1JJ2O

Fully refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
143
structure length
143
Chain Sequence
b'TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAKGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title The kink-turn: a new RNA secondary structure motif.
pubmed doi rcsb
molecule tags Ribosome
total genus 47
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2001-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1jj2O02
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1jj2O01
3CC7P 1KC8Q 1YIJP 1VQMP 3CCUP 1M1KQ 1KQSO 1YITP 3G71P 3CC4P 1VQ6P 3I55P 1Q82Q 2OTLP 1YJWP 1S72P 1VQOP 1N8RQ 1VQKP 1YHQP 1Q86Q 1VQPP 1KD1Q 3CC2P 3CD6P 1M90Q 1K8AQ 3OW2O 1VQ4P 1VQ9P 2OTJP 1Q7YQ 3G6EP 1YI2P 3CCLP 3CCJP 1VQLP 1VQ8P 3CCMP 3CXCO 3CCRP 3CMEP 1VQ5P 1QVGO 3CCSP 1NJIQ 1Q81Q 1YJ9P 1K73Q 1VQ7P 3CMAP 3I56P 3CCVP 1QVFO 3G4SP 1W2BO 3CCQP 2QA4P 3CCEP 2QEXP 3CPWO 1VQNP 1K9MQ 1YJNP 1JJ2O
chains in the Genus database with same CATH superfamily
3RG2A 1YIJP 2JO0A 3G1IA 3LRYA 1E0HA 3CD6P 2L22A 3B5IA 1Q81Q 2JBGA 3CMAP 2FADA 2LL8A 2VLNA 1W2BO 2OARA 1ZMBA 4U0BA 1NQ4A 4XFZA 2EFJA 2FVAA 4U0DA 5HVCA 2K0DX 5DCKA 3MGEA 2EG5A 1Q86Q 1KD1Q 3CC2P 5HGNA 2OTJP 2VLQA 2K2QA 1EOQA 1F80D 2MF4A 2MVUA 2E1MA 5KP6B 3M1MA 3CPWO 1KC8Q 1VQMP 1DV5A 3I55P 2JYGA 2Z46A 1BAJA 1EIAA 5HGOA 2K0YA 2XZ1C 2KOSA 4GR2A 2FVFA 2LF4A 2AFDA 3GJNA 2KWLA 3CCVP 5CZDB 2N50A 3DS1A 5F2NA 2KGAA 2GZJA 1M1KQ 5EJDA 1FR2A 1N8RQ 2KODA 5JPAA 1YHQP 1VQPP 3HYBA 2JYLA 3G26A 2KR5A 1A43A 4XFXA 4U0FA 2PY8A 5F2KA 2AFEA 3DS4A 2KOOA 2KOQA 2ONTA 4U0AA 4U0EA 1CEIA 1Q7YQ 3G6EP 3EJBA 3EJDA 1AYIA 2EHTA 4MRTC 3CCMP 3CXCO 1PEUA 3E2DA 3CCSP 2JGPA 5HV8A 3I56P 4DG9A 2AVAA 1VQNP 5HGLA 1MZ8A 3DS2A 1M74A 2M8NA 3NTEA 1M90Q 1M6EX 2PEOA 1PEQA 1A8OA 2LIWA 2GDXA 4PH0A 1UJZA 3CCQP 3H47A 5KP7B 2DGYA 3CCUP 4COCA 2FQ0A 1ACPA 1BXIA 2L4BA 4GR6A 1RO2A 1DNYA 5I4TG 4QNBA 2GZEA 2AF8A 4H2XC 1PEMA 2MD9A 3P05A 4HKGA 2CNRA 1JJ2O 3EJEA 4UHPB 2EHSA 2OTLP 1QRJA 4R0MA 4COPA 1VQOP 4PWVB 1VQ9P 2VLPA 2CG5B 3CCLP 3GKLC 3CCJP 1VQLP 2MR8A 1K30A 2ROQA 1D1DA 3CCEP 3DPHA 2GZGA 4M0IA 2JU1A 2M8PA 1VQKP 2L0QA 3NY7B 1K9MQ 1VQ4P 2M5RA 2KOPA 4PXHB 3CMEP 1K73Q 1OR5A 2KG9A 4BPGA 2CQ8A 1GXGA 1AUMA 2GDWA 3WBHA 3CC7P 2Z45A 3CC4P 3G71P 3G0VA 2DNWA 1S72P 1IMQA 3G29A 3H4EA 1RNIA 2BQ1E 2XT1A 1QVGO 2CWOA 7CEIA 1HY8A 2LTEA 2L6EA 2K93A 1T8KA 1YJNP 2KW2A 3CE7A 2KG6A 2MY5A 2XZ0D 1KLPA 4U0CA 1ZNVA 2GZFA 2GZIA 2LIUA 3GZLA 1PEOA 4IZ6A 2PEJA 1GPJA 2K94A 2PEMA 1VQ5P 1UNKA 4CA3A 2FACA 2QNWA 1E6JP 2JB0A 1L0HA 2ERHA 2PENA 1Q82Q 1YJWP 2FAEA 5BS2A 5HGMA 3B4QA 4F37A 4IPYA 1L0IA 1VQ8P 2FQ2A 3DTJA 5KP8B 2JAZA 2NO8A 3G4SP 4PH1A 2FQ1A 2N98A 3VRLC 2N5HA 2X2BA 3HZQA 1AF8A 1VKUA 2Z44A 2PEKA 2KGCA 3RG6C 2N6YA 1IUQA 4BPHA 5BS1A 2LMLA 2PNGA 2LKIA 4H2WC 1M6NA 2LOLA 2JQ4A 2M8LA 1VQ6P 2FVEA 3DS5A 2BUOA 1X3OA 2BHVA 4XROA 2K92A 2K0XA 2WPTA 2MR7A 2PEQA 1IMPA 1HQBA 2KGEA 2L9FA 1NJIQ 2KORA 4XRQA 2N5IA 2MVVA 2FHSC 2QA4P 2K5XA 1VHNA 3G28A 3DS0A 4NEOA 1KQSO 2GYKA 3LMOA 2XV6A 1EMVA 5EW5E 3DS3A 3Q20A 2CGQA 1RO0A 3OW2O 1YI2P 3H0DA 1GXHA 2KG8A 2P9XA 3CCRP 3G21A 1YJ9P 1VQ7P 1QVFO 2KGDA 4QKOA 1Z6MA 2PEIA 2N6ZA 1YITP 3GZMA 2EIAA 2GDYA 3G1GA 3U43A 4WYMA 1K8AQ 2LPKA 4BPFA 2VLOA 2JU2A 2VSQA 2QEXP 4XFYA 2XXMA 5F2OA 4H2YC
chains in the Genus database with same CATH topology
1YIJP 2JO0A 4M0IA 3VRLC 3G1IA 3LRYA 3HZQA 2ONTA 2M8PA 1VQKP 2Z44A 4U0AA 2PEKA 1K9MQ 3CD6P 4U0EA 1VQ4P 3RG6C 1Q7YQ 3G6EP 1IUQA 3CCMP 3CXCO 3CMEP 3B5IA 1PEUA 3E2DA 3CCSP 1Q81Q 1K73Q 5BS1A 3I56P 3CMAP 1W2BO 1AUMA 1VQNP 2OARA 1M6NA 5HGLA 3WBHA 1ZMBA 3CC7P 2Z45A 2M8LA 4U0BA 3DS2A 4XFZA 2EFJA 1M74A 4U0DA 3G71P 3CC4P 1VQ6P 3G0VA 3DS5A 5DCKA 1S72P 2M8NA 3MGEA 2EG5A 2BUOA 1Q86Q 2BHVA 3G29A 3H4EA 3NTEA 1M90Q 1KD1Q 1M6EX 2PEOA 4XROA 3CC2P 1RNIA 1PEQA 5HGNA 2OTJP 1A8OA 2PEQA 2BQ1E 2XT1A 1EOQA 1QVGO 1NJIQ 2CWOA 2E1MA 4XRQA 4PH0A 2L6EA 3M1MA 3CCQP 2QA4P 3CPWO 3H47A 3G28A 1YJNP 2DGYA 1KC8Q 3DS0A 1VQMP 3CCUP 1KQSO 3I55P 4U0CA 4COCA 2XV6A 2JYGA 2Z46A 2XXMA 3DS3A 4GR6A 1PEOA 3Q20A 1BAJA 1EIAA 5HGOA 1RO0A 1RO2A 2PEJA 3OW2O 1YI2P 3H0DA 4GR2A 2LF4A 2P9XA 5I4TG 3CCRP 2PEMA 1VQ5P 3G21A 4QNBA 1YJ9P 1VQ7P 1QVFO 3CCVP 1E6JP 2PEIA 1PEMA 3P05A 3DS1A 5F2NA 1JJ2O 1M1KQ 1YITP 2PENA 2EIAA 1Q82Q 2OTLP 1YJWP 3G1GA 1QRJA 4COPA 1VQOP 1N8RQ 2KODA 4WYMA 5HGMA 5BS2A 5JPAA 1VQPP 1YHQP 3HYBA 2JYLA 1K8AQ 3G26A 1VQ9P 4IPYA 3CCLP 3CCJP 1VQLP 1VQ8P 1A43A 3DTJA 1K30A 4XFXA 4U0FA 3G4SP 1D1DA 2PY8A 3CCEP 4PH1A 2QEXP 4XFYA 5F2KA 3DS4A 3DPHA 5F2OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CC7 P;  1KC8 Q;  1YIJ P;  1VQM P;  3CCU P;  1M1K Q;  1KQS O;  1YIT P;  3G71 P;  3CC4 P;  1VQ6 P;  3I55 P;  1Q82 Q;  2OTL P;  1YJW P;  1S72 P;  1VQO P;  1N8R Q;  1VQK P;  1YHQ P;  1Q86 Q;  1VQP P;  1KD1 Q;  3CC2 P;  3CD6 P;  1M90 Q;  1K8A Q;  3OW2 O;  1VQ4 P;  1VQ9 P;  2OTJ P;  1Q7Y Q;  3G6E P;  1YI2 P;  3CCL P;  3CCJ P;  1VQL P;  1VQ8 P;  3CCM P;  3CXC O;  3CCR P;  3CME P;  1VQ5 P;  1QVG O;  3CCS P;  1NJI Q;  1Q81 Q;  1YJ9 P;  1K73 Q;  1VQ7 P;  3CMA P;  3I56 P;  3CCV P;  1QVF O;  3G4S P;  1W2B O;  3CCQ P;  2QA4 P;  3CCE P;  2QEX P;  3CPW O;  1VQN P;  1K9M Q;  1YJN P;  1JJ2 O; 
#chains in the Genus database with same CATH topology
 3RG2 A;  1YIJ P;  2JO0 A;  3G1I A;  3LRY A;  1E0H A;  3CD6 P;  2L22 A;  3B5I A;  1Q81 Q;  2JBG A;  3CMA P;  2FAD A;  2LL8 A;  2VLN A;  1W2B O;  2OAR A;  1ZMB A;  4U0B A;  1NQ4 A;  4XFZ A;  2EFJ A;  2FVA A;  4U0D A;  5HVC A;  2K0D X;  5DCK A;  3MGE A;  2EG5 A;  1Q86 Q;  1KD1 Q;  3CC2 P;  5HGN A;  2OTJ P;  2VLQ A;  2K2Q A;  1EOQ A;  1F80 D;  2MF4 A;  2MVU A;  2E1M A;  5KP6 B;  3M1M A;  3CPW O;  1KC8 Q;  1VQM P;  1DV5 A;  3I55 P;  2JYG A;  2Z46 A;  1BAJ A;  1EIA A;  5HGO A;  2K0Y A;  2XZ1 C;  2KOS A;  4GR2 A;  2FVF A;  2LF4 A;  2AFD A;  3GJN A;  2KWL A;  3CCV P;  5CZD B;  2N50 A;  3DS1 A;  5F2N A;  2KGA A;  2GZJ A;  1M1K Q;  5EJD A;  1FR2 A;  1N8R Q;  2KOD A;  5JPA A;  1YHQ P;  1VQP P;  3HYB A;  2JYL A;  3G26 A;  2KR5 A;  1A43 A;  4XFX A;  4U0F A;  2PY8 A;  5F2K A;  2AFE A;  3DS4 A;  2KOO A;  2KOQ A;  2ONT A;  4U0A A;  4U0E A;  1CEI A;  1Q7Y Q;  3G6E P;  3EJB A;  3EJD A;  1AYI A;  2EHT A;  4MRT C;  3CCM P;  3CXC O;  1PEU A;  3E2D A;  3CCS P;  2JGP A;  5HV8 A;  3I56 P;  4DG9 A;  2AVA A;  1VQN P;  5HGL A;  1MZ8 A;  3DS2 A;  1M74 A;  2M8N A;  3NTE A;  1M90 Q;  1M6E X;  2PEO A;  1PEQ A;  1A8O A;  2LIW A;  2GDX A;  4PH0 A;  1UJZ A;  3CCQ P;  3H47 A;  5KP7 B;  2DGY A;  3CCU P;  4COC A;  2FQ0 A;  1ACP A;  1BXI A;  2L4B A;  4GR6 A;  1RO2 A;  1DNY A;  5I4T G;  4QNB A;  2GZE A;  2AF8 A;  4H2X C;  1PEM A;  2MD9 A;  3P05 A;  4HKG A;  2CNR A;  1JJ2 O;  3EJE A;  4UHP B;  2EHS A;  2OTL P;  1QRJ A;  4R0M A;  4COP A;  1VQO P;  4PWV B;  1VQ9 P;  2VLP A;  2CG5 B;  3CCL P;  3GKL C;  3CCJ P;  1VQL P;  2MR8 A;  1K30 A;  2ROQ A;  1D1D A;  3CCE P;  3DPH A;  2GZG A;  4M0I A;  2JU1 A;  2M8P A;  1VQK P;  2L0Q A;  3NY7 B;  1K9M Q;  1VQ4 P;  2M5R A;  2KOP A;  4PXH B;  3CME P;  1K73 Q;  1OR5 A;  2KG9 A;  4BPG A;  2CQ8 A;  1GXG A;  1AUM A;  2GDW A;  3WBH A;  3CC7 P;  2Z45 A;  3CC4 P;  3G71 P;  3G0V A;  2DNW A;  1S72 P;  1IMQ A;  3G29 A;  3H4E A;  1RNI A;  2BQ1 E;  2XT1 A;  1QVG O;  2CWO A;  7CEI A;  1HY8 A;  2LTE A;  2L6E A;  2K93 A;  1T8K A;  1YJN P;  2KW2 A;  3CE7 A;  2KG6 A;  2MY5 A;  2XZ0 D;  1KLP A;  4U0C A;  1ZNV A;  2GZF A;  2GZI A;  2LIU A;  3GZL A;  1PEO A;  4IZ6 A;  2PEJ A;  1GPJ A;  2K94 A;  2PEM A;  1VQ5 P;  1UNK A;  4CA3 A;  2FAC A;  2QNW A;  1E6J P;  2JB0 A;  1L0H A;  2ERH A;  2PEN A;  1Q82 Q;  1YJW P;  2FAE A;  5BS2 A;  5HGM A;  3B4Q A;  4F37 A;  4IPY A;  1L0I A;  1VQ8 P;  2FQ2 A;  3DTJ A;  5KP8 B;  2JAZ A;  2NO8 A;  3G4S P;  4PH1 A;  2FQ1 A;  2N98 A;  3VRL C;  2N5H A;  2X2B A;  3HZQ A;  1AF8 A;  1VKU A;  2Z44 A;  2PEK A;  2KGC A;  3RG6 C;  2N6Y A;  1IUQ A;  4BPH A;  5BS1 A;  2LML A;  2PNG A;  2LKI A;  4H2W C;  1M6N A;  2LOL A;  2JQ4 A;  2M8L A;  1VQ6 P;  2FVE A;  3DS5 A;  2BUO A;  1X3O A;  2BHV A;  4XRO A;  2K92 A;  2K0X A;  2WPT A;  2MR7 A;  2PEQ A;  1IMP A;  1HQB A;  2KGE A;  2L9F A;  1NJI Q;  2KOR A;  4XRQ A;  2N5I A;  2MVV A;  2FHS C;  2QA4 P;  2K5X A;  1VHN A;  3G28 A;  3DS0 A;  4NEO A;  1KQS O;  2GYK A;  3LMO A;  2XV6 A;  1EMV A;  5EW5 E;  3DS3 A;  3Q20 A;  2CGQ A;  1RO0 A;  3OW2 O;  1YI2 P;  3H0D A;  1GXH A;  2KG8 A;  2P9X A;  3CCR P;  3G21 A;  1YJ9 P;  1VQ7 P;  1QVF O;  2KGD A;  4QKO A;  1Z6M A;  2PEI A;  2N6Z A;  1YIT P;  3GZM A;  2EIA A;  2GDY A;  3G1G A;  3U43 A;  4WYM A;  1K8A Q;  2LPK A;  4BPF A;  2VLO A;  2JU2 A;  2VSQ A;  2QEX P;  4XFY A;  2XXM A;  5F2O A;  4H2Y C; 
#chains in the Genus database with same CATH homology
 1YIJ P;  2JO0 A;  4M0I A;  3VRL C;  3G1I A;  3LRY A;  3HZQ A;  2ONT A;  2M8P A;  1VQK P;  2Z44 A;  4U0A A;  2PEK A;  1K9M Q;  3CD6 P;  4U0E A;  1VQ4 P;  3RG6 C;  1Q7Y Q;  3G6E P;  1IUQ A;  3CCM P;  3CXC O;  3CME P;  3B5I A;  1PEU A;  3E2D A;  3CCS P;  1Q81 Q;  1K73 Q;  5BS1 A;  3I56 P;  3CMA P;  1W2B O;  1AUM A;  1VQN P;  2OAR A;  1M6N A;  5HGL A;  3WBH A;  1ZMB A;  3CC7 P;  2Z45 A;  2M8L A;  4U0B A;  3DS2 A;  4XFZ A;  2EFJ A;  1M74 A;  4U0D A;  3G71 P;  3CC4 P;  1VQ6 P;  3G0V A;  3DS5 A;  5DCK A;  1S72 P;  2M8N A;  3MGE A;  2EG5 A;  2BUO A;  1Q86 Q;  2BHV A;  3G29 A;  3H4E A;  3NTE A;  1M90 Q;  1KD1 Q;  1M6E X;  2PEO A;  4XRO A;  3CC2 P;  1RNI A;  1PEQ A;  5HGN A;  2OTJ P;  1A8O A;  2PEQ A;  2BQ1 E;  2XT1 A;  1EOQ A;  1QVG O;  1NJI Q;  2CWO A;  2E1M A;  4XRQ A;  4PH0 A;  2L6E A;  3M1M A;  3CCQ P;  2QA4 P;  3CPW O;  3H47 A;  3G28 A;  1YJN P;  2DGY A;  1KC8 Q;  3DS0 A;  1VQM P;  3CCU P;  1KQS O;  3I55 P;  4U0C A;  4COC A;  2XV6 A;  2JYG A;  2Z46 A;  2XXM A;  3DS3 A;  4GR6 A;  1PEO A;  3Q20 A;  1BAJ A;  1EIA A;  5HGO A;  1RO0 A;  1RO2 A;  2PEJ A;  3OW2 O;  1YI2 P;  3H0D A;  4GR2 A;  2LF4 A;  2P9X A;  5I4T G;  3CCR P;  2PEM A;  1VQ5 P;  3G21 A;  4QNB A;  1YJ9 P;  1VQ7 P;  1QVF O;  3CCV P;  1E6J P;  2PEI A;  1PEM A;  3P05 A;  3DS1 A;  5F2N A;  1JJ2 O;  1M1K Q;  1YIT P;  2PEN A;  2EIA A;  1Q82 Q;  2OTL P;  1YJW P;  3G1G A;  1QRJ A;  4COP A;  1VQO P;  1N8R Q;  2KOD A;  4WYM A;  5HGM A;  5BS2 A;  5JPA A;  1VQP P;  1YHQ P;  3HYB A;  2JYL A;  1K8A Q;  3G26 A;  1VQ9 P;  4IPY A;  3CCL P;  3CCJ P;  1VQL P;  1VQ8 P;  1A43 A;  3DTJ A;  1K30 A;  4XFX A;  4U0F A;  3G4S P;  1D1D A;  2PY8 A;  3CCE P;  4PH1 A;  2QEX P;  4XFY A;  5F2K A;  3DS4 A;  3DPH A;  5F2O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...