1JJ2O

Fully refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAKGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S RRNA
publication title The kink-turn: a new RNA secondary structure motif.
pubmed doi rcsb
total genus 47
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2001-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1jj2O02
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1jj2O01
3CCLP 3CCQP 3CCEP 3CC7P 2OTLP 3OW2O 1Q7YQ 2OTJP 1YI2P 1QVFO 1YJWP 3CCJP 1VQ4P 3CCSP 3CCRP 3CMEP 1VQ6P 1VQPP 3G4SP 3I56P 3CCVP 1YITP 2QA4P 1YIJP 1JJ2O 3CCMP 1K8AQ 1M90Q 3CXCO 1Q82Q 1W2BO 1Q86Q 1QVGO 1K9MQ 3CMAP 1VQLP 3CC4P 1M1KQ 1KD1Q 3CC2P 1VQ5P 1VQ7P 3I55P 1VQ8P 1YJNP 1VQNP 3G71P 2QEXP 3CPWO 1YJ9P 1VQ9P 1YHQP 1NJIQ 1VQKP 1Q81Q 1K73Q 1VQMP 1KC8Q 3G6EP 1VQOP 3CD6P 1KQSO 3CCUP 1N8RQ 1S72P
chains in the Genus database with same CATH superfamily
1L0IA 2MVUA 1YJWP 4NEOA 3CMEP 3MGEA 4DG9A 2M8PA 2CQ8A 1FR2A 2KOQA 3E2DA 2K0XA 1GXGA 1PEOA 2XZ1C 1YJNP 3VRLC 2KOOA 2FQ0A 5KP7B 2GZFA 2LMLA 1EOQA 3CCJP 2MVVA 3U43A 2JU1A 2VLPA 1M6NA 2NO8A 2KGAA 2Z46A 2GZIA 1RNIA 2FAEA 2BQ1E 3DTJA 2WPTA 1PEUA 2FVEA 2AFEA 3CE7A 2KR5A 3CCVP 5BS2A 1YIJP 2L22A 1K8AQ 1IUQA 1HY8A 3CC2P 1VQNP 1VQ8P 2JAZA 1EIAA 1T8KA 3DS4A 4XRQA 3CC7P 3G26A 1K30A 1Q7YQ 4PH1A 2GZEA 2GDXA 2LF4A 3CCMP 2EHTA 2LKIA 2N5HA 1OR5A 2M8LA 3I55P 5CZDB 4U0FA 5F2NA 1NJIQ 2KG8A 1KQSO 1N8RQ 3CCLP 5BS1A 2K2QA 3G4SP 2KG9A 1E0HA 2GZJA 4U0BA 2JO0A 2XV6A 2MD9A 3B5IA 2KGDA 2KG6A 5HGLA 1DV5A 1VQ9P 1ZMBA 1Q81Q 2XZ0D 3CD6P 4XFZA 1NQ4A 3DS2A 4H2XC 1UNKA 2DGYA 3CXCO 3NY7B 1VQLP 3CMAP 1RO0A 1IMQA 4PH0A 2KWLA 1KC8Q 2BHVA 3CCEP 2CGQA 2OTLP 1KLPA 2LOLA 2JBGA 2AFDA 3CCRP 3G21A 1GXHA 2Z44A 3GZLA 3G1GA 2QNWA 4IPYA 1AYIA 2PEQA 2VSQA 4XROA 1QVGO 4U0CA 1RO2A 2FADA 2BUOA 3DS0A 4M0IA 2PEOA 2JYGA 1DNYA 5EJDA 1PEMA 2M5RA 3G0VA 4PXHB 3DS1A 1VHNA 2L9FA 2N98A 2CG5B 1ACPA 2QA4P 1HQBA 2VLOA 1M74A 2L0QA 2P9XA 4BPHA 2LPKA 3G28A 2KGEA 3GZMA 2EIAA 2QEXP 2MR8A 2FQ2A 1D1DA 1X3OA 2MR7A 3H0DA 2LIUA 2ROQA 4U0AA 3CCQP 2N5IA 2JYLA 3CCSP 1VQ6P 2EG5A 3NTEA 3RG6C 3CC4P 2GDYA 2LIWA 3EJEA 3H47A 4WYMA 2LL8A 1K73Q 3M1MA 1A8OA 5EW5E 2L4BA 5HV8A 2OTJP 1BXIA 2KOPA 3RG2A 4QNBA 1A43A 1Q82Q 1Q86Q 4XFYA 2N6ZA 1E6JP 2EFJA 2GZGA 5F2KA 4COPA 1KD1Q 4UHPB 3CPWO 2K0DX 1Z6MA 2KODA 3G6EP 1IMPA 2PEMA 1GPJA 3OW2O 2MY5A 2L6EA 1JJ2O 3WBHA 2CNRA 2ERHA 2GDWA 4HKGA 2PEKA 1VKUA 3HZQA 1VQ7P 2JB0A 5KP6B 1VQMP 2DNWA 2K94A 4BPGA 4COCA 2XXMA 5I4TG 1YITP 1BAJA 4GR2A 2E1MA 3LMOA 2N6YA 4PWVB 4QKOA 2X2BA 2M8NA 4U0DA 2PENA 3G1IA 2PY8A 2EHSA 5HVCA 2LTEA 4H2WC 2AVAA 3GKLC 3GJNA 1M90Q 2Z45A 1M6EX 1M1KQ 5F2OA 5HGMA 2K0YA 2XT1A 1YJ9P 1VQKP 5KP8B 5HGNA 5HGOA 1VQ5P 1QRJA 4U0EA 2ONTA 2PEJA 5DCKA 1VQPP 1AUMA 3HYBA 4CA3A 2PEIA 5JPAA 4F37A 2N50A 3G29A 1AF8A 3B4QA 1EMVA 2VLNA 4BPFA 3EJDA 3Q20A 1YI2P 1QVFO 1CEIA 1MZ8A 2FVFA 2KW2A 2FVAA 3I56P 2K92A 2OARA 2FQ1A 2GYKA 1PEQA 4H2YC 4GR6A 1ZNVA 1YHQP 2MF4A 3P05A 2K93A 7CEIA 2JU2A 1VQOP 3CCUP 2KOSA 4IZ6A 3H4EA 3DPHA 1VQ4P 3LRYA 3EJBA 2CWOA 3DS3A 3DS5A 2PNGA 1UJZA 2JQ4A 2KGCA 2AF8A 1W2BO 2KORA 4XFXA 1K9MQ 4MRTC 1F80D 2FACA 3G71P 2FHSC 2K5XA 2VLQA 1L0HA 2JGPA 4R0MA 1S72P
chains in the Genus database with same CATH topology
3CCLP 4U0AA 3CCQP 5BS1A 2PENA 3G1IA 2PY8A 2JYLA 1YJWP 3CMEP 3CCSP 1VQ6P 3MGEA 3G4SP 2M8PA 4U0BA 2EG5A 2JO0A 2XV6A 1M90Q 3NTEA 3RG6C 3B5IA 2Z45A 3E2DA 3CC4P 1M6EX 1PEOA 1M1KQ 5F2OA 5HGLA 1YJNP 5HGMA 3VRLC 3H47A 4WYMA 2XT1A 1YJ9P 1VQ9P 1VQKP 1ZMBA 1Q81Q 3M1MA 1K73Q 1A8OA 5HGNA 5HGOA 1VQ5P 3CD6P 4XFZA 1EOQA 1QRJA 3DS2A 4U0EA 2ONTA 2PEJA 2OTJP 5DCKA 3CCJP 1VQPP 1AUMA 2DGYA 4QNBA 1A43A 3CXCO 1Q82Q 3HYBA 1Q86Q 4XFYA 1M6NA 2PEIA 1VQLP 3CMAP 1E6JP 1RO0A 2EFJA 5F2KA 4COPA 5JPAA 1KD1Q 2Z46A 1RNIA 3G29A 3CPWO 4PH0A 2BQ1E 2KODA 3DTJA 1KC8Q 3G6EP 2BHVA 2PEMA 3CCEP 3Q20A 1PEUA 2OTLP 3OW2O 1YI2P 1QVFO 3CCRP 3G21A 3I56P 3CCVP 2Z44A 2L6EA 3G1GA 5BS2A 1YIJP 1JJ2O 1K8AQ 4IPYA 3WBHA 2PEQA 1IUQA 4XROA 1QVGO 2OARA 2PEKA 3CC2P 4U0CA 3HZQA 1VQNP 1VQ7P 1VQ8P 1PEQA 4GR6A 1EIAA 1YHQP 1RO2A 3P05A 3DS4A 4XRQA 1VQMP 1VQOP 3CCUP 3DS0A 2BUOA 4M0IA 2PEOA 2JYGA 3CC7P 3G26A 3H4EA 1PEMA 3DPHA 1K30A 1Q7YQ 3G0VA 2XXMA 4PH1A 4COCA 5I4TG 3DS1A 1VQ4P 3LRYA 2LF4A 1YITP 2CWOA 2QA4P 1BAJA 3DS3A 3DS5A 1M74A 2E1MA 4GR2A 3CCMP 2P9XA 1W2BO 4XFXA 1K9MQ 2M8LA 3G28A 3I55P 2EIAA 3G71P 2QEXP 4U0FA 2M8NA 5F2NA 1D1DA 4U0DA 1NJIQ 3H0DA 1KQSO 1N8RQ 1S72P
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCL P;  3CCQ P;  3CCE P;  3CC7 P;  2OTL P;  3OW2 O;  1Q7Y Q;  2OTJ P;  1YI2 P;  1QVF O;  1YJW P;  3CCJ P;  1VQ4 P;  3CCS P;  3CCR P;  3CME P;  1VQ6 P;  1VQP P;  3G4S P;  3I56 P;  3CCV P;  1YIT P;  2QA4 P;  1YIJ P;  1JJ2 O;  3CCM P;  1K8A Q;  1M90 Q;  3CXC O;  1Q82 Q;  1W2B O;  1Q86 Q;  1QVG O;  1K9M Q;  3CMA P;  1VQL P;  3CC4 P;  1M1K Q;  1KD1 Q;  3CC2 P;  1VQ5 P;  1VQ7 P;  3I55 P;  1VQ8 P;  1YJN P;  1VQN P;  3G71 P;  2QEX P;  3CPW O;  1YJ9 P;  1VQ9 P;  1YHQ P;  1NJI Q;  1VQK P;  1Q81 Q;  1K73 Q;  1VQM P;  1KC8 Q;  3G6E P;  1VQO P;  3CD6 P;  1KQS O;  3CCU P;  1N8R Q;  1S72 P; 
#chains in the Genus database with same CATH topology
 1L0I A;  2MVU A;  1YJW P;  4NEO A;  3CME P;  3MGE A;  4DG9 A;  2M8P A;  2CQ8 A;  1FR2 A;  2KOQ A;  3E2D A;  2K0X A;  1GXG A;  1PEO A;  2XZ1 C;  1YJN P;  3VRL C;  2KOO A;  2FQ0 A;  5KP7 B;  2GZF A;  2LML A;  1EOQ A;  3CCJ P;  2MVV A;  3U43 A;  2JU1 A;  2VLP A;  1M6N A;  2NO8 A;  2KGA A;  2Z46 A;  2GZI A;  1RNI A;  2FAE A;  2BQ1 E;  3DTJ A;  2WPT A;  1PEU A;  2FVE A;  2AFE A;  3CE7 A;  2KR5 A;  3CCV P;  5BS2 A;  1YIJ P;  2L22 A;  1K8A Q;  1IUQ A;  1HY8 A;  3CC2 P;  1VQN P;  1VQ8 P;  2JAZ A;  1EIA A;  1T8K A;  3DS4 A;  4XRQ A;  3CC7 P;  3G26 A;  1K30 A;  1Q7Y Q;  4PH1 A;  2GZE A;  2GDX A;  2LF4 A;  3CCM P;  2EHT A;  2LKI A;  2N5H A;  1OR5 A;  2M8L A;  3I55 P;  5CZD B;  4U0F A;  5F2N A;  1NJI Q;  2KG8 A;  1KQS O;  1N8R Q;  3CCL P;  5BS1 A;  2K2Q A;  3G4S P;  2KG9 A;  1E0H A;  2GZJ A;  4U0B A;  2JO0 A;  2XV6 A;  2MD9 A;  3B5I A;  2KGD A;  2KG6 A;  5HGL A;  1DV5 A;  1VQ9 P;  1ZMB A;  1Q81 Q;  2XZ0 D;  3CD6 P;  4XFZ A;  1NQ4 A;  3DS2 A;  4H2X C;  1UNK A;  2DGY A;  3CXC O;  3NY7 B;  1VQL P;  3CMA P;  1RO0 A;  1IMQ A;  4PH0 A;  2KWL A;  1KC8 Q;  2BHV A;  3CCE P;  2CGQ A;  2OTL P;  1KLP A;  2LOL A;  2JBG A;  2AFD A;  3CCR P;  3G21 A;  1GXH A;  2Z44 A;  3GZL A;  3G1G A;  2QNW A;  4IPY A;  1AYI A;  2PEQ A;  2VSQ A;  4XRO A;  1QVG O;  4U0C A;  1RO2 A;  2FAD A;  2BUO A;  3DS0 A;  4M0I A;  2PEO A;  2JYG A;  1DNY A;  5EJD A;  1PEM A;  2M5R A;  3G0V A;  4PXH B;  3DS1 A;  1VHN A;  2L9F A;  2N98 A;  2CG5 B;  1ACP A;  2QA4 P;  1HQB A;  2VLO A;  1M74 A;  2L0Q A;  2P9X A;  4BPH A;  2LPK A;  3G28 A;  2KGE A;  3GZM A;  2EIA A;  2QEX P;  2MR8 A;  2FQ2 A;  1D1D A;  1X3O A;  2MR7 A;  3H0D A;  2LIU A;  2ROQ A;  4U0A A;  3CCQ P;  2N5I A;  2JYL A;  3CCS P;  1VQ6 P;  2EG5 A;  3NTE A;  3RG6 C;  3CC4 P;  2GDY A;  2LIW A;  3EJE A;  3H47 A;  4WYM A;  2LL8 A;  1K73 Q;  3M1M A;  1A8O A;  5EW5 E;  2L4B A;  5HV8 A;  2OTJ P;  1BXI A;  2KOP A;  3RG2 A;  4QNB A;  1A43 A;  1Q82 Q;  1Q86 Q;  4XFY A;  2N6Z A;  1E6J P;  2EFJ A;  2GZG A;  5F2K A;  4COP A;  1KD1 Q;  4UHP B;  3CPW O;  2K0D X;  1Z6M A;  2KOD A;  3G6E P;  1IMP A;  2PEM A;  1GPJ A;  3OW2 O;  2MY5 A;  2L6E A;  1JJ2 O;  3WBH A;  2CNR A;  2ERH A;  2GDW A;  4HKG A;  2PEK A;  1VKU A;  3HZQ A;  1VQ7 P;  2JB0 A;  5KP6 B;  1VQM P;  2DNW A;  2K94 A;  4BPG A;  4COC A;  2XXM A;  5I4T G;  1YIT P;  1BAJ A;  4GR2 A;  2E1M A;  3LMO A;  2N6Y A;  4PWV B;  4QKO A;  2X2B A;  2M8N A;  4U0D A;  2PEN A;  3G1I A;  2PY8 A;  2EHS A;  5HVC A;  2LTE A;  4H2W C;  2AVA A;  3GKL C;  3GJN A;  1M90 Q;  2Z45 A;  1M6E X;  1M1K Q;  5F2O A;  5HGM A;  2K0Y A;  2XT1 A;  1YJ9 P;  1VQK P;  5KP8 B;  5HGN A;  5HGO A;  1VQ5 P;  1QRJ A;  4U0E A;  2ONT A;  2PEJ A;  5DCK A;  1VQP P;  1AUM A;  3HYB A;  4CA3 A;  2PEI A;  5JPA A;  4F37 A;  2N50 A;  3G29 A;  1AF8 A;  3B4Q A;  1EMV A;  2VLN A;  4BPF A;  3EJD A;  3Q20 A;  1YI2 P;  1QVF O;  1CEI A;  1MZ8 A;  2FVF A;  2KW2 A;  2FVA A;  3I56 P;  2K92 A;  2OAR A;  2FQ1 A;  2GYK A;  1PEQ A;  4H2Y C;  4GR6 A;  1ZNV A;  1YHQ P;  2MF4 A;  3P05 A;  2K93 A;  7CEI A;  2JU2 A;  1VQO P;  3CCU P;  2KOS A;  4IZ6 A;  3H4E A;  3DPH A;  1VQ4 P;  3LRY A;  3EJB A;  2CWO A;  3DS3 A;  3DS5 A;  2PNG A;  1UJZ A;  2JQ4 A;  2KGC A;  2AF8 A;  1W2B O;  2KOR A;  4XFX A;  1K9M Q;  4MRT C;  1F80 D;  2FAC A;  3G71 P;  2FHS C;  2K5X A;  2VLQ A;  1L0H A;  2JGP A;  4R0M A;  1S72 P; 
#chains in the Genus database with same CATH homology
 3CCL P;  4U0A A;  3CCQ P;  5BS1 A;  2PEN A;  3G1I A;  2PY8 A;  2JYL A;  1YJW P;  3CME P;  3CCS P;  1VQ6 P;  3MGE A;  3G4S P;  2M8P A;  4U0B A;  2EG5 A;  2JO0 A;  2XV6 A;  1M90 Q;  3NTE A;  3RG6 C;  3B5I A;  2Z45 A;  3E2D A;  3CC4 P;  1M6E X;  1PEO A;  1M1K Q;  5F2O A;  5HGL A;  1YJN P;  5HGM A;  3VRL C;  3H47 A;  4WYM A;  2XT1 A;  1YJ9 P;  1VQ9 P;  1VQK P;  1ZMB A;  1Q81 Q;  3M1M A;  1K73 Q;  1A8O A;  5HGN A;  5HGO A;  1VQ5 P;  3CD6 P;  4XFZ A;  1EOQ A;  1QRJ A;  3DS2 A;  4U0E A;  2ONT A;  2PEJ A;  2OTJ P;  5DCK A;  3CCJ P;  1VQP P;  1AUM A;  2DGY A;  4QNB A;  1A43 A;  3CXC O;  1Q82 Q;  3HYB A;  1Q86 Q;  4XFY A;  1M6N A;  2PEI A;  1VQL P;  3CMA P;  1E6J P;  1RO0 A;  2EFJ A;  5F2K A;  4COP A;  5JPA A;  1KD1 Q;  2Z46 A;  1RNI A;  3G29 A;  3CPW O;  4PH0 A;  2BQ1 E;  2KOD A;  3DTJ A;  1KC8 Q;  3G6E P;  2BHV A;  2PEM A;  3CCE P;  3Q20 A;  1PEU A;  2OTL P;  3OW2 O;  1YI2 P;  1QVF O;  3CCR P;  3G21 A;  3I56 P;  3CCV P;  2Z44 A;  2L6E A;  3G1G A;  5BS2 A;  1YIJ P;  1JJ2 O;  1K8A Q;  4IPY A;  3WBH A;  2PEQ A;  1IUQ A;  4XRO A;  1QVG O;  2OAR A;  2PEK A;  3CC2 P;  4U0C A;  3HZQ A;  1VQN P;  1VQ7 P;  1VQ8 P;  1PEQ A;  4GR6 A;  1EIA A;  1YHQ P;  1RO2 A;  3P05 A;  3DS4 A;  4XRQ A;  1VQM P;  1VQO P;  3CCU P;  3DS0 A;  2BUO A;  4M0I A;  2PEO A;  2JYG A;  3CC7 P;  3G26 A;  3H4E A;  1PEM A;  3DPH A;  1K30 A;  1Q7Y Q;  3G0V A;  2XXM A;  4PH1 A;  4COC A;  5I4T G;  3DS1 A;  1VQ4 P;  3LRY A;  2LF4 A;  1YIT P;  2CWO A;  2QA4 P;  1BAJ A;  3DS3 A;  3DS5 A;  1M74 A;  2E1M A;  4GR2 A;  3CCM P;  2P9X A;  1W2B O;  4XFX A;  1K9M Q;  2M8L A;  3G28 A;  3I55 P;  2EIA A;  3G71 P;  2QEX P;  4U0F A;  2M8N A;  5F2N A;  1D1D A;  4U0D A;  1NJI Q;  3H0D A;  1KQS O;  1N8R Q;  1S72 P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...