1JJ2O

Fully refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAKGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title The kink-turn: a new RNA secondary structure motif.
pubmed doi rcsb
molecule tags Ribosome
total genus 47
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2001-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1jj2O02
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1jj2O01
1KC8Q 1YJNP 1S72P 1M1KQ 2OTLP 1YJWP 3CCUP 3CXCO 1YJ9P 1VQNP 1M90Q 1VQ6P 1NJIQ 1VQ4P 1KQSO 1K73Q 1YIJP 1VQ5P 1QVGO 3G6EP 1W2BO 1VQOP 3CCRP 1VQKP 1Q82Q 1KD1Q 3CPWO 3CCEP 3I55P 1Q81Q 2QEXP 1N8RQ 1VQ8P 3CCJP 1VQ7P 1VQLP 3CMEP 1YHQP 1YITP 1VQ9P 3CC7P 2QA4P 1VQMP 3CCMP 3CCSP 3I56P 3CD6P 1VQPP 3CCLP 1YI2P 3OW2O 3CC2P 1Q86Q 3CMAP 3CC4P 1JJ2O 1K8AQ 2OTJP 3CCQP 1Q7YQ 3G71P 1K9MQ 1QVFO 3CCVP 3G4SP
chains in the Genus database with same CATH superfamily
2XV6A 1YJWP 3CCUP 3DS0A 2CGQA 1E0HA 2FVEA 2MF4A 1Q82Q 2GZIA 2QEXP 2MR7A 2L9FA 1HY8A 2JYLA 2XZ1C 1ACPA 1YI2P 2CG5B 2FAEA 2ROQA 1DNYA 4NEOA 1VQNP 2K0XA 4PH0A 3DPHA 2KOQA 2CQ8A 2PNGA 3VRLC 2N50A 1N8RQ 1VHNA 2Z44A 2BQ1E 2OTJP 3P05A 1YJNP 2JYGA 2OTLP 2X2BA 1M90Q 2GZJA 1L0HA 1EMVA 2FQ1A 4IPYA 5KP8B 2XZ0D 4U0FA 2VLPA 3CC7P 2K0DX 5F2NA 2OARA 3CD6P 2K93A 5HGMA 2PEJA 1JJ2O 4COPA 3M1MA 2JQ4A 4BPFA 4PXHB 3G0VA 2CWOA 2KW2A 1W2BO 2KODA 3G29A 2L4BA 2AFDA 1OR5A 2QNWA 1VQLP 1YITP 4U0AA 5JPAA 4IZ6A 2AFEA 2N5HA 2PEQA 2GDWA 3MGEA 2LOLA 4HKGA 4XFYA 5HGNA 2GZEA 2FVAA 2KWLA 4WYMA 1F80D 2GDXA 3H0DA 1PEUA 3I55P 1PEMA 4UHPB 1KLPA 1VQMP 3I56P 2KOSA 3CC4P 4CA3A 4GR6A 1X3OA 2KOPA 2M8PA 2EFJA 1M6EX 2M5RA 4XFZA 2MD9A 2JB0A 2L6EA 2GZGA 3DS3A 2LIUA 1VQKP 2LMLA 3LRYA 5BS2A 1IMQA 3G1GA 2QA4P 2LKIA 4U0CA 3GJNA 1ZNVA 2VLNA 2GDYA 5HGLA 1S72P 2FACA 1PEQA 4QNBA 3HZQA 2FVFA 1A8OA 1KD1Q 3CPWO 2KG9A 3EJDA 5BS1A 4DG9A 1PEOA 2JBGA 3G21A 3G28A 2KGEA 3NTEA 1AYIA 4QKOA 2LIWA 2N98A 1Z6MA 2K92A 1EIAA 1QVGO 2K2QA 4H2WC 2KGCA 1VQ9P 1K30A 1VQPP 3CC2P 1M74A 3DTJA 1M1KQ 1YJ9P 1VQ6P 1UNKA 1GXHA 5EW5E 4COCA 3G26A 5HVCA 1A43A 4H2XC 1VQ8P 4XROA 2KG6A 2JGPA 2KORA 2PEOA 2KR5A 2L22A 2P9XA 3CCLP 2N6ZA 7CEIA 2BUOA 2VLOA 5F2OA 2LPKA 3G4SP 2MR8A 2XT1A 3E2DA 2BHVA 1MZ8A 3DS4A 3RG2A 2EHTA 2N6YA 2KGDA 3G71P 2E1MA 2JO0A 2PEIA 2JAZA 3WBHA 4XRQA 4PH1A 2LF4A 3B5IA 3CCRP 2K0YA 2MVVA 1IUQA 2PY8A 2Z45A 1NQ4A 3CMAP 4M0IA 3CCQP 4U0BA 1D1DA 1QVFO 2KOOA 5EJDA 2JU2A 2KGAA 1CEIA 1QRJA 3CE7A 1RO0A 5CZDB 1ZMBA 3HYBA 1KQSO 2NO8A 3G6EP 1GXGA 1UJZA 4GR2A 2CNRA 1Q81Q 3G1IA 3H4EA 2JU1A 3U43A 2GYKA 3DS1A 1VKUA 1K8AQ 1HQBA 1AUMA 3CCVP 2LL8A 1E6JP 3EJEA 2MVUA 4R0MA 1DV5A 2N5IA 5DCKA 1K73Q 5HGOA 2K94A 1VQOP 5KP7B 2MY5A 3Q20A 3CCJP 1YHQP 1RO2A 4MRTC 4PWVB 3B4QA 2GZFA 2M8LA 1Q7YQ 2FHSC 2DNWA 3NY7B 5I4TG 3H47A 1VQ4P 1T8KA 2VLQA 2LTEA 2PEMA 1IMPA 2Z46A 2EHSA 2ERHA 2FQ0A 4XFXA 3CCMP 3CCSP 2PEKA 1Q86Q 1L0IA 3EJBA 1BXIA 1GPJA 1KC8Q 3CXCO 2VSQA 3LMOA 1AF8A 1NJIQ 1YIJP 4U0DA 5KP6B 2EG5A 2FQ2A 1FR2A 2XXMA 3CCEP 4U0EA 4BPHA 3DS2A 3CMEP 2M8NA 2DGYA 4H2YC 3GKLC 5F2KA 2PENA 1K9MQ 2FADA 1M6NA 4BPGA 5HV8A 1RNIA 3RG6C 1BAJA 4F37A 3GZLA 2AF8A 1VQ5P 2ONTA 3DS5A 2K5XA 3GZMA 1VQ7P 2WPTA 2EIAA 2AVAA 3OW2O 2L0QA 1EOQA 2KG8A
chains in the Genus database with same CATH topology
1M74A 2XV6A 4XFYA 3DTJA 1M1KQ 1YJWP 3CCUP 1YJ9P 3DS0A 5HGNA 1VQ6P 5DCKA 4COCA 1K73Q 4WYMA 3G26A 3H0DA 5HGOA 1PEUA 1VQOP 1A43A 1Q82Q 3I55P 1VQ8P 2QEXP 1PEMA 4XROA 3Q20A 3CCJP 1YHQP 2PEOA 2JYLA 1RO2A 1VQMP 3I56P 2P9XA 3CCLP 1YI2P 3CC4P 2BUOA 4GR6A 2M8LA 1Q7YQ 5F2OA 3G4SP 2M8PA 2XT1A 2EFJA 1M6EX 1VQNP 4XFZA 5I4TG 3H47A 3E2DA 1VQ4P 4PH0A 2L6EA 3DPHA 3DS3A 2BHVA 2PEMA 3VRLC 1VQKP 1N8RQ 2Z46A 3LRYA 5BS2A 3DS4A 3G1GA 4XFXA 2QA4P 2Z44A 3CCMP 3CCSP 2PEKA 4U0CA 2BQ1E 1Q86Q 2OTJP 3P05A 3G71P 5HGLA 2E1MA 2JO0A 2PEIA 1KC8Q 1YJNP 2JYGA 1S72P 2OTLP 3WBHA 3CXCO 1PEQA 4XRQA 1M90Q 4PH1A 1NJIQ 2LF4A 1YIJP 4U0DA 4QNBA 3HZQA 2EG5A 3B5IA 4IPYA 1A8OA 3CCRP 1KD1Q 2XXMA 3CPWO 3CCEP 4U0EA 1IUQA 5BS1A 3DS2A 1PEOA 2PY8A 4U0FA 3CMEP 2M8NA 3CC7P 3G21A 5F2NA 2DGYA 2OARA 3CD6P 2Z45A 5HGMA 3CMAP 4M0IA 2PEJA 5F2KA 1JJ2O 3G28A 3CCQP 4U0BA 4COPA 1D1DA 2PENA 1K9MQ 1QVFO 3M1MA 1M6NA 3NTEA 1QRJA 1RNIA 3RG6C 1BAJA 1RO0A 3G0VA 1EIAA 1ZMBA 2CWOA 3HYBA 1KQSO 1VQ5P 1QVGO 2ONTA 3DS5A 3G6EP 1W2BO 2KODA 3G29A 4GR2A 1Q81Q 3G1IA 3H4EA 1VQ7P 1VQLP 1YITP 4U0AA 1VQ9P 2EIAA 5JPAA 1K30A 1VQPP 3DS1A 3OW2O 3CC2P 2PEQA 1K8AQ 1EOQA 3MGEA 1AUMA 3CCVP 1E6JP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KC8 Q;  1YJN P;  1S72 P;  1M1K Q;  2OTL P;  1YJW P;  3CCU P;  3CXC O;  1YJ9 P;  1VQN P;  1M90 Q;  1VQ6 P;  1NJI Q;  1VQ4 P;  1KQS O;  1K73 Q;  1YIJ P;  1VQ5 P;  1QVG O;  3G6E P;  1W2B O;  1VQO P;  3CCR P;  1VQK P;  1Q82 Q;  1KD1 Q;  3CPW O;  3CCE P;  3I55 P;  1Q81 Q;  2QEX P;  1N8R Q;  1VQ8 P;  3CCJ P;  1VQ7 P;  1VQL P;  3CME P;  1YHQ P;  1YIT P;  1VQ9 P;  3CC7 P;  2QA4 P;  1VQM P;  3CCM P;  3CCS P;  3I56 P;  3CD6 P;  1VQP P;  3CCL P;  1YI2 P;  3OW2 O;  3CC2 P;  1Q86 Q;  3CMA P;  3CC4 P;  1JJ2 O;  1K8A Q;  2OTJ P;  3CCQ P;  1Q7Y Q;  3G71 P;  1K9M Q;  1QVF O;  3CCV P;  3G4S P; 
#chains in the Genus database with same CATH topology
 2XV6 A;  1YJW P;  3CCU P;  3DS0 A;  2CGQ A;  1E0H A;  2FVE A;  2MF4 A;  1Q82 Q;  2GZI A;  2QEX P;  2MR7 A;  2L9F A;  1HY8 A;  2JYL A;  2XZ1 C;  1ACP A;  1YI2 P;  2CG5 B;  2FAE A;  2ROQ A;  1DNY A;  4NEO A;  1VQN P;  2K0X A;  4PH0 A;  3DPH A;  2KOQ A;  2CQ8 A;  2PNG A;  3VRL C;  2N50 A;  1N8R Q;  1VHN A;  2Z44 A;  2BQ1 E;  2OTJ P;  3P05 A;  1YJN P;  2JYG A;  2OTL P;  2X2B A;  1M90 Q;  2GZJ A;  1L0H A;  1EMV A;  2FQ1 A;  4IPY A;  5KP8 B;  2XZ0 D;  4U0F A;  2VLP A;  3CC7 P;  2K0D X;  5F2N A;  2OAR A;  3CD6 P;  2K93 A;  5HGM A;  2PEJ A;  1JJ2 O;  4COP A;  3M1M A;  2JQ4 A;  4BPF A;  4PXH B;  3G0V A;  2CWO A;  2KW2 A;  1W2B O;  2KOD A;  3G29 A;  2L4B A;  2AFD A;  1OR5 A;  2QNW A;  1VQL P;  1YIT P;  4U0A A;  5JPA A;  4IZ6 A;  2AFE A;  2N5H A;  2PEQ A;  2GDW A;  3MGE A;  2LOL A;  4HKG A;  4XFY A;  5HGN A;  2GZE A;  2FVA A;  2KWL A;  4WYM A;  1F80 D;  2GDX A;  3H0D A;  1PEU A;  3I55 P;  1PEM A;  4UHP B;  1KLP A;  1VQM P;  3I56 P;  2KOS A;  3CC4 P;  4CA3 A;  4GR6 A;  1X3O A;  2KOP A;  2M8P A;  2EFJ A;  1M6E X;  2M5R A;  4XFZ A;  2MD9 A;  2JB0 A;  2L6E A;  2GZG A;  3DS3 A;  2LIU A;  1VQK P;  2LML A;  3LRY A;  5BS2 A;  1IMQ A;  3G1G A;  2QA4 P;  2LKI A;  4U0C A;  3GJN A;  1ZNV A;  2VLN A;  2GDY A;  5HGL A;  1S72 P;  2FAC A;  1PEQ A;  4QNB A;  3HZQ A;  2FVF A;  1A8O A;  1KD1 Q;  3CPW O;  2KG9 A;  3EJD A;  5BS1 A;  4DG9 A;  1PEO A;  2JBG A;  3G21 A;  3G28 A;  2KGE A;  3NTE A;  1AYI A;  4QKO A;  2LIW A;  2N98 A;  1Z6M A;  2K92 A;  1EIA A;  1QVG O;  2K2Q A;  4H2W C;  2KGC A;  1VQ9 P;  1K30 A;  1VQP P;  3CC2 P;  1M74 A;  3DTJ A;  1M1K Q;  1YJ9 P;  1VQ6 P;  1UNK A;  1GXH A;  5EW5 E;  4COC A;  3G26 A;  5HVC A;  1A43 A;  4H2X C;  1VQ8 P;  4XRO A;  2KG6 A;  2JGP A;  2KOR A;  2PEO A;  2KR5 A;  2L22 A;  2P9X A;  3CCL P;  2N6Z A;  7CEI A;  2BUO A;  2VLO A;  5F2O A;  2LPK A;  3G4S P;  2MR8 A;  2XT1 A;  3E2D A;  2BHV A;  1MZ8 A;  3DS4 A;  3RG2 A;  2EHT A;  2N6Y A;  2KGD A;  3G71 P;  2E1M A;  2JO0 A;  2PEI A;  2JAZ A;  3WBH A;  4XRQ A;  4PH1 A;  2LF4 A;  3B5I A;  3CCR P;  2K0Y A;  2MVV A;  1IUQ A;  2PY8 A;  2Z45 A;  1NQ4 A;  3CMA P;  4M0I A;  3CCQ P;  4U0B A;  1D1D A;  1QVF O;  2KOO A;  5EJD A;  2JU2 A;  2KGA A;  1CEI A;  1QRJ A;  3CE7 A;  1RO0 A;  5CZD B;  1ZMB A;  3HYB A;  1KQS O;  2NO8 A;  3G6E P;  1GXG A;  1UJZ A;  4GR2 A;  2CNR A;  1Q81 Q;  3G1I A;  3H4E A;  2JU1 A;  3U43 A;  2GYK A;  3DS1 A;  1VKU A;  1K8A Q;  1HQB A;  1AUM A;  3CCV P;  2LL8 A;  1E6J P;  3EJE A;  2MVU A;  4R0M A;  1DV5 A;  2N5I A;  5DCK A;  1K73 Q;  5HGO A;  2K94 A;  1VQO P;  5KP7 B;  2MY5 A;  3Q20 A;  3CCJ P;  1YHQ P;  1RO2 A;  4MRT C;  4PWV B;  3B4Q A;  2GZF A;  2M8L A;  1Q7Y Q;  2FHS C;  2DNW A;  3NY7 B;  5I4T G;  3H47 A;  1VQ4 P;  1T8K A;  2VLQ A;  2LTE A;  2PEM A;  1IMP A;  2Z46 A;  2EHS A;  2ERH A;  2FQ0 A;  4XFX A;  3CCM P;  3CCS P;  2PEK A;  1Q86 Q;  1L0I A;  3EJB A;  1BXI A;  1GPJ A;  1KC8 Q;  3CXC O;  2VSQ A;  3LMO A;  1AF8 A;  1NJI Q;  1YIJ P;  4U0D A;  5KP6 B;  2EG5 A;  2FQ2 A;  1FR2 A;  2XXM A;  3CCE P;  4U0E A;  4BPH A;  3DS2 A;  3CME P;  2M8N A;  2DGY A;  4H2Y C;  3GKL C;  5F2K A;  2PEN A;  1K9M Q;  2FAD A;  1M6N A;  4BPG A;  5HV8 A;  1RNI A;  3RG6 C;  1BAJ A;  4F37 A;  3GZL A;  2AF8 A;  1VQ5 P;  2ONT A;  3DS5 A;  2K5X A;  3GZM A;  1VQ7 P;  2WPT A;  2EIA A;  2AVA A;  3OW2 O;  2L0Q A;  1EOQ A;  2KG8 A; 
#chains in the Genus database with same CATH homology
 1M74 A;  2XV6 A;  4XFY A;  3DTJ A;  1M1K Q;  1YJW P;  3CCU P;  1YJ9 P;  3DS0 A;  5HGN A;  1VQ6 P;  5DCK A;  4COC A;  1K73 Q;  4WYM A;  3G26 A;  3H0D A;  5HGO A;  1PEU A;  1VQO P;  1A43 A;  1Q82 Q;  3I55 P;  1VQ8 P;  2QEX P;  1PEM A;  4XRO A;  3Q20 A;  3CCJ P;  1YHQ P;  2PEO A;  2JYL A;  1RO2 A;  1VQM P;  3I56 P;  2P9X A;  3CCL P;  1YI2 P;  3CC4 P;  2BUO A;  4GR6 A;  2M8L A;  1Q7Y Q;  5F2O A;  3G4S P;  2M8P A;  2XT1 A;  2EFJ A;  1M6E X;  1VQN P;  4XFZ A;  5I4T G;  3H47 A;  3E2D A;  1VQ4 P;  4PH0 A;  2L6E A;  3DPH A;  3DS3 A;  2BHV A;  2PEM A;  3VRL C;  1VQK P;  1N8R Q;  2Z46 A;  3LRY A;  5BS2 A;  3DS4 A;  3G1G A;  4XFX A;  2QA4 P;  2Z44 A;  3CCM P;  3CCS P;  2PEK A;  4U0C A;  2BQ1 E;  1Q86 Q;  2OTJ P;  3P05 A;  3G71 P;  5HGL A;  2E1M A;  2JO0 A;  2PEI A;  1KC8 Q;  1YJN P;  2JYG A;  1S72 P;  2OTL P;  3WBH A;  3CXC O;  1PEQ A;  4XRQ A;  1M90 Q;  4PH1 A;  1NJI Q;  2LF4 A;  1YIJ P;  4U0D A;  4QNB A;  3HZQ A;  2EG5 A;  3B5I A;  4IPY A;  1A8O A;  3CCR P;  1KD1 Q;  2XXM A;  3CPW O;  3CCE P;  4U0E A;  1IUQ A;  5BS1 A;  3DS2 A;  1PEO A;  2PY8 A;  4U0F A;  3CME P;  2M8N A;  3CC7 P;  3G21 A;  5F2N A;  2DGY A;  2OAR A;  3CD6 P;  2Z45 A;  5HGM A;  3CMA P;  4M0I A;  2PEJ A;  5F2K A;  1JJ2 O;  3G28 A;  3CCQ P;  4U0B A;  4COP A;  1D1D A;  2PEN A;  1K9M Q;  1QVF O;  3M1M A;  1M6N A;  3NTE A;  1QRJ A;  1RNI A;  3RG6 C;  1BAJ A;  1RO0 A;  3G0V A;  1EIA A;  1ZMB A;  2CWO A;  3HYB A;  1KQS O;  1VQ5 P;  1QVG O;  2ONT A;  3DS5 A;  3G6E P;  1W2B O;  2KOD A;  3G29 A;  4GR2 A;  1Q81 Q;  3G1I A;  3H4E A;  1VQ7 P;  1VQL P;  1YIT P;  4U0A A;  1VQ9 P;  2EIA A;  5JPA A;  1K30 A;  1VQP P;  3DS1 A;  3OW2 O;  3CC2 P;  2PEQ A;  1K8A Q;  1EOQ A;  3MGE A;  1AUM A;  3CCV P;  1E6J P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...