 3MHVA 2MR7A 3HE5A 3H47A 1KYOH 4C7RA 2IBZG 4HYTB 2WSCH 1NTMK 5GTIH 3AEEC 2W6BA 1Q7YQ 1JOCA 3VP8A 1IFPA 1PEQA 1N8RQ 1J1DC 1M1JB 5CJ0A 2QM7A 4JBZA 2GDXA 4YXDC 2GUVA 3CWBG 4QKOA 3VMAA 4U0BA 3LMOA 5KTBA 3P32A 1RNIA 1H0TA 4IFDK 5HV8A 3H6PA 2QJPB 3M91A 1KQSO 3L75J 1IFNA 3A3YB 3HYBA 1OVRA 3PHLA 3M0DC 3S1KA 2KZIA 3RG2A 3O6QB 3A7OA 1XTCC 4IL6E 2D2CD 1NJIQ 1KQFB 2NRGA 1L2PA 1M56D 4PD4D 2JQ4A 1ZP0C 2JO0A 1NTZE 2HFED 1AFOA 1VQ7P 2JBGA 5KLVJ 5L8RJ 4WBAA 2AFEA 2O01H 1NAYA 2YXRB 2E74B 3L70G 1LT9B 3RL0B 2GZJA 1PP9J 3TGUD 1RHZB 2M8NA 2WT7B 2GM4A 1FDIA 4XFZA 1S2EA 3QWOC 1BE3J 2L0QA 2WITA 5EW5E 2KG8A 4H13B 3W68A 3L70J 2XXMA 3CMEP 2KWLA 3L73D 1ZMBA 3GLMA 4YTPC 2YNYA 4PJ0E 1HWTC 2PEJA 3CCJP 3B4QA 1J1EC 1JY3N 3CXHH 1VQ6P 2WVRA 4W80A 4PV1D 2XNXA 4YPCA 3AEFC 2LOLA 3L71E 4BRYB 4ZKPA 4OGQC 1E79H 2FAEA 4IPYA 2YMKA 1NTKD 4AUWA 2K92A 2WQYC 2JB0A 4W7ZA 2J58A 1BAJA 5KAFH 3I55P 1N86A 1CEIA 1U57A 1IK9A 1L0NJ 1FDOA 1SS1A 1N7LA 2NPSB 3M1MA 1PFIA 3WBHA 1GU5A 3AE5C 5F2NA 3P8MC 3RGUA 1NTMG 2JU2A 2RKLA 2FXOA 1S5LX 2DGYA 2FVEA 1JY3O 3EJBA 4U7JA 1SQPG 1PGPA 2QJYB 3EJDA 2LTEA 1LWUC 1LTTC 4N6JA 3HUSC 3SWYA 2P2UA 3HD7C 2RH0A 3RK3D 2PRRA 3FGAD 1ZR2A 3G1IA 1ACPA 1EIAA 1P84E 1WRGA 1SQPJ 3V5BA 3MZWB 1KILB 2PEKA 2M3BA 1G1IA 3CCVP 2W8ZA 4GR2A 1BCCE 2KS1B 2O01J 5AW5B 2YKQA 1P84I 1PEMA 1HVVA 2OYHC 2ERHA 5CJ4A 3CXHE 2LL8A 1IMQA 1HGZA 3H1IE 1K05A 1DH3A 1JMMA 4U0DA 3GZMA 3USSA 1T2KD 2FYUG 2FYNC 1VF5D 1BDCA 5F2KA 5AVQB 1ZW0A 5B66E 3CCQP 3EQ2A 1PPJG 4I1LA 2G3AA 4PWVB 3CXHI 2POHA 1VQOP 3T97B 3M9HA 1PZQA 3VRLC 2FYUJ 4DJGA 1DIPA 3GJNA 1GZLA 2DNWA 1X9VA 4I6MC 2LF4A 3RK2D 3H1HG 1KQGB 1NGMB 4QMAA 3R4YA 1EMVA 4PD4E 1JJ2O 2JGPA 3CXCO 2ZAEB 2OTKE 2G8YA 1FZFA 3G1GA 3H1KG 3Q20A 1USDA 1GK4A 4RJTA 4IFMA 2LXBA 3BCCD 1RH5B 4PD4I 4JQ0D 3AE3C 2M3EA 3TGUE 2Z5HA 2A45G 1PEUA 1ZMEC 3LIDA 4U0CA 1M1JC 3LW5J 2N6ZA 4CA3A 3H1KJ 4D6TD 2PNGA 2PEOA 1FZCB 2L4BA 1K8AQ 4AQRD 2KLUA 4U3FD 1LP1B 1MUUA 1ZNVA 5KP8B 1Z56A 3L72D 3L73E 3H1LD 2QJPC 1NWQA 5APTA 2YXQB 2QJKB 2N50A 4EIJA 1X3OA 2XZ0D 1FC2C 1QL1A 2NO8A 5KAIH 3L75D 1SQVG 1LTAC 5DJUB 2KI7B 3B8EB 3PP5A 1NTKE 3H1JJ 1S4XA 4AYCA 1IC2A 1SLQA 2ZYDA 3O6QA 4L74A 2HYNA 3M0AA 3SWFA 4LGDE 5CMZA 1GTWA 1D7MA 3CX5D 2E74C 1SQVJ 1LT9C 2WSEH 1JM0A 3RL0C 1S72P 3ABVC 1URQB 5KLVD 1BSHA 2AVAA 2AXTE 1Q2NA 1J1EB 3EJEA 4BWNA 1RO0A 1VF5B 3H32B 4R0MA 3P05A 4GDOA 2OYOA 2CPSA 1PP9D 1RF0A 4GKGA 1Q81Q 2CPBA 2LR2A 3TDKA 5HGOA 2XDJA 4N3YB 2ZVNB 5BU8B 2R5DA 3NTEA 1BE3D 1F80D 5AW6B 3H0DA 2XZ1C 1VQKP 5BS2A 2AEMA 2P1JA 3IR9A 3RK3E 3RK2B 2PGDA 2Z5IA 2KOSA 4WY4B 1N7SC 3G9RA 5AVWB 5EJDA 1OVVA 2KXPB 5KP7B 3OA7A 1HY8A 2KW2A 2B87A 3OAKA 1YQ3C 1IFDA 3CCMP 1T8ZA 2ROQA 1SQBJ 3GF3A 3FXEA 3TF5A 1JCDA 3SWKA 1U7JA 1KYOD 3JCUH 3WMM0 3GHGA 2OQQA 2YO2A 2FACA 2KOQA 1XTGB 3B5ND 2BEZF 2NPSC 1ZXGA 2K88A 1L0ND 1L4AA 3CL3D 5CBNA 2FXPA 1KV4A 1SFCB 2JAZA 1CW5A 3IAOA 2P7JA 3Q5RA 3A0BE 4F37A 2Y0CA 1YHQP 1KC8Q 4NPDA 1QL2A 1L0LE 2PY8A 2QJYC 1NU1J 2QIWA 4JYBA 3S9OA 2FFDB 1AVOA 4IFFA 2BCCG 3PLNA 3G29A 1FDMA 1NTZK 5KJ7A 2JJLA 5EFWB 3E1IA 2PAJA 3H4EA 2PEMA 5K5GB 1KILC 1YI2P 3RL0g 4Y28J 1OZHA 2E43A 1JY2O 2IFMA 1GL2B 4ZKUA 2BQ1E 2K93A 1N73B 1HTLC 2H7HA 1D1DA 1M74A 1KILA 2N1TA 3BCCE 2I1JA 3G4SP 2N98A 2C0WA 4LC1A 5CCGC 2KGCA 1L0HA 2ZT9D 2YO3A 4JYCA 1OIPA 1BGYJ 3GF7A 4JF7A 4L75A 1WT6A 2XV5A 4D6TE 4UHPB 1VQNP 1IJDB 2K94A 3II6A 2FBWC 4U3FE 2QM8A 1BXIA 1HJ0A 5AW7B 3SFDC 1BCCD 3V4WA 2QSIA 2RN0A 3H1LE 1CI6B 1K04A 3VMZA 2IZ0A 1KFNA 1LTIC 2K3RA 3TNUB 3CXHD 3VN0A 1S5LE 3H1ID 3D70A 3L75E 3D6YA 2JU1A 3NTNA 2LKMA 1HQBA 1DX7A 1L4AD 1S1CX 2J5UA 4KHXA 2HODB 1W2BO 5AW4B 2N6YA 2ZFCA 4HKGA 5AVYB 2GDYA 3CC4P 1OX3A 3CX5E 4TT3H 1E0HA 2FQ0A 1NYHA 1JMBA 4M3LA 3G6EP 3B5NB 2XV6A 5KLVE 5CZDB 2P10A 3CWBJ 2OYIB 4IZ6A 2H88C 1UIXA 4RO0A 5KJ7D 2C9NY 1PP9E 2GA1A 4GIFA 4H44B 5AW1B 3G21A 3MP7B 1FZCC 3CX5I 2MKVA 1VHNA 1Y9BA 3D6ZA 1Q90D 2L9FA 1BE3E 3M0DA 4CPGA 1NQ4A 4WWIA 3DS2A 3TYYA 3L70E 5B5EH 2JWDA 2QJKC 3ITKA 2N1TD 1DEEG 1JTHA 4BPHA 2L5GB 2K0DX 4H2YC 3MUDC 2M5AB 3AEGC 5AVZB 2ZJSE 1QRJA 3L74G 2XT1A 3AEBC 3WU2H 1FZEA 1NTZG 2VLQA 2Q6QA 2K5XA 5DJTB 3ZDMA 5AVUB 1EXJA 1LNQA 1T3UA 4HH2A 1SP4A 1SQXG 2C0XA 2JR8A 1FOSE 1LTJB 3KPEA 2Q9IA 3H1JD 1KYOE 5CCHD 1KD1Q 5AW9B 2L6EA 3L74J 1PL5A 3DPHA 3CI9A 1URQC 5GTIE 2KGDA 3SFEC 2EG5A 1FE6A 1VF5C 1L0NE 5GTHH 2OGUA 4DG9A 5AVTB 1SQXJ 1N7SB 1VPCA 3CCRP 1KYOI 2B89A 3E7KA 3NFQA 3C9IA 3U43A 1QX8A 3B71A 1RE4C 1YIJP 2IX7C 3RK2C 1W5CE 1X22A 2C9LY 4WY4C 2GZFA 2JYGA 2AXCA 1FBMA 3L71G 1K73Q 3V2RA 5JPAA 4HJGH 2J59M 3NY7B 2YKOA 3AE9C 1SQPE 2N9BA 1AV1A 3AE2C 1FS0E 1PIXA 1GW4A 2W90A 3LW5H 4ASVA 5C39A 1LTBC 1M6EX 1YJWP 3A0HH 5B5EE 4IOIH 2M0BA 2IDBA 2M8PA 1RQUA 5BS1A 1QVFO 4K3AA 1SQBD 1NTMJ 1X0TA 1RF1B 3CCEP 2A45H 4GR6A 1L0IA 1EZVD 3WU2E 2A06G 1SFCC 2D2CB 4N78D 1E6JP 2P67A 1LWUA 1A8OA 1GK6A 2CNRA 2VLOA 3HUSA 1BSNA 3HD7A 2O1JA 7CEIA 5H2FH 2JKVA 1OR5A 2FFDC 2FADA 4MRTC 2WPRA 1S9KE 1NTKK 3IFMA 2R3CA 2B9BA 1NU1D 2YMYA 5E79H 1JNMA 5HVCA 2KSEA 3OW2O 1OW7A 3GW6A 2W83C 1AQTA 2E75D 1EDIA 1PPJE 2OYHA 1KORA 1R5LA 1GL2C 1IUQA 3HTKB 5KAFE 3G0VA 1N73C 3DS1A 1L0LD 4DZOA 3KZIH 2M8RA 2FQ2A 2AEFA 2K9YA 1SQQD 3HE5B 2GYKA 3W67A 4H2XC 1KLPA 4OGQD 4PV1B 3N7NA 5KLIB 1PGOA 2KNCA 3UIAA 1IK7A 1AQ5A 1BGYD 3DS4A 2UWJE 4XFYA 3H1HJ 5APWA 4OWFA 5TJHA 1OWAA 3V4QA 4C7NB 2ZXXA 2R32A 3G3ZA 1AVYA 2MD9A 2ZXEB 4R4MA 4W7YA 1KN7A 5AVRB 4EOTA 3CMAP 1EQ7A 5BVZA 3M9BA 2L22A 3L4FA 2VLPA 2Y0DA 5AVVB 2EIAA 2KSJA 2JEEA 2Q7CA 1IO4A 2Q1KA 1GDTA 3H1JE 5CHXA 1ZLLA 1M1JA 3TGUG 2IBZD 3B5NC 1EXIA 3EWKA 1L0LK 3RK3B 2OYIC 2XKMA 1SQVE 1SQQK 2FHSC 4KT0J 1NVOA 1FZAA 4H44C 4I2LC 3CWBD 3Q3DA 3CCUP 1Z6MA 3L73G 5M1BA 1VQ8P 1AA0A 2IPPA 1FAVA 1RQVA 2WSFH 3AECC 1K9MQ 3G26A 1Y47A 3IN6A 2Q3EA 2EHTA 3L73J 5KP6B 3F89A 1NTKG 2CG5B 3BASA 4XE5B 3LIEA 1LT9A 2KOOA 5AW2B 2M5AA 4COPA 4A7PA 2KLVA 1LTJC 1EC5A 1ZV8A 2WT7A 4HB1A 3V2NA 3P8CD 4LLHA 3L70D 1SQBE 3Q2YA 2FVFA 1HBWA 1JB0J 2Y0EA 3CC7P 3L37A 3KQGA 1EZVE 1LTJA 4N78E 3HE4B 2AEJA 1X8YA 1PGJA 2HR3A 3CCSP 2JDIH 4NPEA 2VRSA 2LMLA 2KK7A 5CBOA 1KB9H 5AVXB 1N7SA 1EZVI 4DCKA 1HJBA 2KOGA 2FKWB 1GW3A 4BRYA 2OARA 1NO4A 1NU1E 2IFNA 3NMDA 5AW3B 1R5SA 2JYLA 2MJZA 5KAIE 1QVGO 3FWNA 3GMAA 5KLVK 3PRJA 2K2QA 4H0LD 1U7MA 3M06A 2NPSA 1M8OB 1UJZA 1MKMA 1SQQE 4OVNF 1YTZT 4ZNCA 1RF1C 2EFJA 1OXZA 2Y9ZA 2WPSA 2LXCB 2D2CC 1X79B 3CE7A 1BGYE 2YKPA 3BVHA 3G71P 1NTMD 2BCCJ 3KHUA 3E2DA 4RKUJ 2KG9A 1QLED 1UNKA 1SQPD 4JPZB 3A5TA 2WSFJ 2E74D 3RL0D 2NZ2A 2XU6A 1NKNA 3M9QA 3AE7C 3CPWO 5DCKA 2E5TA 2KS1A 1M7LA 4IL6H 3N4XA 1MV8A 4PXHB 2O01N 4H13D 1JUNA 2K9JB 4B86A 2H43A 2OTLP 5APUA 1H88A 5CCGA 1L0NK 3BCCG 3B5IA 3AE4C 3L36A 1DEBA 2IZ1A 3L35A 5CCHC 1DD4A 3JCUE 2IBZE 1S9KD 4L73A 3RBZA 1PEOA 1NHLA 3U1CA 3C8VA 3BATA 3AE6C 3HTKA 2AFDA 4PV1C 4D6TG 2ITAA 2W6AA 2E76D 5KLIC 2FYUD 3BCCJ 3GG2A 3T97A 4U3FG 5HGLA 2VLNA 1IMPA 3CWBE 2IBZI 3MTUE 1VQPP 1JY3P 1PPJD 3L72G 3H1LG 3Q1MA 2AF8A 1YJ9P 2MR8A 1EDJA 2HPCB 4PJ0H 2QG4A 4D6TJ 2NPSD 2N9YB 1SQPK 3AEAC 4U3FJ 1J2JB 2X2BA 3L75G 3H1HD 5HGNA 1PGQA 3L72J 3H1LJ 1LTSC 4GOFA 2WPTA 2MF4A 1FJPA 1RY3A 4H0LB 4C7NA 3A2AA 2P9XA 1MZ9A 4M0IA 3VTPC 4UB6H 2E42A 3RBXA 3H1KD 2QVAA 2L91A 1MFTA 2WMMA 1LJ2A 3P8CE 5KLVG 3DS0A 3EFFK 3RK3C 4I7ZB 2I8DA 2E5YA 1FZCA 1KILD 1PP9G 1LP1A 3L74E 3MIWA 2KR5A 1WMKA 2ZYAA 1M57D 2H89C 2GZEA 5APSA 3MGEA 1A02F 1BE3G 1SQXE 1HF9A 2FYUK 4YXWH 4PH0A 5TISH 2BASA 1GMJA 2K0XA 3MUDA 5AW0B 5CCGD 4K35A 3R2PA 1GPJA 4NPFX 1P84H 2FVAA 2Z46A 5APQA 2KUBA 4WB4A 1NTZJ 2ZT9B 4XROA 1DNYA 3V2QA 1T2KC 3OJAB 2E75C 2KYVA 4COCA 1SQVD 3S4RA 2WZ7A 2PEQA 2O3JA 3Q5SA 1URQA 1VQ9P 1CSBA 3CD6P 2B87B 1YYCA 1JO5A 3EFGA 4QNBA 4C46A 3H32A 5AVSB 2M5RA 2CWOA 3VP9A 2E1MA 1G2CB 1RE3C 1L0NG 1FZGA 1HGVA 3GHGB 1H8AA 2E76B 4WVZA 1GXGA 2BUOA 5F2OA 5B66H 2WSCJ 4TLFA 1NTME 1RE4A 1L4AB 2MY5A 3AE8C 1OFCX 4UB6E 1RE3A 2R44A 2EHSA 1VL2A 4WY4A 2FXMA 1AF8A 4EI2A 2DW3A 3L71J 3HE4A 2WTYA 1ZRTD 3NXSA 4XFJA 2QA4P 2A06E 2KB7P 1Q86Q 3I5CA 4PD4H 1OW8A 2YIUB 2P58A 4Y99B 3PJSK 1VQLP 5TISE 1M90Q 1SQVK 4ASWA 2I1KA 3G28A 1SFCA 1USEA 1K30A 5KKZB 2KZJA 2B88A 1KFMA 2N1TB 2WWWA 2FYZA 1KQLA 3CC2P 5GTHE 4BPFA 2FYUE 3GZLA 2FFDA 1YQ4C 2WPVB 3MGNA 2Q5UA 4IL6X 3VOPA 3RG6C 1BCCG 3QH9A 2R3SA 3BRVB 1OMIA 2CQ8A 1LTGC 1JEKA 1NOHA 3U1AA 4NEOA 1URQD 2BCCD 3H1IG 2KOPA 3H1HE 1BCCJ 3U59A 2Z44A 2LPKA 4U0FA 3SSUA 1GL2A 1KZUB 3BRTB 1W2EA 1N73A 1PV3A 1SQBK 2LKIA 3HRNA 3H1IJ 3GKLC 2CK3H 2V4HA 2FQ1A 3H1KE 1QGKB 4KJMA 3A0HE 1EOQA 3JSVC 1EDLA 4WY4D 2K9JA 3V2PA 3Q5PA 3FWLA 3KDPB 2AXTH 1H0TB 1LT1A 1KILE 3HZQA 1FR2A 1J1DB 2XZRA 1MZ8A 1CI6A 1LGHB 1NU1K 4HKZH 2KORA 1M1KQ 3TNUA 1GD2E 3PTZA 1YJNP 3O8ZA 5H2FE 2A45I 2R5BA 1FU1A 1KB9D 2WSSH 3HD7D 4PH1A 3FX0A 2N5IA 1VDFA 4GOEA 2PENA 2HODA 5E79E 1CZQA 1SFCD 2JO1A 1Y8AA 2KP8A 2HPCA 2IYPA 1T8KA 2OTJP 1JTHB 4DOJA 3E1RA 4H0LC 2MVVA 1N2DC 1OW6A 3B5NA 2K37A 2ZVOB 1JY2P 3KXDA 3TGUJ 3H1JG 4EDFA 2OYIA 3FXDA 1AYIA 3KZIE 3VMYA 2JWAA 2GZGA 1RO2A 1VQ4P 1QEXA 4I7ZC 2QNWA 3D71A 5APXA 2QE7H 1FJKA 1ZR4A 1T6AA 3F5HA 2ZYGA 3A0BH 1R8EA 2H8PD 3VYIA 2Z4EA 4U0AA 2QRXA 2E75B 1GL2D 1YTZI 3IF4A 3CCLP 1FOSF 1RF0C 3B4SA 3K5BA 2KIKA 5APVA 2N5HA 1VQMP 1HUCA 4MN4C 2BHVA 2K0YA 2QEXP 2M8LA 1NTKJ 1A43A 1ZRTE 1KTMA 2ZT9C 1KMIZ 2V7QH 3WUUA 2MVUA 1A02J 1YITP 4OGQB 1NH4A 3AEDC 4H13C 1UIIA 3TK1A 1EDKA 3L74D 2W27A 4UB8H 3VMXA 1NTZD 3WUVA 1T3JA 1FZBA 1Q82Q 1IFJA 4O9BA 4GT1A 2O1KA 1SQXD 2KGEA 1JCCA 1SQBG 1BDDA 2RMZA 2LIUA 5APYA 1EZVG 2W6JH 1E5WA 3GHGC 2E76C 1M6NA 3MD0A 3KYQA 4R4LA 3PH0A 3H25A 1AJYA 4XRQA 2LIWA 1AUMA 2PEIA 1DV5A 1L4AC 2Z45A 1G2CA 4EYYQ 1G1JA 3DS5A 3WUTA 1LWUB 1SVFA 3HUSB 2SPZA 5BU5A 2BCCE 4OH8B 1NU1G 3HD7B 1JY2N 3TSIA 4ZMDA 1H89A 2KODA 5AW8B 1S5LH 3DS3A 4RESB 1NKZB 4BXLA 5HGMA 1ZN5A 3V6IA 1VKUA 4H44D 3L71D 5KJ7C 1ZOYC 1IFIA 2WPQA 3P7KA 2YIUC 2BEQD 4Y99C 2HG5D 2XNDH 1L0LG 2VSQA 4XA4A 1IFMA 3C1LA 1IZNB 1RF1A 1VQ5P 1OVUA 2Q3IA 3CX5H 2OYHB 1SQQG 4H2WC 2KG6A 1YBKA 5KKZC 4DT0A 1S3JA 3JC22 1SQXK 2N1TC 2JP3A 2CGQA 2GDWA 1L0LJ 2FYNB 4XFXA 1BGYG 4U0EA 4UB8E 2A06D 2IYOA 2Y9YA 1SQQJ 2WSEJ 4L76A 2FY8A 4Z1MH 1MFZA 2K1AA 2KNCB
chains in the Genus database with same CATH topology
3G6EP 3CXCO 1YIJP 3DS1A 4XROA 3CCUP 3LRYA 3H4EA 1VQ7P 4PH1A 2PEMA 2XV6A 3P05A 5HGLA 2DGYA 3CC2P 4COCA 1YI2P 1Q81Q 2ONTA 3DTJA 5HGOA 2PENA 1VQPP 3G1GA 2JYGA 1YJ9P 1VQ8P 2PEQA 3Q20A 3RG6C 1M6NA 3G21A 3NTEA 1K73Q 2OTJP 4WYMA 5JPAA 1VQ9P 3I56P 3CD6P 5I4TG 4XRQA 1K9MQ 2BQ1E 3G26A 3G1IA 1AUMA 2M8NA 3H0DA 1VQKP 1EIAA 5BS2A 2EFJA 2PEIA 4QNBA 1D1DA 1M74A 4XFZA 3G4SP 2Z45A 5HGNA 1PEUA 2CWOA 2PEKA 2E1MA 4U0CA 3DS4A 3DS5A 3DS2A 3CCVP 1M6EX 2XXMA 3CMEP 1YJWP 4GR2A 3H47A 3G71P 4XFYA 2Z44A 1RO2A 1VQ4P 2PEOA 2M8PA 4U0FA 4COPA 2BUOA 5BS1A 3E2DA 2KODA 1ZMBA 5F2OA 1K8AQ 1QVFO 1PEMA 1QRJA 2P9XA 1VQNP 3DS3A 3CCEP 1Q7YQ 4M0IA 4GR6A 3CCMP 2PEJA 5HGMA 2XT1A 3CCJP 1PEQA 1VQ6P 1E6JP 4U0AA 1N8RQ 3CC7P 4U0DA 3CPWO 3DS0A 5DCKA 1JJ2O 1A8OA 3CCLP 4U0BA 3CMAP 4IPYA 1EOQA 1RNIA 1VQMP 5F2KA 1KD1Q 2L6EA 3CCSP 2EIAA 1VQ5P 3DPHA 1BAJA 3CCQP 2BHVA 2QA4P 2QEXP 1Q86Q 2M8LA 3HZQA 1A43A 3I55P 2OTLP 1KQSO 1VQOP 2EG5A 3HYBA 3MGEA 3B5IA 1YHQP 1KC8Q 4PH0A 3VRLC 1VQLP 1YITP 2OARA 2PY8A 4XFXA 3OW2O 1M90Q 3CCRP 3M1MA 1W2BO 1M1KQ 2LF4A 4U0EA 1NJIQ 1PEOA 3WBHA 1S72P 1YJNP 1Q82Q 2JYLA 3G29A 3G28A 5F2NA 1QVGO 2JO0A 3CC4P 2Z46A 1IUQA 1K30A 1RO0A 3G0VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G6E P;  3CXC O;  1YIJ P;  3CCU P;  3G4S P;  1VQO P;  1VQ6 P;  1VQ7 P;  3CC7 P;  1N8R Q;  3CPW O;  3CC2 P;  1YHQ P;  1KC8 Q;  3CCV P;  1VQL P;  1YI2 P;  1YIT P;  1Q81 Q;  3CCL P;  1VQP P;  3CME P;  3OW2 O;  1YJW P;  1M90 Q;  3G71 P;  3CMA P;  3CCR P;  1YJ9 P;  1VQ8 P;  1W2B O;  1M1K Q;  1NJI Q;  1VQ4 P;  1VQM P;  1K8A Q;  1QVF O;  1K73 Q;  1S72 P;  1KD1 Q;  1YJN P;  1VQ9 P;  2OTJ P;  1VQ5 P;  3CCS P;  1Q82 Q;  3I56 P;  3CD6 P;  1QVG O;  3CCQ P;  1K9M Q;  1VQN P;  2QA4 P;  3CCE P;  1Q7Y Q;  2QEX P;  3CC4 P;  1Q86 Q;  3CCM P;  1VQK P;  3I55 P;  2OTL P;  3CCJ P;  1KQS O;  1JJ2 O; 
#chains in the Genus database with same CATH topology
 3LRY A;  2KGA A;  1KB9 E;  1GXH A;  2V7Q J;  4BPG A;  2ONT A;  3DTJ A;  4GOD A;  1DD3 A;  1P84 D;  3CLQ A;  1N7S D;  4WYM A;  2GZI A;  3I56 P;  5I4T G;  2HLO A;  3AE1 C;  2GUS A;  2PFX A;  1KB9 I;  1TU3 F;  1NAF A;  1GU4 A;  1HH0 A;  5CCH A;  2PP6 A;  3L72 E;  3MHV A;  2MR7 A;  3HE5 A;  3H47 A;  1KYO H;  4C7R A;  2IBZ G;  4HYT B;  2WSC H;  1NTM K;  5GTI H;  3AEE C;  2W6B A;  1Q7Y Q;  1JOC A;  3VP8 A;  1IFP A;  1PEQ A;  1N8R Q;  1J1D C;  1M1J B;  5CJ0 A;  2QM7 A;  4JBZ A;  2GDX A;  4YXD C;  2GUV A;  3CWB G;  4QKO A;  3VMA A;  4U0B A;  3LMO A;  5KTB A;  3P32 A;  1RNI A;  1H0T A;  4IFD K;  5HV8 A;  3H6P A;  2QJP B;  3M91 A;  1KQS O;  3L75 J;  1IFN A;  3A3Y B;  3HYB A;  1OVR A;  3PHL A;  3M0D C;  3S1K A;  2KZI A;  3RG2 A;  3O6Q B;  3A7O A;  1XTC C;  4IL6 E;  2D2C D;  1NJI Q;  1KQF B;  2NRG A;  1L2P A;  1M56 D;  4PD4 D;  2JQ4 A;  1ZP0 C;  2JO0 A;  1NTZ E;  2HFE D;  1AFO A;  1VQ7 P;  2JBG A;  5KLV J;  5L8R J;  4WBA A;  2AFE A;  2O01 H;  1NAY A;  2YXR B;  2E74 B;  3L70 G;  1LT9 B;  3RL0 B;  2GZJ A;  1PP9 J;  3TGU D;  1RHZ B;  2M8N A;  2WT7 B;  2GM4 A;  1FDI A;  4XFZ A;  1S2E A;  3QWO C;  1BE3 J;  2L0Q A;  2WIT A;  5EW5 E;  2KG8 A;  4H13 B;  3W68 A;  3L70 J;  2XXM A;  3CME P;  2KWL A;  3L73 D;  1ZMB A;  3GLM A;  4YTP C;  2YNY A;  4PJ0 E;  1HWT C;  2PEJ A;  3CCJ P;  3B4Q A;  1J1E C;  1JY3 N;  3CXH H;  1VQ6 P;  2WVR A;  4W80 A;  4PV1 D;  2XNX A;  4YPC A;  3AEF C;  2LOL A;  3L71 E;  4BRY B;  4ZKP A;  4OGQ C;  1E79 H;  2FAE A;  4IPY A;  2YMK A;  1NTK D;  4AUW A;  2K92 A;  2WQY C;  2JB0 A;  4W7Z A;  2J58 A;  1BAJ A;  5KAF H;  3I55 P;  1N86 A;  1CEI A;  1U57 A;  1IK9 A;  1L0N J;  1FDO A;  1SS1 A;  1N7L A;  2NPS B;  3M1M A;  1PFI A;  3WBH A;  1GU5 A;  3AE5 C;  5F2N A;  3P8M C;  3RGU A;  1NTM G;  2JU2 A;  2RKL A;  2FXO A;  1S5L X;  2DGY A;  2FVE A;  1JY3 O;  3EJB A;  4U7J A;  1SQP G;  1PGP A;  2QJY B;  3EJD A;  2LTE A;  1LWU C;  1LTT C;  4N6J A;  3HUS C;  3SWY A;  2P2U A;  3HD7 C;  2RH0 A;  3RK3 D;  2PRR A;  3FGA D;  1ZR2 A;  3G1I A;  1ACP A;  1EIA A;  1P84 E;  1WRG A;  1SQP J;  3V5B A;  3MZW B;  1KIL B;  2PEK A;  2M3B A;  1G1I A;  3CCV P;  2W8Z A;  4GR2 A;  1BCC E;  2KS1 B;  2O01 J;  5AW5 B;  2YKQ A;  1P84 I;  1PEM A;  1HVV A;  2OYH C;  2ERH A;  5CJ4 A;  3CXH E;  2LL8 A;  1IMQ A;  1HGZ A;  3H1I E;  1K05 A;  1DH3 A;  1JMM A;  4U0D A;  3GZM A;  3USS A;  1T2K D;  2FYU G;  2FYN C;  1VF5 D;  1BDC A;  5F2K A;  5AVQ B;  1ZW0 A;  5B66 E;  3CCQ P;  3EQ2 A;  1PPJ G;  4I1L A;  2G3A A;  4PWV B;  3CXH I;  2POH A;  1VQO P;  3T97 B;  3M9H A;  1PZQ A;  3VRL C;  2FYU J;  4DJG A;  1DIP A;  3GJN A;  1GZL A;  2DNW A;  1X9V A;  4I6M C;  2LF4 A;  3RK2 D;  3H1H G;  1KQG B;  1NGM B;  4QMA A;  3R4Y A;  1EMV A;  4PD4 E;  1JJ2 O;  2JGP A;  3CXC O;  2ZAE B;  2OTK E;  2G8Y A;  1FZF A;  3G1G A;  3H1K G;  3Q20 A;  1USD A;  1GK4 A;  4RJT A;  4IFM A;  2LXB A;  3BCC D;  1RH5 B;  4PD4 I;  4JQ0 D;  3AE3 C;  2M3E A;  3TGU E;  2Z5H A;  2A45 G;  1PEU A;  1ZME C;  3LID A;  4U0C A;  1M1J C;  3LW5 J;  2N6Z A;  4CA3 A;  3H1K J;  4D6T D;  2PNG A;  2PEO A;  1FZC B;  2L4B A;  1K8A Q;  4AQR D;  2KLU A;  4U3F D;  1LP1 B;  1MUU A;  1ZNV A;  5KP8 B;  1Z56 A;  3L72 D;  3L73 E;  3H1L D;  2QJP C;  1NWQ A;  5APT A;  2YXQ B;  2QJK B;  2N50 A;  4EIJ A;  1X3O A;  2XZ0 D;  1FC2 C;  1QL1 A;  2NO8 A;  5KAI H;  3L75 D;  1SQV G;  1LTA C;  5DJU B;  2KI7 B;  3B8E B;  3PP5 A;  1NTK E;  3H1J J;  1S4X A;  4AYC A;  1IC2 A;  1SLQ A;  2ZYD A;  3O6Q A;  4L74 A;  2HYN A;  3M0A A;  3SWF A;  4LGD E;  5CMZ A;  1GTW A;  1D7M A;  3CX5 D;  2E74 C;  1SQV J;  1LT9 C;  2WSE H;  1JM0 A;  3RL0 C;  1S72 P;  3ABV C;  1URQ B;  5KLV D;  1BSH A;  2AVA A;  2AXT E;  1Q2N A;  1J1E B;  3EJE A;  4BWN A;  1RO0 A;  1VF5 B;  3H32 B;  4R0M A;  3P05 A;  4GDO A;  2OYO A;  2CPS A;  1PP9 D;  1RF0 A;  4GKG A;  1Q81 Q;  2CPB A;  2LR2 A;  3TDK A;  5HGO A;  2XDJ A;  4N3Y B;  2ZVN B;  5BU8 B;  2R5D A;  3NTE A;  1BE3 D;  1F80 D;  5AW6 B;  3H0D A;  2XZ1 C;  1VQK P;  5BS2 A;  2AEM A;  2P1J A;  3IR9 A;  3RK3 E;  3RK2 B;  2PGD A;  2Z5I A;  2KOS A;  4WY4 B;  1N7S C;  3G9R A;  5AVW B;  5EJD A;  1OVV A;  2KXP B;  5KP7 B;  3OA7 A;  1HY8 A;  2KW2 A;  2B87 A;  3OAK A;  1YQ3 C;  1IFD A;  3CCM P;  1T8Z A;  2ROQ A;  1SQB J;  3GF3 A;  3FXE A;  3TF5 A;  1JCD A;  3SWK A;  1U7J A;  1KYO D;  3JCU H;  3WMM 0;  3GHG A;  2OQQ A;  2YO2 A;  2FAC A;  2KOQ A;  1XTG B;  3B5N D;  2BEZ F;  2NPS C;  1ZXG A;  2K88 A;  1L0N D;  1L4A A;  3CL3 D;  5CBN A;  2FXP A;  1KV4 A;  1SFC B;  2JAZ A;  1CW5 A;  3IAO A;  2P7J A;  3Q5R A;  3A0B E;  4F37 A;  2Y0C A;  1YHQ P;  1KC8 Q;  4NPD A;  1QL2 A;  1L0L E;  2PY8 A;  2QJY C;  1NU1 J;  2QIW A;  4JYB A;  3S9O A;  2FFD B;  1AVO A;  4IFF A;  2BCC G;  3PLN A;  3G29 A;  1FDM A;  1NTZ K;  5KJ7 A;  2JJL A;  5EFW B;  3E1I A;  2PAJ A;  3H4E A;  2PEM A;  5K5G B;  1KIL C;  1YI2 P;  3RL0 g;  4Y28 J;  1OZH A;  2E43 A;  1JY2 O;  2IFM A;  1GL2 B;  4ZKU A;  2BQ1 E;  2K93 A;  1N73 B;  1HTL C;  2H7H A;  1D1D A;  1M74 A;  1KIL A;  2N1T A;  3BCC E;  2I1J A;  3G4S P;  2N98 A;  2C0W A;  4LC1 A;  5CCG C;  2KGC A;  1L0H A;  2ZT9 D;  2YO3 A;  4JYC A;  1OIP A;  1BGY J;  3GF7 A;  4JF7 A;  4L75 A;  1WT6 A;  2XV5 A;  4D6T E;  4UHP B;  1VQN P;  1IJD B;  2K94 A;  3II6 A;  2FBW C;  4U3F E;  2QM8 A;  1BXI A;  1HJ0 A;  5AW7 B;  3SFD C;  1BCC D;  3V4W A;  2QSI A;  2RN0 A;  3H1L E;  1CI6 B;  1K04 A;  3VMZ A;  2IZ0 A;  1KFN A;  1LTI C;  2K3R A;  3TNU B;  3CXH D;  3VN0 A;  1S5L E;  3H1I D;  3D70 A;  3L75 E;  3D6Y A;  2JU1 A;  3NTN A;  2LKM A;  1HQB A;  1DX7 A;  1L4A D;  1S1C X;  2J5U A;  4KHX A;  2HOD B;  1W2B O;  5AW4 B;  2N6Y A;  2ZFC A;  4HKG A;  5AVY B;  2GDY A;  3CC4 P;  1OX3 A;  3CX5 E;  4TT3 H;  1E0H A;  2FQ0 A;  1NYH A;  1JMB A;  4M3L A;  3G6E P;  3B5N B;  2XV6 A;  5KLV E;  5CZD B;  2P10 A;  3CWB J;  2OYI B;  4IZ6 A;  2H88 C;  1UIX A;  4RO0 A;  5KJ7 D;  2C9N Y;  1PP9 E;  2GA1 A;  4GIF A;  4H44 B;  5AW1 B;  3G21 A;  3MP7 B;  1FZC C;  3CX5 I;  2MKV A;  1VHN A;  1Y9B A;  3D6Z A;  1Q90 D;  2L9F A;  1BE3 E;  3M0D A;  4CPG A;  1NQ4 A;  4WWI A;  3DS2 A;  3TYY A;  3L70 E;  5B5E H;  2JWD A;  2QJK C;  3ITK A;  2N1T D;  1DEE G;  1JTH A;  4BPH A;  2L5G B;  2K0D X;  4H2Y C;  3MUD C;  2M5A B;  3AEG C;  5AVZ B;  2ZJS E;  1QRJ A;  3L74 G;  2XT1 A;  3AEB C;  3WU2 H;  1FZE A;  1NTZ G;  2VLQ A;  2Q6Q A;  2K5X A;  5DJT B;  3ZDM A;  5AVU B;  1EXJ A;  1LNQ A;  1T3U A;  4HH2 A;  1SP4 A;  1SQX G;  2C0X A;  2JR8 A;  1FOS E;  1LTJ B;  3KPE A;  2Q9I A;  3H1J D;  1KYO E;  5CCH D;  1KD1 Q;  5AW9 B;  2L6E A;  3L74 J;  1PL5 A;  3DPH A;  3CI9 A;  1URQ C;  5GTI E;  2KGD A;  3SFE C;  2EG5 A;  1FE6 A;  1VF5 C;  1L0N E;  5GTH H;  2OGU A;  4DG9 A;  5AVT B;  1SQX J;  1N7S B;  1VPC A;  3CCR P;  1KYO I;  2B89 A;  3E7K A;  3NFQ A;  3C9I A;  3U43 A;  1QX8 A;  3B71 A;  1RE4 C;  1YIJ P;  2IX7 C;  3RK2 C;  1W5C E;  1X22 A;  2C9L Y;  4WY4 C;  2GZF A;  2JYG A;  2AXC A;  1FBM A;  3L71 G;  1K73 Q;  3V2R A;  5JPA A;  4HJG H;  2J59 M;  3NY7 B;  2YKO A;  3AE9 C;  1SQP E;  2N9B A;  1AV1 A;  3AE2 C;  1FS0 E;  1PIX A;  1GW4 A;  2W90 A;  3LW5 H;  4ASV A;  5C39 A;  1LTB C;  1M6E X;  1YJW P;  3A0H H;  5B5E E;  4IOI H;  2M0B A;  2IDB A;  2M8P A;  1RQU A;  5BS1 A;  1QVF O;  4K3A A;  1SQB D;  1NTM J;  1X0T A;  1RF1 B;  3CCE P;  2A45 H;  4GR6 A;  1L0I A;  1EZV D;  3WU2 E;  2A06 G;  1SFC C;  2D2C B;  4N78 D;  1E6J P;  2P67 A;  1LWU A;  1A8O A;  1GK6 A;  2CNR A;  2VLO A;  3HUS A;  1BSN A;  3HD7 A;  2O1J A;  7CEI A;  5H2F H;  2JKV A;  1OR5 A;  2FFD C;  2FAD A;  4MRT C;  2WPR A;  1S9K E;  1NTK K;  3IFM A;  2R3C A;  2B9B A;  1NU1 D;  2YMY A;  5E79 H;  1JNM A;  5HVC A;  2KSE A;  3OW2 O;  1OW7 A;  3GW6 A;  2W83 C;  1AQT A;  2E75 D;  1EDI A;  1PPJ E;  2OYH A;  1KOR A;  1R5L A;  1GL2 C;  1IUQ A;  3HTK B;  5KAF E;  3G0V A;  1N73 C;  3DS1 A;  1L0L D;  4DZO A;  3KZI H;  2M8R A;  2FQ2 A;  2AEF A;  2K9Y A;  1SQQ D;  3HE5 B;  2GYK A;  3W67 A;  4H2X C;  1KLP A;  4OGQ D;  4PV1 B;  3N7N A;  5KLI B;  1PGO A;  2KNC A;  3UIA A;  1IK7 A;  1AQ5 A;  1BGY D;  3DS4 A;  2UWJ E;  4XFY A;  3H1H J;  5APW A;  4OWF A;  5TJH A;  1OWA A;  3V4Q A;  4C7N B;  2ZXX A;  2R32 A;  3G3Z A;  1AVY A;  2MD9 A;  2ZXE B;  4R4M A;  4W7Y A;  1KN7 A;  5AVR B;  4EOT A;  3CMA P;  1EQ7 A;  5BVZ A;  3M9B A;  2L22 A;  3L4F A;  2VLP A;  2Y0D A;  5AVV B;  2EIA A;  2KSJ A;  2JEE A;  2Q7C A;  1IO4 A;  2Q1K A;  1GDT A;  3H1J E;  5CHX A;  1ZLL A;  1M1J A;  3TGU G;  2IBZ D;  3B5N C;  1EXI A;  3EWK A;  1L0L K;  3RK3 B;  2OYI C;  2XKM A;  1SQV E;  1SQQ K;  2FHS C;  4KT0 J;  1NVO A;  1FZA A;  4H44 C;  4I2L C;  3CWB D;  3Q3D A;  3CCU P;  1Z6M A;  3L73 G;  5M1B A;  1VQ8 P;  1AA0 A;  2IPP A;  1FAV A;  1RQV A;  2WSF H;  3AEC C;  1K9M Q;  3G26 A;  1Y47 A;  3IN6 A;  2Q3E A;  2EHT A;  3L73 J;  5KP6 B;  3F89 A;  1NTK G;  2CG5 B;  3BAS A;  4XE5 B;  3LIE A;  1LT9 A;  2KOO A;  5AW2 B;  2M5A A;  4COP A;  4A7P A;  2KLV A;  1LTJ C;  1EC5 A;  1ZV8 A;  2WT7 A;  4HB1 A;  3V2N A;  3P8C D;  4LLH A;  3L70 D;  1SQB E;  3Q2Y A;  2FVF A;  1HBW A;  1JB0 J;  2Y0E A;  3CC7 P;  3L37 A;  3KQG A;  1EZV E;  1LTJ A;  4N78 E;  3HE4 B;  2AEJ A;  1X8Y A;  1PGJ A;  2HR3 A;  3CCS P;  2JDI H;  4NPE A;  2VRS A;  2LML A;  2KK7 A;  5CBO A;  1KB9 H;  5AVX B;  1N7S A;  1EZV I;  4DCK A;  1HJB A;  2KOG A;  2FKW B;  1GW3 A;  4BRY A;  2OAR A;  1NO4 A;  1NU1 E;  2IFN A;  3NMD A;  5AW3 B;  1R5S A;  2JYL A;  2MJZ A;  5KAI E;  1QVG O;  3FWN A;  3GMA A;  5KLV K;  3PRJ A;  2K2Q A;  4H0L D;  1U7M A;  3M06 A;  2NPS A;  1M8O B;  1UJZ A;  1MKM A;  1SQQ E;  4OVN F;  1YTZ T;  4ZNC A;  1RF1 C;  2EFJ A;  1OXZ A;  2Y9Z A;  2WPS A;  2LXC B;  2D2C C;  1X79 B;  3CE7 A;  1BGY E;  2YKP A;  3BVH A;  3G71 P;  1NTM D;  2BCC J;  3KHU A;  3E2D A;  4RKU J;  2KG9 A;  1QLE D;  1UNK A;  1SQP D;  4JPZ B;  3A5T A;  2WSF J;  2E74 D;  3RL0 D;  2NZ2 A;  2XU6 A;  1NKN A;  3M9Q A;  3AE7 C;  3CPW O;  5DCK A;  2E5T A;  2KS1 A;  1M7L A;  4IL6 H;  3N4X A;  1MV8 A;  4PXH B;  2O01 N;  4H13 D;  1JUN A;  2K9J B;  4B86 A;  2H43 A;  2OTL P;  5APU A;  1H88 A;  5CCG A;  1L0N K;  3BCC G;  3B5I A;  3AE4 C;  3L36 A;  1DEB A;  2IZ1 A;  3L35 A;  5CCH C;  1DD4 A;  3JCU E;  2IBZ E;  1S9K D;  4L73 A;  3RBZ A;  1PEO A;  1NHL A;  3U1C A;  3C8V A;  3BAT A;  3AE6 C;  3HTK A;  2AFD A;  4PV1 C;  4D6T G;  2ITA A;  2W6A A;  2E76 D;  5KLI C;  2FYU D;  3BCC J;  3GG2 A;  3T97 A;  4U3F G;  5HGL A;  2VLN A;  1IMP A;  3CWB E;  2IBZ I;  3MTU E;  1VQP P;  1JY3 P;  1PPJ D;  3L72 G;  3H1L G;  3Q1M A;  2AF8 A;  1YJ9 P;  2MR8 A;  1EDJ A;  2HPC B;  4PJ0 H;  2QG4 A;  4D6T J;  2NPS D;  2N9Y B;  1SQP K;  3AEA C;  4U3F J;  1J2J B;  2X2B A;  3L75 G;  3H1H D;  5HGN A;  1PGQ A;  3L72 J;  3H1L J;  1LTS C;  4GOF A;  2WPT A;  2MF4 A;  1FJP A;  1RY3 A;  4H0L B;  4C7N A;  3A2A A;  2P9X A;  1MZ9 A;  4M0I A;  3VTP C;  4UB6 H;  2E42 A;  3RBX A;  3H1K D;  2QVA A;  2L91 A;  1MFT A;  2WMM A;  1LJ2 A;  3P8C E;  5KLV G;  3DS0 A;  3EFF K;  3RK3 C;  4I7Z B;  2I8D A;  2E5Y A;  1FZC A;  1KIL D;  1PP9 G;  1LP1 A;  3L74 E;  3MIW A;  2KR5 A;  1WMK A;  2ZYA A;  1M57 D;  2H89 C;  2GZE A;  5APS A;  3MGE A;  1A02 F;  1BE3 G;  1SQX E;  1HF9 A;  2FYU K;  4YXW H;  4PH0 A;  5TIS H;  2BAS A;  1GMJ A;  2K0X A;  3MUD A;  5AW0 B;  5CCG D;  4K35 A;  3R2P A;  1GPJ A;  4NPF X;  1P84 H;  2FVA A;  2Z46 A;  5APQ A;  2KUB A;  4WB4 A;  1NTZ J;  2ZT9 B;  4XRO A;  1DNY A;  3V2Q A;  1T2K C;  3OJA B;  2E75 C;  2KYV A;  4COC A;  1SQV D;  3S4R A;  2WZ7 A;  2PEQ A;  2O3J A;  3Q5S A;  1URQ A;  1VQ9 P;  1CSB A;  3CD6 P;  2B87 B;  1YYC A;  1JO5 A;  3EFG A;  4QNB A;  4C46 A;  3H32 A;  5AVS B;  2M5R A;  2CWO A;  3VP9 A;  2E1M A;  1G2C B;  1RE3 C;  1L0N G;  1FZG A;  1HGV A;  3GHG B;  1H8A A;  2E76 B;  4WVZ A;  1GXG A;  2BUO A;  5F2O A;  5B66 H;  2WSC J;  4TLF A;  1NTM E;  1RE4 A;  1L4A B;  2MY5 A;  3AE8 C;  1OFC X;  4UB6 E;  1RE3 A;  2R44 A;  2EHS A;  1VL2 A;  4WY4 A;  2FXM A;  1AF8 A;  4EI2 A;  2DW3 A;  3L71 J;  3HE4 A;  2WTY A;  1ZRT D;  3NXS A;  4XFJ A;  2QA4 P;  2A06 E;  2KB7 P;  1Q86 Q;  3I5C A;  4PD4 H;  1OW8 A;  2YIU B;  2P58 A;  4Y99 B;  3PJS K;  1VQL P;  5TIS E;  1M90 Q;  1SQV K;  4ASW A;  2I1K A;  3G28 A;  1SFC A;  1USE A;  1K30 A;  5KKZ B;  2KZJ A;  2B88 A;  1KFM A;  2N1T B;  2WWW A;  2FYZ A;  1KQL A;  3CC2 P;  5GTH E;  4BPF A;  2FYU E;  3GZL A;  2FFD A;  1YQ4 C;  2WPV B;  3MGN A;  2Q5U A;  4IL6 X;  3VOP A;  3RG6 C;  1BCC G;  3QH9 A;  2R3S A;  3BRV B;  1OMI A;  2CQ8 A;  1LTG C;  1JEK A;  1NOH A;  3U1A A;  4NEO A;  1URQ D;  2BCC D;  3H1I G;  2KOP A;  3H1H E;  1BCC J;  3U59 A;  2Z44 A;  2LPK A;  4U0F A;  3SSU A;  1GL2 A;  1KZU B;  3BRT B;  1W2E A;  1N73 A;  1PV3 A;  1SQB K;  2LKI A;  3HRN A;  3H1I J;  3GKL C;  2CK3 H;  2V4H A;  2FQ1 A;  3H1K E;  1QGK B;  4KJM A;  3A0H E;  1EOQ A;  3JSV C;  1EDL A;  4WY4 D;  2K9J A;  3V2P A;  3Q5P A;  3FWL A;  3KDP B;  2AXT H;  1H0T B;  1LT1 A;  1KIL E;  3HZQ A;  1FR2 A;  1J1D B;  2XZR A;  1MZ8 A;  1CI6 A;  1LGH B;  1NU1 K;  4HKZ H;  2KOR A;  1M1K Q;  3TNU A;  1GD2 E;  3PTZ A;  1YJN P;  3O8Z A;  5H2F E;  2A45 I;  2R5B A;  1FU1 A;  1KB9 D;  2WSS H;  3HD7 D;  4PH1 A;  3FX0 A;  2N5I A;  1VDF A;  4GOE A;  2PEN A;  2HOD A;  5E79 E;  1CZQ A;  1SFC D;  2JO1 A;  1Y8A A;  2KP8 A;  2HPC A;  2IYP A;  1T8K A;  2OTJ P;  1JTH B;  4DOJ A;  3E1R A;  4H0L C;  2MVV A;  1N2D C;  1OW6 A;  3B5N A;  2K37 A;  2ZVO B;  1JY2 P;  3KXD A;  3TGU J;  3H1J G;  4EDF A;  2OYI A;  3FXD A;  1AYI A;  3KZI E;  3VMY A;  2JWA A;  2GZG A;  1RO2 A;  1VQ4 P;  1QEX A;  4I7Z C;  2QNW A;  3D71 A;  5APX A;  2QE7 H;  1FJK A;  1ZR4 A;  1T6A A;  3F5H A;  2ZYG A;  3A0B H;  1R8E A;  2H8P D;  3VYI A;  2Z4E A;  4U0A A;  2QRX A;  2E75 B;  1GL2 D;  1YTZ I;  3IF4 A;  3CCL P;  1FOS F;  1RF0 C;  3B4S A;  3K5B A;  2KIK A;  5APV A;  2N5H A;  1VQM P;  1HUC A;  4MN4 C;  2BHV A;  2K0Y A;  2QEX P;  2M8L A;  1NTK J;  1A43 A;  1ZRT E;  1KTM A;  2ZT9 C;  1KMI Z;  2V7Q H;  3WUU A;  2MVU A;  1A02 J;  1YIT P;  4OGQ B;  1NH4 A;  3AED C;  4H13 C;  1UII A;  3TK1 A;  1EDK A;  3L74 D;  2W27 A;  4UB8 H;  3VMX A;  1NTZ D;  3WUV A;  1T3J A;  1FZB A;  1Q82 Q;  1IFJ A;  4O9B A;  4GT1 A;  2O1K A;  1SQX D;  2KGE A;  1JCC A;  1SQB G;  1BDD A;  2RMZ A;  2LIU A;  5APY A;  1EZV G;  2W6J H;  1E5W A;  3GHG C;  2E76 C;  1M6N A;  3MD0 A;  3KYQ A;  4R4L A;  3PH0 A;  3H25 A;  1AJY A;  4XRQ A;  2LIW A;  1AUM A;  2PEI A;  1DV5 A;  1L4A C;  2Z45 A;  1G2C A;  4EYY Q;  1G1J A;  3DS5 A;  3WUT A;  1LWU B;  1SVF A;  3HUS B;  2SPZ A;  5BU5 A;  2BCC E;  4OH8 B;  1NU1 G;  3HD7 B;  1JY2 N;  3TSI A;  4ZMD A;  1H89 A;  2KOD A;  5AW8 B;  1S5L H;  3DS3 A;  4RES B;  1NKZ B;  4BXL A;  5HGM A;  1ZN5 A;  3V6I A;  1VKU A;  4H44 D;  3L71 D;  5KJ7 C;  1ZOY C;  1IFI A;  2WPQ A;  3P7K A;  2YIU C;  2BEQ D;  4Y99 C;  2HG5 D;  2XND H;  1L0L G;  2VSQ A;  4XA4 A;  1IFM A;  3C1L A;  1IZN B;  1RF1 A;  1VQ5 P;  1OVU A;  2Q3I A;  3CX5 H;  2OYH B;  1SQQ G;  4H2W C;  2KG6 A;  1YBK A;  5KKZ C;  4DT0 A;  1S3J A;  3JC2 2;  1SQX K;  2N1T C;  2JP3 A;  2CGQ A;  2GDW A;  1L0L J;  2FYN B;  4XFX A;  1BGY G;  4U0E A;  4UB8 E;  2A06 D;  2IYO A;  2Y9Y A;  1SQQ J;  2WSE J;  4L76 A;  2FY8 A;  4Z1M H;  1MFZ A;  2K1A A;  2KNC B; 
#chains in the Genus database with same CATH homology
 3G6E P;  3CXC O;  1YIJ P;  3DS1 A;  4XRO A;  3CCU P;  3LRY A;  3H4E A;  1VQ7 P;  4PH1 A;  2PEM A;  2XV6 A;  3P05 A;  5HGL A;  2DGY A;  3CC2 P;  4COC A;  1YI2 P;  1Q81 Q;  2ONT A;  3DTJ A;  5HGO A;  2PEN A;  1VQP P;  3G1G A;  2JYG A;  1YJ9 P;  1VQ8 P;  2PEQ A;  3Q20 A;  3RG6 C;  1M6N A;  3G21 A;  3NTE A;  1K73 Q;  2OTJ P;  4WYM A;  5JPA A;  1VQ9 P;  3I56 P;  3CD6 P;  5I4T G;  4XRQ A;  1K9M Q;  2BQ1 E;  3G26 A;  3G1I A;  1AUM A;  2M8N A;  3H0D A;  1VQK P;  1EIA A;  5BS2 A;  2EFJ A;  2PEI A;  4QNB A;  1D1D A;  1M74 A;  4XFZ A;  3G4S P;  2Z45 A;  5HGN A;  1PEU A;  2CWO A;  2PEK A;  2E1M A;  4U0C A;  3DS4 A;  3DS5 A;  3DS2 A;  3CCV P;  1M6E X;  2XXM A;  3CME P;  1YJW P;  4GR2 A;  3H47 A;  3G71 P;  4XFY A;  2Z44 A;  1RO2 A;  1VQ4 P;  2PEO A;  2M8P A;  4U0F A;  4COP A;  2BUO A;  5BS1 A;  3E2D A;  2KOD A;  1ZMB A;  5F2O A;  1K8A Q;  1QVF O;  1PEM A;  1QRJ A;  2P9X A;  1VQN P;  3DS3 A;  3CCE P;  1Q7Y Q;  4M0I A;  4GR6 A;  3CCM P;  2PEJ A;  5HGM A;  2XT1 A;  3CCJ P;  1PEQ A;  1VQ6 P;  1E6J P;  4U0A A;  1N8R Q;  3CC7 P;  4U0D A;  3CPW O;  3DS0 A;  5DCK A;  1JJ2 O;  1A8O A;  3CCL P;  4U0B A;  3CMA P;  4IPY A;  1EOQ A;  1RNI A;  1VQM P;  5F2K A;  1KD1 Q;  2L6E A;  3CCS P;  2EIA A;  1VQ5 P;  3DPH A;  1BAJ A;  3CCQ P;  2BHV A;  2QA4 P;  2QEX P;  1Q86 Q;  2M8L A;  3HZQ A;  1A43 A;  3I55 P;  2OTL P;  1KQS O;  1VQO P;  2EG5 A;  3HYB A;  3MGE A;  3B5I A;  1YHQ P;  1KC8 Q;  4PH0 A;  3VRL C;  1VQL P;  1YIT P;  2OAR A;  2PY8 A;  4XFX A;  3OW2 O;  1M90 Q;  3CCR P;  3M1M A;  1W2B O;  1M1K Q;  2LF4 A;  4U0E A;  1NJI Q;  1PEO A;  3WBH A;  1S72 P;  1YJN P;  1Q82 Q;  2JYL A;  3G29 A;  3G28 A;  5F2N A;  1QVG O;  2JO0 A;  3CC4 P;  2Z46 A;  1IUQ A;  1K30 A;  1RO0 A;  3G0V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...