1JJ2O

Fully refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAKGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The kink-turn: a new RNA secondary structure motif.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S RRNA
total genus 47
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2001-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1jj2O02
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1jj2O01
1M90Q 1VQ8P 3G4SP 1YHQP 1Q81Q 1K73Q 3OW2O 3CCLP 1VQ4P 3CMEP 1VQLP 3CPWO 1KD1Q 1S72P 3CCMP 3CC7P 3CCQP 1K8AQ 3CC4P 3CCJP 3CCUP 3CC2P 2OTLP 3I56P 1VQMP 1VQ5P 1QVGO 1Q7YQ 3CCSP 1YITP 1KQSO 1VQ6P 1VQNP 3CCRP 1YJNP 1W2BO 1KC8Q 2QA4P 1K9MQ 3G71P 3CCVP 1VQ7P 3CD6P 1VQOP 1YIJP 3I55P 1VQ9P 3CCEP 1YI2P 1YJ9P 3CXCO 1VQKP 2QEXP 2OTJP 1JJ2O 3CMAP 1Q82Q 1QVFO 1YJWP 1N8RQ 1Q86Q 1VQPP 1M1KQ 3G6EP 1NJIQ
chains in the Genus database with same CATH superfamily
1CEIA 3DPHA 2LTEA 4XROA 3G1GA 2Z44A 2XV6A 2JYGA 5HGLA 2VLOA 2PEJA 2QNWA 2M8PA 1KLPA 2GDWA 1W2BO 2CNRA 1IUQA 2DNWA 2M8LA 2GZEA 2XXMA 1NJIQ 1A43A 3HYBA 2CG5B 3LRYA 3DS4A 2GZIA 1VQLP 5F2KA 2K0XA 1VHNA 4NEOA 3CCQP 3NY7B 3CC4P 2KGEA 2PY8A 2XT1A 1VQNP 4PXHB 1RO0A 1K9MQ 1VQOP 1VQKP 2GYKA 2VLQA 3G26A 2FACA 3EJDA 1PEUA 2AVAA 1Q81Q 3P05A 3WBHA 3CCLP 2KR5A 3EJEA 2BQ1E 5JPAA 3CCUP 4M0IA 1VQ6P 5DCKA 2JQ4A 2KG8A 5HV8A 2FQ2A 5HGNA 2N50A 1N8RQ 4PH1A 2JYLA 2EIAA 2XZ0D 2ROQA 3GZLA 1K8AQ 2JAZA 2PEOA 2OARA 2EFJA 3CCSP 3DS1A 4QNBA 2MR8A 4PH0A 3I55P 3DS3A 3H47A 2GDYA 1EOQA 2KWLA 2L6EA 4XFXA 2GZFA 3NTEA 4U0CA 1S72P 2LPKA 3CCJP 2OTLP 4H2XC 2EHSA 1BXIA 5HVCA 5HGOA 3CD6P 1HQBA 1IMPA 3CCEP 2K0YA 3DS2A 2CQ8A 1Z6MA 2N6ZA 4U0FA 5HGMA 1Q86Q 1GXHA 2PEKA 1K30A 3G29A 2KGDA 2K93A 2PEMA 2LMLA 3CXCO 3M1MA 4BPHA 2KW2A 2MY5A 2PENA 2ERHA 2GDXA 1YHQP 3OW2O 1VQ4P 2PNGA 1DV5A 2VLNA 1BAJA 3CC2P 5KP7B 1FR2A 4GR2A 1Q7YQ 2L4BA 1A8OA 2QA4P 1VQ9P 1PEMA 4GR6A 1Q82Q 2N5HA 2KOSA 3VRLC 1UNKA 3E2DA 3CPWO 2MVUA 1L0IA 4COCA 3RG2A 3Q20A 2BUOA 1HY8A 2L9FA 2QEXP 1IMQA 4U0BA 3DS0A 2N6YA 2CWOA 3G4SP 3CMEP 2JU1A 3H4EA 1VQ5P 3GJNA 2Z45A 4WYMA 1YITP 3B5IA 4H2YC 2MR7A 2LOLA 1RO2A 2JU2A 1YJ9P 2OTJP 2FQ0A 1UJZA 2MF4A 2Z46A 3G28A 2FHSC 4XFZA 2K0DX 2PEQA 1QRJA 1PEOA 1ZNVA 3RG6C 2KOPA 2PEIA 2KORA 2XZ1C 1X3OA 4IZ6A 2P9XA 2KOQA 1KD1Q 3CCMP 1PEQA 5F2OA 1AUMA 1D1DA 2FQ1A 2LF4A 1M6EX 1GPJA 2K5XA 2K2QA 2L22A 1QVFO 4BPFA 2LIWA 1YJNP 4IPYA 5F2NA 3HZQA 2VSQA 4BPGA 5BS2A 1AF8A 2JBGA 1MZ8A 3I56P 1RNIA 4H2WC 1ZMBA 2DGYA 2FVAA 2EG5A 2LIUA 1KC8Q 7CEIA 1YI2P 2FVFA 1DNYA 2FAEA 3G21A 1EMVA 3H0DA 2AFDA 2M5RA 2JGPA 5BS1A 3G1IA 2AFEA 2AF8A 2KG6A 2JB0A 2L0QA 1ACPA 3GZMA 1T8KA 4CA3A 5KP6B 2N5IA 3G0VA 2X2BA 4U0EA 4R0MA 1VQ7P 5EW5E 3DTJA 3EJBA 2BHVA 3CMAP 1M6NA 1AYIA 1F80D 4UHPB 1GXGA 1M74A 5EJDA 3CC7P 2EHTA 2MD9A 2GZGA 3MGEA 2LL8A 3U43A 1YIJP 2CGQA 2LKIA 1NQ4A 2KGAA 1M1KQ 3G6EP 2MVVA 1M90Q 1VQ8P 1K73Q 4XFYA 1E0HA 2GZJA 4QKOA 1L0HA 4COPA 4XRQA 1VQMP 2JO0A 1KQSO 2WPTA 5KP8B 3DS5A 3G71P 3GKLC 3LMOA 2FADA 1E6JP 2KGCA 4PWVB 5I4TG 2KOOA 2FVEA 2KG9A 1VKUA 1JJ2O 4HKGA 1OR5A 2K94A 2ONTA 3B4QA 2M8NA 4F37A 2NO8A 4U0AA 1QVGO 4DG9A 3CCRP 5CZDB 4MRTC 2KODA 3CCVP 3CE7A 2E1MA 4U0DA 2K92A 2N98A 1YJWP 1EIAA 1VQPP 2VLPA
chains in the Genus database with same CATH topology
2L6EA 4XFXA 3DPHA 2CWOA 3G4SP 5BS1A 4XROA 3NTEA 3CMEP 3G1GA 2Z44A 4U0CA 3G1IA 2XV6A 1S72P 2JYGA 5HGLA 3CCJP 2OTLP 2PEJA 3H4EA 1VQ5P 2Z45A 4WYMA 3G0VA 1YITP 2M8PA 3B5IA 4U0EA 1W2BO 1RO2A 5HGOA 3CD6P 1VQ7P 3DTJA 3CCEP 1YJ9P 2OTJP 1IUQA 2BHVA 3CMAP 2M8LA 3DS2A 2Z46A 4U0FA 1Q86Q 5HGMA 2XXMA 3G28A 1M6NA 1NJIQ 1A43A 2PEKA 3HYBA 3LRYA 3DS4A 1K30A 1VQLP 5F2KA 4XFZA 1M74A 3G29A 3CC7P 3CCQP 3CC4P 2PEQA 1QRJA 2PY8A 1PEOA 2XT1A 3MGEA 1VQNP 1RO0A 1K9MQ 2PEMA 1VQOP 3RG6C 1YIJP 2PEIA 1VQKP 3CXCO 3G26A 3M1MA 1PEUA 1M1KQ 3G6EP 2PENA 1M90Q 1VQ8P 2P9XA 1YHQP 1Q81Q 3P05A 3WBHA 3OW2O 1K73Q 4XFYA 1VQ4P 3CCLP 1KD1Q 3CCMP 2BQ1E 1PEQA 5JPAA 5F2OA 3CCUP 1BAJA 3CC2P 4COPA 4XRQA 4M0IA 1VQMP 1AUMA 2JO0A 4GR2A 1Q7YQ 1KQSO 1VQ6P 5DCKA 1D1DA 3DS5A 1A8OA 2LF4A 3G71P 2QA4P 1M6EX 1VQ9P 1PEMA 1E6JP 4GR6A 5HGNA 1Q82Q 1QVFO 5I4TG 1N8RQ 1YJNP 1JJ2O 4PH1A 4IPYA 3HZQA 2JYLA 5F2NA 3VRLC 2ONTA 2EIAA 3E2DA 3CPWO 2M8NA 5BS2A 1VQPP 1K8AQ 4COCA 4U0AA 2PEOA 2OARA 3I56P 1QVGO 2EFJA 1RNIA 1ZMBA 3CCSP 2DGYA 3DS1A 3CCRP 3Q20A 4QNBA 2EG5A 1KC8Q 2BUOA 3CCVP 2KODA 4PH0A 3I55P 1YI2P 3DS3A 2QEXP 2E1MA 4U0DA 3H47A 4U0BA 3DS0A 1YJWP 1EIAA 1EOQA 3G21A 3H0DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M90 Q;  1VQ8 P;  3G4S P;  1YHQ P;  1Q81 Q;  1K73 Q;  3OW2 O;  3CCL P;  1VQ4 P;  3CME P;  1VQL P;  3CPW O;  1KD1 Q;  1S72 P;  3CCM P;  3CC7 P;  3CCQ P;  1K8A Q;  3CC4 P;  3CCJ P;  3CCU P;  3CC2 P;  2OTL P;  3I56 P;  1VQM P;  1VQ5 P;  1QVG O;  1Q7Y Q;  3CCS P;  1YIT P;  1KQS O;  1VQ6 P;  1VQN P;  3CCR P;  1YJN P;  1W2B O;  1KC8 Q;  2QA4 P;  1K9M Q;  3G71 P;  3CCV P;  1VQ7 P;  3CD6 P;  1VQO P;  1YIJ P;  3I55 P;  1VQ9 P;  3CCE P;  1YI2 P;  1YJ9 P;  3CXC O;  1VQK P;  2QEX P;  2OTJ P;  1JJ2 O;  3CMA P;  1Q82 Q;  1QVF O;  1YJW P;  1N8R Q;  1Q86 Q;  1VQP P;  1M1K Q;  3G6E P;  1NJI Q; 
#chains in the Genus database with same CATH topology
 1CEI A;  3DPH A;  2LTE A;  4XRO A;  3G1G A;  2Z44 A;  2XV6 A;  2JYG A;  5HGL A;  2VLO A;  2PEJ A;  2QNW A;  2M8P A;  1KLP A;  2GDW A;  1W2B O;  2CNR A;  1IUQ A;  2DNW A;  2M8L A;  2GZE A;  2XXM A;  1NJI Q;  1A43 A;  3HYB A;  2CG5 B;  3LRY A;  3DS4 A;  2GZI A;  1VQL P;  5F2K A;  2K0X A;  1VHN A;  4NEO A;  3CCQ P;  3NY7 B;  3CC4 P;  2KGE A;  2PY8 A;  2XT1 A;  1VQN P;  4PXH B;  1RO0 A;  1K9M Q;  1VQO P;  1VQK P;  2GYK A;  2VLQ A;  3G26 A;  2FAC A;  3EJD A;  1PEU A;  2AVA A;  1Q81 Q;  3P05 A;  3WBH A;  3CCL P;  2KR5 A;  3EJE A;  2BQ1 E;  5JPA A;  3CCU P;  4M0I A;  1VQ6 P;  5DCK A;  2JQ4 A;  2KG8 A;  5HV8 A;  2FQ2 A;  5HGN A;  2N50 A;  1N8R Q;  4PH1 A;  2JYL A;  2EIA A;  2XZ0 D;  2ROQ A;  3GZL A;  1K8A Q;  2JAZ A;  2PEO A;  2OAR A;  2EFJ A;  3CCS P;  3DS1 A;  4QNB A;  2MR8 A;  4PH0 A;  3I55 P;  3DS3 A;  3H47 A;  2GDY A;  1EOQ A;  2KWL A;  2L6E A;  4XFX A;  2GZF A;  3NTE A;  4U0C A;  1S72 P;  2LPK A;  3CCJ P;  2OTL P;  4H2X C;  2EHS A;  1BXI A;  5HVC A;  5HGO A;  3CD6 P;  1HQB A;  1IMP A;  3CCE P;  2K0Y A;  3DS2 A;  2CQ8 A;  1Z6M A;  2N6Z A;  4U0F A;  5HGM A;  1Q86 Q;  1GXH A;  2PEK A;  1K30 A;  3G29 A;  2KGD A;  2K93 A;  2PEM A;  2LML A;  3CXC O;  3M1M A;  4BPH A;  2KW2 A;  2MY5 A;  2PEN A;  2ERH A;  2GDX A;  1YHQ P;  3OW2 O;  1VQ4 P;  2PNG A;  1DV5 A;  2VLN A;  1BAJ A;  3CC2 P;  5KP7 B;  1FR2 A;  4GR2 A;  1Q7Y Q;  2L4B A;  1A8O A;  2QA4 P;  1VQ9 P;  1PEM A;  4GR6 A;  1Q82 Q;  2N5H A;  2KOS A;  3VRL C;  1UNK A;  3E2D A;  3CPW O;  2MVU A;  1L0I A;  4COC A;  3RG2 A;  3Q20 A;  2BUO A;  1HY8 A;  2L9F A;  2QEX P;  1IMQ A;  4U0B A;  3DS0 A;  2N6Y A;  2CWO A;  3G4S P;  3CME P;  2JU1 A;  3H4E A;  1VQ5 P;  3GJN A;  2Z45 A;  4WYM A;  1YIT P;  3B5I A;  4H2Y C;  2MR7 A;  2LOL A;  1RO2 A;  2JU2 A;  1YJ9 P;  2OTJ P;  2FQ0 A;  1UJZ A;  2MF4 A;  2Z46 A;  3G28 A;  2FHS C;  4XFZ A;  2K0D X;  2PEQ A;  1QRJ A;  1PEO A;  1ZNV A;  3RG6 C;  2KOP A;  2PEI A;  2KOR A;  2XZ1 C;  1X3O A;  4IZ6 A;  2P9X A;  2KOQ A;  1KD1 Q;  3CCM P;  1PEQ A;  5F2O A;  1AUM A;  1D1D A;  2FQ1 A;  2LF4 A;  1M6E X;  1GPJ A;  2K5X A;  2K2Q A;  2L22 A;  1QVF O;  4BPF A;  2LIW A;  1YJN P;  4IPY A;  5F2N A;  3HZQ A;  2VSQ A;  4BPG A;  5BS2 A;  1AF8 A;  2JBG A;  1MZ8 A;  3I56 P;  1RNI A;  4H2W C;  1ZMB A;  2DGY A;  2FVA A;  2EG5 A;  2LIU A;  1KC8 Q;  7CEI A;  1YI2 P;  2FVF A;  1DNY A;  2FAE A;  3G21 A;  1EMV A;  3H0D A;  2AFD A;  2M5R A;  2JGP A;  5BS1 A;  3G1I A;  2AFE A;  2AF8 A;  2KG6 A;  2JB0 A;  2L0Q A;  1ACP A;  3GZM A;  1T8K A;  4CA3 A;  5KP6 B;  2N5I A;  3G0V A;  2X2B A;  4U0E A;  4R0M A;  1VQ7 P;  5EW5 E;  3DTJ A;  3EJB A;  2BHV A;  3CMA P;  1M6N A;  1AYI A;  1F80 D;  4UHP B;  1GXG A;  1M74 A;  5EJD A;  3CC7 P;  2EHT A;  2MD9 A;  2GZG A;  3MGE A;  2LL8 A;  3U43 A;  1YIJ P;  2CGQ A;  2LKI A;  1NQ4 A;  2KGA A;  1M1K Q;  3G6E P;  2MVV A;  1M90 Q;  1VQ8 P;  1K73 Q;  4XFY A;  1E0H A;  2GZJ A;  4QKO A;  1L0H A;  4COP A;  4XRQ A;  1VQM P;  2JO0 A;  1KQS O;  2WPT A;  5KP8 B;  3DS5 A;  3G71 P;  3GKL C;  3LMO A;  2FAD A;  1E6J P;  2KGC A;  4PWV B;  5I4T G;  2KOO A;  2FVE A;  2KG9 A;  1VKU A;  1JJ2 O;  4HKG A;  1OR5 A;  2K94 A;  2ONT A;  3B4Q A;  2M8N A;  4F37 A;  2NO8 A;  4U0A A;  1QVG O;  4DG9 A;  3CCR P;  5CZD B;  4MRT C;  2KOD A;  3CCV P;  3CE7 A;  2E1M A;  4U0D A;  2K92 A;  2N98 A;  1YJW P;  1EIA A;  1VQP P;  2VLP A; 
#chains in the Genus database with same CATH homology
 2L6E A;  4XFX A;  3DPH A;  2CWO A;  3G4S P;  5BS1 A;  4XRO A;  3NTE A;  3CME P;  3G1G A;  2Z44 A;  4U0C A;  3G1I A;  2XV6 A;  1S72 P;  2JYG A;  5HGL A;  3CCJ P;  2OTL P;  2PEJ A;  3H4E A;  1VQ5 P;  2Z45 A;  4WYM A;  3G0V A;  1YIT P;  2M8P A;  3B5I A;  4U0E A;  1W2B O;  1RO2 A;  5HGO A;  3CD6 P;  1VQ7 P;  3DTJ A;  3CCE P;  1YJ9 P;  2OTJ P;  1IUQ A;  2BHV A;  3CMA P;  2M8L A;  3DS2 A;  2Z46 A;  4U0F A;  1Q86 Q;  5HGM A;  2XXM A;  3G28 A;  1M6N A;  1NJI Q;  1A43 A;  2PEK A;  3HYB A;  3LRY A;  3DS4 A;  1K30 A;  1VQL P;  5F2K A;  4XFZ A;  1M74 A;  3G29 A;  3CC7 P;  3CCQ P;  3CC4 P;  2PEQ A;  1QRJ A;  2PY8 A;  1PEO A;  2XT1 A;  3MGE A;  1VQN P;  1RO0 A;  1K9M Q;  2PEM A;  1VQO P;  3RG6 C;  1YIJ P;  2PEI A;  1VQK P;  3CXC O;  3G26 A;  3M1M A;  1PEU A;  1M1K Q;  3G6E P;  2PEN A;  1M90 Q;  1VQ8 P;  2P9X A;  1YHQ P;  1Q81 Q;  3P05 A;  3WBH A;  3OW2 O;  1K73 Q;  4XFY A;  1VQ4 P;  3CCL P;  1KD1 Q;  3CCM P;  2BQ1 E;  1PEQ A;  5JPA A;  5F2O A;  3CCU P;  1BAJ A;  3CC2 P;  4COP A;  4XRQ A;  4M0I A;  1VQM P;  1AUM A;  2JO0 A;  4GR2 A;  1Q7Y Q;  1KQS O;  1VQ6 P;  5DCK A;  1D1D A;  3DS5 A;  1A8O A;  2LF4 A;  3G71 P;  2QA4 P;  1M6E X;  1VQ9 P;  1PEM A;  1E6J P;  4GR6 A;  5HGN A;  1Q82 Q;  1QVF O;  5I4T G;  1N8R Q;  1YJN P;  1JJ2 O;  4PH1 A;  4IPY A;  3HZQ A;  2JYL A;  5F2N A;  3VRL C;  2ONT A;  2EIA A;  3E2D A;  3CPW O;  2M8N A;  5BS2 A;  1VQP P;  1K8A Q;  4COC A;  4U0A A;  2PEO A;  2OAR A;  3I56 P;  1QVG O;  2EFJ A;  1RNI A;  1ZMB A;  3CCS P;  2DGY A;  3DS1 A;  3CCR P;  3Q20 A;  4QNB A;  2EG5 A;  1KC8 Q;  2BUO A;  3CCV P;  2KOD A;  4PH0 A;  3I55 P;  1YI2 P;  3DS3 A;  2QEX P;  2E1M A;  4U0D A;  3H47 A;  4U0B A;  3DS0 A;  1YJW P;  1EIA A;  1EOQ A;  3G21 A;  3H0D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...