1OR5A

Solution structure of the holo-form of the frenolicin acyl carrier protein, minimized mean structure
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
82
structure length
82
Chain Sequence
SALTVDDLKKLLAETAGEDDSVDLAGELDTPFVDLGYDSLALLETAAVLQQRYGIALTDETVGRLGTPRELLDEVNTTPATA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure and Backbone Dynamics of the Holo Form of the Frenolicin Acyl Carrier Protein
pubmed doi rcsb
source organism Streptomyces roseofulvus
molecule tags Biosynthetic protein
molecule keywords acyl carrier protein
total genus 16
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2003-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 1or5A00
3CE7A 2GDXA 2QNWA 2EHTA 1NQ4A 2MD9A 2FVFA 4CA3A 2JQ4A 2XZ0D 3EJBA 2KGDA 2JU1A 2DNWA 2L9FA 2GDYA 2N6ZA 2LPKA 2MVUA 2N6YA 2AVAA 2KG8A 2KGEA 2FHSC 4PWVB 2FVAA 2K0YA 2FQ1A 5CZDB 2FACA 1DNYA 2CQ8A 2KW2A 3GZLA 2M5RA 3GZMA 4HKGA 2FAEA 2LL8A 5KP7B 4BPHA 2LMLA 2K92A 2K0XA 2KOSA 2N98A 2MVVA 5KP8B 2LIUA 2FQ2A 1KLPA 4H2WC 2PNGA 2VSQA 2KGAA 2FQ0A 2KGCA 2CNRA 2MF4A 2N5IA 2KG6A 5HVCA 2ROQA 1HQBA 2KR5A 1AF8A 3EJDA 1F80D 4MRTC 2LKIA 5KP6B 2K93A 2FADA 2EHSA 1X3OA 2L22A 2GDWA 2KG9A 2AF8A 4BPFA 2LTEA 4H2XC 2LOLA 2N5HA 2FVEA 2KOQA 2N50A 2MY5A 2KORA 4PXHB 2AFDA 4NEOA 3LMOA 1VKUA 2JU2A 2L0QA 2KWLA 2LIWA 2KOOA 2JGPA 4H2YC 1L0IA 4BPGA 1L0HA 2K2QA 4IZ6A 1DV5A 1T8KA 4R0MA 5HV8A 2L4BA 2CG5B 3NY7B 1ACPA 2MR7A 2XZ1C 2K94A 2MR8A 1HY8A 1OR5A 3EJEA 2AFEA 2CGQA 2X2BA 3RG2A 2KOPA 5EJDA 4DG9A
chains in the Genus database with same CATH superfamily
2GDXA 2QNWA 2MD9A 2FVFA 4CA3A 2JQ4A 2KGDA 2ONTA 1VQ5P 1K73Q 2L9FA 1AYIA 1FR2A 3CCLP 2N6YA 2KG8A 4U0AA 2GZGA 1BAJA 1IMQA 5BS2A 2P9XA 2K0DX 2Z45A 1QRJA 3GZLA 1A8OA 4HKGA 3CD6P 5KP7B 2K92A 2N98A 2EIAA 3H4EA 2MVVA 3DPHA 1KC8Q 2VLNA 3E2DA 4H2WC 2PNGA 3DS2A 1M90Q 2KGCA 2N5IA 1HQBA 2KR5A 1YHQP 3M1MA 1ZNVA 2PEQA 5HGMA 1X3OA 1CEIA 2ERHA 1UJZA 2AF8A 2JYGA 2KG9A 3GKLC 2LTEA 1VQOP 2KORA 1IUQA 4NEOA 1Q7YQ 3CC2P 1VQ9P 2KOOA 2NO8A 1RO0A 4XRQA 3CCQP 2K2QA 1YJ9P 3LRYA 4IZ6A 5F2NA 2CG5B 3B4QA 3CCSP 3I55P 1ACPA 4XFYA 2XZ1C 4UHPB 2BUOA 2K94A 2MR8A 1HY8A 2AFEA 2X2BA 3MGEA 1EIAA 2EHTA 1NQ4A 1JJ2O 1Q82Q 5F2KA 3HYBA 2VLOA 4GR6A 2QEXP 3EJBA 2JU1A 1YIJP 3G28A 3CPWO 2GDYA 1K30A 2M8PA 4XFXA 2LPKA 2CWOA 2FHSC 4PWVB 1A43A 2FVAA 5HGOA 1EMVA 1GXGA 5CZDB 2CQ8A 2KW2A 3GZMA 2GYKA 2OARA 1VQKP 2LMLA 2PEMA 2K0XA 2KOSA 3NTEA 5DCKA 1VQNP 2E1MA 3G29A 2LIUA 1YJWP 2FQ2A 2WPTA 3P05A 1E0HA 4WYMA 2MF4A 2CNRA 2XXMA 2ROQA 5JPAA 2GZIA 2JB0A 2EFJA 4MRTC 5KP6B 2EG5A 2DGYA 5HGLA 1RNIA 3CCUP 2LOLA 2PENA 1VQLP 3I56P 3CMAP 4M0IA 2MY5A 4PXHB 3CC4P 1D1DA 2JYLA 2JU2A 2LIWA 2JGPA 1L0HA 3B5IA 3CCVP 1M6NA 4R0MA 1YITP 2GZJA 5I4TG 1VQMP 2JBGA 4U0DA 3G4SP 1Q81Q 2LF4A 3EJEA 4U0EA 1QVGO 3CE7A 2GZEA 3CCRP 3CC7P 5BS1A 4XROA 2DNWA 3G21A 2N6ZA 2JO0A 2MVUA 2AVAA 2KGEA 5EW5E 2BHVA 2XV6A 2FQ1A 1YJNP 1QVFO 2GZFA 2FACA 1DNYA 3G71P 1KQSO 2FAEA 2L6EA 2LL8A 4BPHA 3DS1A 1VQ7P 1S72P 1KLPA 3GJNA 2PEIA 2PY8A 3HZQA 1AUMA 2VSQA 2KGAA 2FQ0A 4QNBA 4COPA 1Z6MA 3EJDA 3CCMP 2Z44A 2LKIA 1K8AQ 1MZ8A 2K93A 2EHSA 2GDWA 4PH0A 1BXIA 4H2XC 4IPYA 1ZMBA 2N5HA 1M74A 2FVEA 2N50A 5HGNA 1GXHA 3G0VA 3LMOA 1VKUA 2L0QA 2KWLA 4H2YC 1Q86Q 3CCEP 1DV5A 1GPJA 1T8KA 1VQ8P 1VQ6P 2OTJP 2MR7A 3OW2O 3G1GA 2M8NA 2CGQA 1M6EX 3DTJA 1VQPP 4DG9A 2Z46A 1W2BO 3H47A 4XFZA 7CEIA 1RO2A 5F2OA 3RG6C 2XZ0D 3DS4A 3G26A 3DS5A 1E6JP 1KD1Q 1IMPA 2PEKA 1UNKA 2PEJA 2KODA 1NJIQ 2VLQA 2K0YA 4U0CA 2M5RA 4F37A 1VHNA 5KP8B 3VRLC 3Q20A 1M1KQ 3DS0A 2JAZA 3G6EP 2M8LA 2KG6A 5HVCA 2QA4P 1AF8A 1EOQA 1F80D 1K9MQ 2FADA 2K5XA 1N8RQ 3DS3A 2L22A 4BPFA 1VQ4P 4U0BA 4COCA 1YI2P 4PH1A 2KOQA 4U0FA 3G1IA 3H0DA 3CMEP 2AFDA 4QKOA 1L0IA 4BPGA 3U43A 5HV8A 2L4BA 3NY7B 2XT1A 3CXCO 3WBHA 1OR5A 2OTLP 3CCJP 4GR2A 3RG2A 2KOPA 2VLPA 5EJDA 2PEOA
chains in the Genus database with same CATH topology
3CE7A 2GDXA 2QNWA 2EHTA 1NQ4A 2MD9A 2FVFA 4CA3A 2JQ4A 2XZ0D 3EJBA 2KGDA 2JU1A 2DNWA 2L9FA 2GDYA 2N6ZA 2LPKA 2MVUA 2N6YA 2AVAA 2KG8A 2KGEA 2FHSC 4PWVB 2FVAA 2K0YA 2FQ1A 5CZDB 2FACA 1DNYA 2CQ8A 2KW2A 3GZLA 2M5RA 3GZMA 4HKGA 2FAEA 2LL8A 5KP7B 4BPHA 2LMLA 2K92A 2K0XA 2KOSA 2N98A 2MVVA 5KP8B 2LIUA 2FQ2A 1KLPA 4H2WC 2PNGA 2VSQA 2KGAA 2FQ0A 2KGCA 2CNRA 2MF4A 2N5IA 2KG6A 5HVCA 2ROQA 1HQBA 2KR5A 1AF8A 3EJDA 1F80D 4MRTC 2LKIA 5KP6B 2K93A 2FADA 2EHSA 1X3OA 2L22A 2GDWA 2KG9A 2AF8A 4BPFA 2LTEA 4H2XC 2LOLA 2N5HA 2FVEA 2KOQA 2N50A 2MY5A 2KORA 4PXHB 2AFDA 4NEOA 3LMOA 1VKUA 2JU2A 2L0QA 2KWLA 2LIWA 2KOOA 2JGPA 4H2YC 1L0IA 4BPGA 1L0HA 2K2QA 4IZ6A 1DV5A 1T8KA 4R0MA 5HV8A 2L4BA 2CG5B 3NY7B 1ACPA 2MR7A 2XZ1C 2K94A 2MR8A 1HY8A 1OR5A 3EJEA 2AFEA 2CGQA 2X2BA 3RG2A 2KOPA 5EJDA 4DG9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CE7 A;  2GDX A;  2QNW A;  2EHT A;  1NQ4 A;  2MD9 A;  2FVF A;  4CA3 A;  2JQ4 A;  2XZ0 D;  3EJB A;  2KGD A;  2JU1 A;  2DNW A;  2L9F A;  2GDY A;  2N6Z A;  2LPK A;  2MVU A;  2N6Y A;  2AVA A;  2KG8 A;  2KGE A;  2FHS C;  4PWV B;  2FVA A;  2K0Y A;  2FQ1 A;  5CZD B;  2FAC A;  1DNY A;  2CQ8 A;  2KW2 A;  3GZL A;  2M5R A;  3GZM A;  4HKG A;  2FAE A;  2LL8 A;  5KP7 B;  4BPH A;  2LML A;  2K92 A;  2K0X A;  2KOS A;  2N98 A;  2MVV A;  5KP8 B;  2LIU A;  2FQ2 A;  1KLP A;  4H2W C;  2PNG A;  2VSQ A;  2KGA A;  2FQ0 A;  2KGC A;  2CNR A;  2MF4 A;  2N5I A;  2KG6 A;  5HVC A;  2ROQ A;  1HQB A;  2KR5 A;  1AF8 A;  3EJD A;  1F80 D;  4MRT C;  2LKI A;  5KP6 B;  2K93 A;  2FAD A;  2EHS A;  1X3O A;  2L22 A;  2GDW A;  2KG9 A;  2AF8 A;  4BPF A;  2LTE A;  4H2X C;  2LOL A;  2N5H A;  2FVE A;  2KOQ A;  2N50 A;  2MY5 A;  2KOR A;  4PXH B;  2AFD A;  4NEO A;  3LMO A;  1VKU A;  2JU2 A;  2L0Q A;  2KWL A;  2LIW A;  2KOO A;  2JGP A;  4H2Y C;  1L0I A;  4BPG A;  1L0H A;  2K2Q A;  4IZ6 A;  1DV5 A;  1T8K A;  4R0M A;  5HV8 A;  2L4B A;  2CG5 B;  3NY7 B;  1ACP A;  2MR7 A;  2XZ1 C;  2K94 A;  2MR8 A;  1HY8 A;  1OR5 A;  3EJE A;  2AFE A;  2CGQ A;  2X2B A;  3RG2 A;  2KOP A;  5EJD A;  4DG9 A; 
#chains in the Genus database with same CATH topology
 2GDX A;  2QNW A;  2MD9 A;  2FVF A;  4CA3 A;  2JQ4 A;  2KGD A;  2ONT A;  1VQ5 P;  1K73 Q;  2L9F A;  1AYI A;  1FR2 A;  3CCL P;  2N6Y A;  2KG8 A;  4U0A A;  2GZG A;  1BAJ A;  1IMQ A;  5BS2 A;  2P9X A;  2K0D X;  2Z45 A;  1QRJ A;  3GZL A;  1A8O A;  4HKG A;  3CD6 P;  5KP7 B;  2K92 A;  2N98 A;  2EIA A;  3H4E A;  2MVV A;  3DPH A;  1KC8 Q;  2VLN A;  3E2D A;  4H2W C;  2PNG A;  3DS2 A;  1M90 Q;  2KGC A;  2N5I A;  1HQB A;  2KR5 A;  1YHQ P;  3M1M A;  1ZNV A;  2PEQ A;  5HGM A;  1X3O A;  1CEI A;  2ERH A;  1UJZ A;  2AF8 A;  2JYG A;  2KG9 A;  3GKL C;  2LTE A;  1VQO P;  2KOR A;  1IUQ A;  4NEO A;  1Q7Y Q;  3CC2 P;  1VQ9 P;  2KOO A;  2NO8 A;  1RO0 A;  4XRQ A;  3CCQ P;  2K2Q A;  1YJ9 P;  3LRY A;  4IZ6 A;  5F2N A;  2CG5 B;  3B4Q A;  3CCS P;  3I55 P;  1ACP A;  4XFY A;  2XZ1 C;  4UHP B;  2BUO A;  2K94 A;  2MR8 A;  1HY8 A;  2AFE A;  2X2B A;  3MGE A;  1EIA A;  2EHT A;  1NQ4 A;  1JJ2 O;  1Q82 Q;  5F2K A;  3HYB A;  2VLO A;  4GR6 A;  2QEX P;  3EJB A;  2JU1 A;  1YIJ P;  3G28 A;  3CPW O;  2GDY A;  1K30 A;  2M8P A;  4XFX A;  2LPK A;  2CWO A;  2FHS C;  4PWV B;  1A43 A;  2FVA A;  5HGO A;  1EMV A;  1GXG A;  5CZD B;  2CQ8 A;  2KW2 A;  3GZM A;  2GYK A;  2OAR A;  1VQK P;  2LML A;  2PEM A;  2K0X A;  2KOS A;  3NTE A;  5DCK A;  1VQN P;  2E1M A;  3G29 A;  2LIU A;  1YJW P;  2FQ2 A;  2WPT A;  3P05 A;  1E0H A;  4WYM A;  2MF4 A;  2CNR A;  2XXM A;  2ROQ A;  5JPA A;  2GZI A;  2JB0 A;  2EFJ A;  4MRT C;  5KP6 B;  2EG5 A;  2DGY A;  5HGL A;  1RNI A;  3CCU P;  2LOL A;  2PEN A;  1VQL P;  3I56 P;  3CMA P;  4M0I A;  2MY5 A;  4PXH B;  3CC4 P;  1D1D A;  2JYL A;  2JU2 A;  2LIW A;  2JGP A;  1L0H A;  3B5I A;  3CCV P;  1M6N A;  4R0M A;  1YIT P;  2GZJ A;  5I4T G;  1VQM P;  2JBG A;  4U0D A;  3G4S P;  1Q81 Q;  2LF4 A;  3EJE A;  4U0E A;  1QVG O;  3CE7 A;  2GZE A;  3CCR P;  3CC7 P;  5BS1 A;  4XRO A;  2DNW A;  3G21 A;  2N6Z A;  2JO0 A;  2MVU A;  2AVA A;  2KGE A;  5EW5 E;  2BHV A;  2XV6 A;  2FQ1 A;  1YJN P;  1QVF O;  2GZF A;  2FAC A;  1DNY A;  3G71 P;  1KQS O;  2FAE A;  2L6E A;  2LL8 A;  4BPH A;  3DS1 A;  1VQ7 P;  1S72 P;  1KLP A;  3GJN A;  2PEI A;  2PY8 A;  3HZQ A;  1AUM A;  2VSQ A;  2KGA A;  2FQ0 A;  4QNB A;  4COP A;  1Z6M A;  3EJD A;  3CCM P;  2Z44 A;  2LKI A;  1K8A Q;  1MZ8 A;  2K93 A;  2EHS A;  2GDW A;  4PH0 A;  1BXI A;  4H2X C;  4IPY A;  1ZMB A;  2N5H A;  1M74 A;  2FVE A;  2N50 A;  5HGN A;  1GXH A;  3G0V A;  3LMO A;  1VKU A;  2L0Q A;  2KWL A;  4H2Y C;  1Q86 Q;  3CCE P;  1DV5 A;  1GPJ A;  1T8K A;  1VQ8 P;  1VQ6 P;  2OTJ P;  2MR7 A;  3OW2 O;  3G1G A;  2M8N A;  2CGQ A;  1M6E X;  3DTJ A;  1VQP P;  4DG9 A;  2Z46 A;  1W2B O;  3H47 A;  4XFZ A;  7CEI A;  1RO2 A;  5F2O A;  3RG6 C;  2XZ0 D;  3DS4 A;  3G26 A;  3DS5 A;  1E6J P;  1KD1 Q;  1IMP A;  2PEK A;  1UNK A;  2PEJ A;  2KOD A;  1NJI Q;  2VLQ A;  2K0Y A;  4U0C A;  2M5R A;  4F37 A;  1VHN A;  5KP8 B;  3VRL C;  3Q20 A;  1M1K Q;  3DS0 A;  2JAZ A;  3G6E P;  2M8L A;  2KG6 A;  5HVC A;  2QA4 P;  1AF8 A;  1EOQ A;  1F80 D;  1K9M Q;  2FAD A;  2K5X A;  1N8R Q;  3DS3 A;  2L22 A;  4BPF A;  1VQ4 P;  4U0B A;  4COC A;  1YI2 P;  4PH1 A;  2KOQ A;  4U0F A;  3G1I A;  3H0D A;  3CME P;  2AFD A;  4QKO A;  1L0I A;  4BPG A;  3U43 A;  5HV8 A;  2L4B A;  3NY7 B;  2XT1 A;  3CXC O;  3WBH A;  1OR5 A;  2OTL P;  3CCJ P;  4GR2 A;  3RG2 A;  2KOP A;  2VLP A;  5EJD A;  2PEO A; 
#chains in the Genus database with same CATH homology
 3CE7 A;  2GDX A;  2QNW A;  2EHT A;  1NQ4 A;  2MD9 A;  2FVF A;  4CA3 A;  2JQ4 A;  2XZ0 D;  3EJB A;  2KGD A;  2JU1 A;  2DNW A;  2L9F A;  2GDY A;  2N6Z A;  2LPK A;  2MVU A;  2N6Y A;  2AVA A;  2KG8 A;  2KGE A;  2FHS C;  4PWV B;  2FVA A;  2K0Y A;  2FQ1 A;  5CZD B;  2FAC A;  1DNY A;  2CQ8 A;  2KW2 A;  3GZL A;  2M5R A;  3GZM A;  4HKG A;  2FAE A;  2LL8 A;  5KP7 B;  4BPH A;  2LML A;  2K92 A;  2K0X A;  2KOS A;  2N98 A;  2MVV A;  5KP8 B;  2LIU A;  2FQ2 A;  1KLP A;  4H2W C;  2PNG A;  2VSQ A;  2KGA A;  2FQ0 A;  2KGC A;  2CNR A;  2MF4 A;  2N5I A;  2KG6 A;  5HVC A;  2ROQ A;  1HQB A;  2KR5 A;  1AF8 A;  3EJD A;  1F80 D;  4MRT C;  2LKI A;  5KP6 B;  2K93 A;  2FAD A;  2EHS A;  1X3O A;  2L22 A;  2GDW A;  2KG9 A;  2AF8 A;  4BPF A;  2LTE A;  4H2X C;  2LOL A;  2N5H A;  2FVE A;  2KOQ A;  2N50 A;  2MY5 A;  2KOR A;  4PXH B;  2AFD A;  4NEO A;  3LMO A;  1VKU A;  2JU2 A;  2L0Q A;  2KWL A;  2LIW A;  2KOO A;  2JGP A;  4H2Y C;  1L0I A;  4BPG A;  1L0H A;  2K2Q A;  4IZ6 A;  1DV5 A;  1T8K A;  4R0M A;  5HV8 A;  2L4B A;  2CG5 B;  3NY7 B;  1ACP A;  2MR7 A;  2XZ1 C;  2K94 A;  2MR8 A;  1HY8 A;  1OR5 A;  3EJE A;  2AFE A;  2CGQ A;  2X2B A;  3RG2 A;  2KOP A;  5EJD A;  4DG9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...