1OR5A

Solution structure of the holo-form of the frenolicin acyl carrier protein, minimized mean structure
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
82
structure length
82
Chain Sequence
SALTVDDLKKLLAETAGEDDSVDLAGELDTPFVDLGYDSLALLETAAVLQQRYGIALTDETVGRLGTPRELLDEVNTTPATA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Biosynthetic protein
molecule keywords acyl carrier protein
publication title Solution Structure and Backbone Dynamics of the Holo Form of the Frenolicin Acyl Carrier Protein
pubmed doi rcsb
source organism Streptomyces roseofulvus
total genus 16
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2003-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 1or5A00
2K92A 1F80D 2CG5B 2GDXA 2LL8A 1DNYA 3NY7B 3CE7A 2KW2A 1L0HA 1HQBA 2FAEA 2K94A 2N6ZA 3GZLA 1ACPA 2LMLA 2JGPA 1VKUA 2GDYA 1NQ4A 4BPGA 2CGQA 2LKIA 1HY8A 2JU1A 2K93A 2MVUA 2K0XA 2JQ4A 2FQ1A 1X3OA 4PWVB 1DV5A 4H2XC 2JU2A 4MRTC 2LOLA 2LIWA 2L22A 2KOPA 2KGAA 2KR5A 2AFDA 2L9FA 4BPFA 2FACA 2KORA 2MY5A 5HV8A 2FHSC 2KOSA 2KGDA 2KOOA 4PXHB 5KP7B 2KG9A 2N98A 4IZ6A 4CA3A 2L4BA 2QNWA 4HKGA 2KOQA 2K0YA 1L0IA 2MD9A 2PNGA 2FVFA 4H2YC 3LMOA 2LTEA 1OR5A 2XZ1C 2FQ2A 3EJDA 2MR8A 2FQ0A 2LIUA 2CQ8A 2EHTA 3EJEA 2AFEA 4H2WC 2AF8A 3RG2A 2KG8A 5HVCA 2MF4A 2MVVA 5CZDB 5EJDA 2EHSA 2N50A 2K2QA 4DG9A 2N5HA 2X2BA 3GZMA 2N5IA 2KGCA 1KLPA 2KWLA 2ROQA 4R0MA 2FVAA 2MR7A 2FADA 1AF8A 2LPKA 4BPHA 1T8KA 2M5RA 5KP8B 2CNRA 2VSQA 4NEOA 2FVEA 2L0QA 3EJBA 2N6YA 5KP6B 2DNWA 2XZ0D 2AVAA 2KG6A 2GDWA 2KGEA
chains in the Genus database with same CATH superfamily
2CG5B 2LL8A 1MZ8A 1M1KQ 1L0HA 2FAEA 1VQ9P 1Q81Q 3DTJA 2DGYA 1E0HA 2Z44A 2K93A 2K0XA 2JQ4A 1GXGA 3G1IA 1X3OA 3B5IA 3HYBA 4MRTC 5HGOA 3MGEA 2LOLA 2LIWA 4XFZA 5F2KA 1ZNVA 2KGAA 3B4QA 2AFDA 4BPFA 3CCUP 5BS2A 1D1DA 2MY5A 2VLNA 3Q20A 2FHSC 5HV8A 2KOSA 3CMEP 4PXHB 4IZ6A 4CA3A 2Z46A 1M6EX 1VHNA 3EJDA 2MR8A 3DS5A 1RNIA 2AF8A 3RG2A 2KG8A 5HVCA 2EHSA 2X2BA 1KD1Q 1VQ5P 1RO2A 5DCKA 1KLPA 2K5XA 4R0MA 2WPTA 2NO8A 2CNRA 3CCVP 4QKOA 3P05A 1Q7YQ 2JB0A 2N6YA 4GR2A 5KP6B 3RG6C 1RO0A 2JYLA 2KG6A 7CEIA 1FR2A 2GDXA 3DS2A 1N8RQ 1HQBA 1ACPA 2LMLA 1YJ9P 2JGPA 2GDYA 3H47A 1HY8A 1BAJA 1IMQA 2MVUA 2OTJP 4U0DA 2PEOA 4U0FA 2QEXP 1ZMBA 1VQ8P 1CEIA 4H2XC 3CCEP 2JU2A 3G4SP 2OTLP 2GZEA 1YIJP 2KOPA 1IUQA 3G0VA 3CCRP 2KG9A 2N98A 5HGNA 1AUMA 2L4BA 3E2DA 4WYMA 1Z6MA 1VQLP 4HKGA 1YITP 2Z45A 2BUOA 1EIAA 2KOQA 2PEIA 2PEMA 2LTEA 3NTEA 2JYGA 3DS4A 1OR5A 3GJNA 5BS1A 2CQ8A 2EHTA 2AFEA 4H2WC 3I56P 2P9XA 2MF4A 3CCLP 5EJDA 2N50A 4PH0A 3GZMA 2N5IA 3CCJP 4GR6A 1A8OA 2MR7A 2FADA 2EFJA 2ERHA 2M5RA 3I55P 1UNKA 1M74A 5F2NA 2K92A 2KW2A 2M8PA 2N6ZA 1YJWP 1NQ4A 4UHPB 4XROA 2LKIA 1A43A 1JJ2O 2JU1A 4F37A 2FQ1A 5I4TG 2OARA 2XXMA 4XFYA 2L22A 5EW5E 2LF4A 3DS3A 2KR5A 4U0CA 2FACA 3CCMP 1EMVA 1K73Q 1VQ7P 2KGDA 5KP7B 4IPYA 2E1MA 1EOQA 2QNWA 2PEQA 2GZJA 1UJZA 2VLPA 2CWOA 4U0AA 4COCA 1L0IA 3CCSP 2MD9A 2JAZA 2GYKA 2PEJA 3LMOA 2BHVA 3CMAP 3CC7P 2PENA 3EJEA 1W2BO 5HGMA 1AYIA 4QNBA 3G71P 2K2QA 2N5HA 3CC4P 3M1MA 1IMPA 3VRLC 2ROQA 1VQMP 2VLOA 2JBGA 3CD6P 1VQPP 1Q86Q 1VQKP 4U0EA 4M0IA 1K8AQ 3WBHA 2GZFA 3OW2O 3G28A 2EIAA 2L0QA 3EJBA 2DNWA 2XT1A 2AVAA 3DS0A 2PY8A 5HGLA 2KGEA 1F80D 1DNYA 3HZQA 4XRQA 3NY7B 3CE7A 1Q82Q 2K94A 3GZLA 1YI2P 3CXCO 1K9MQ 3G26A 5F2OA 1VKUA 1GXHA 3U43A 4BPGA 2CGQA 1E6JP 1BXIA 1VQ4P 4U0BA 2GZGA 4PWVB 1DV5A 2GZIA 5JPAA 4PH1A 3CPWO 3H0DA 2KODA 3G6EP 1M90Q 1YJNP 3DPHA 2L9FA 2KORA 2KOOA 2M8NA 3CCQP 2K0YA 1VQ6P 1KQSO 2PNGA 2PEKA 2FVFA 4H2YC 1KC8Q 2XV6A 2XZ1C 1S72P 2FQ2A 1QRJA 2FQ0A 2LIUA 3H4EA 2L6EA 1GPJA 3G21A 3G29A 2JO0A 1YHQP 2MVVA 5CZDB 4DG9A 1NJIQ 2KGCA 3CC2P 2KWLA 2FVAA 2ONTA 2M8LA 3DS1A 3GKLC 2LPKA 1AF8A 2EG5A 4BPHA 1T8KA 1VQNP 5KP8B 2VSQA 2K0DX 4NEOA 1QVFO 2FVEA 1K30A 3G1GA 2VLQA 2XZ0D 4COPA 4XFXA 1M6NA 3LRYA 2QA4P 1VQOP 1QVGO 2GDWA
chains in the Genus database with same CATH topology
2K92A 1F80D 2CG5B 2GDXA 2LL8A 1DNYA 3NY7B 3CE7A 2KW2A 1L0HA 1HQBA 2FAEA 2K94A 2N6ZA 3GZLA 1ACPA 2LMLA 2JGPA 1VKUA 2GDYA 1NQ4A 4BPGA 2CGQA 2LKIA 1HY8A 2JU1A 2K93A 2MVUA 2K0XA 2JQ4A 2FQ1A 1X3OA 4PWVB 1DV5A 4H2XC 2JU2A 4MRTC 2LOLA 2LIWA 2L22A 2KOPA 2KGAA 2KR5A 2AFDA 2L9FA 4BPFA 2FACA 2KORA 2MY5A 5HV8A 2FHSC 2KOSA 2KGDA 2KOOA 4PXHB 5KP7B 2KG9A 2N98A 4IZ6A 4CA3A 2L4BA 2QNWA 4HKGA 2KOQA 2K0YA 1L0IA 2MD9A 2PNGA 2FVFA 4H2YC 3LMOA 2LTEA 1OR5A 2XZ1C 2FQ2A 3EJDA 2MR8A 2FQ0A 2LIUA 2CQ8A 2EHTA 3EJEA 2AFEA 4H2WC 2AF8A 3RG2A 2KG8A 5HVCA 2MF4A 2MVVA 5CZDB 5EJDA 2EHSA 2N50A 2K2QA 4DG9A 2N5HA 2X2BA 3GZMA 2N5IA 2KGCA 1KLPA 2KWLA 2ROQA 4R0MA 2FVAA 2MR7A 2FADA 1AF8A 2LPKA 4BPHA 1T8KA 2M5RA 5KP8B 2CNRA 2VSQA 4NEOA 2FVEA 2L0QA 3EJBA 2N6YA 5KP6B 2DNWA 2XZ0D 2AVAA 2KG6A 2GDWA 2KGEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K92 A;  1F80 D;  2CG5 B;  2GDX A;  2LL8 A;  1DNY A;  3NY7 B;  3CE7 A;  2KW2 A;  1L0H A;  1HQB A;  2FAE A;  2K94 A;  2N6Z A;  3GZL A;  1ACP A;  2LML A;  2JGP A;  1VKU A;  2GDY A;  1NQ4 A;  4BPG A;  2CGQ A;  2LKI A;  1HY8 A;  2JU1 A;  2K93 A;  2MVU A;  2K0X A;  2JQ4 A;  2FQ1 A;  1X3O A;  4PWV B;  1DV5 A;  4H2X C;  2JU2 A;  4MRT C;  2LOL A;  2LIW A;  2L22 A;  2KOP A;  2KGA A;  2KR5 A;  2AFD A;  2L9F A;  4BPF A;  2FAC A;  2KOR A;  2MY5 A;  5HV8 A;  2FHS C;  2KOS A;  2KGD A;  2KOO A;  4PXH B;  5KP7 B;  2KG9 A;  2N98 A;  4IZ6 A;  4CA3 A;  2L4B A;  2QNW A;  4HKG A;  2KOQ A;  2K0Y A;  1L0I A;  2MD9 A;  2PNG A;  2FVF A;  4H2Y C;  3LMO A;  2LTE A;  1OR5 A;  2XZ1 C;  2FQ2 A;  3EJD A;  2MR8 A;  2FQ0 A;  2LIU A;  2CQ8 A;  2EHT A;  3EJE A;  2AFE A;  4H2W C;  2AF8 A;  3RG2 A;  2KG8 A;  5HVC A;  2MF4 A;  2MVV A;  5CZD B;  5EJD A;  2EHS A;  2N50 A;  2K2Q A;  4DG9 A;  2N5H A;  2X2B A;  3GZM A;  2N5I A;  2KGC A;  1KLP A;  2KWL A;  2ROQ A;  4R0M A;  2FVA A;  2MR7 A;  2FAD A;  1AF8 A;  2LPK A;  4BPH A;  1T8K A;  2M5R A;  5KP8 B;  2CNR A;  2VSQ A;  4NEO A;  2FVE A;  2L0Q A;  3EJB A;  2N6Y A;  5KP6 B;  2DNW A;  2XZ0 D;  2AVA A;  2KG6 A;  2GDW A;  2KGE A; 
#chains in the Genus database with same CATH topology
 2CG5 B;  2LL8 A;  1MZ8 A;  1M1K Q;  1L0H A;  2FAE A;  1VQ9 P;  1Q81 Q;  3DTJ A;  2DGY A;  1E0H A;  2Z44 A;  2K93 A;  2K0X A;  2JQ4 A;  1GXG A;  3G1I A;  1X3O A;  3B5I A;  3HYB A;  4MRT C;  5HGO A;  3MGE A;  2LOL A;  2LIW A;  4XFZ A;  5F2K A;  1ZNV A;  2KGA A;  3B4Q A;  2AFD A;  4BPF A;  3CCU P;  5BS2 A;  1D1D A;  2MY5 A;  2VLN A;  3Q20 A;  2FHS C;  5HV8 A;  2KOS A;  3CME P;  4PXH B;  4IZ6 A;  4CA3 A;  2Z46 A;  1M6E X;  1VHN A;  3EJD A;  2MR8 A;  3DS5 A;  1RNI A;  2AF8 A;  3RG2 A;  2KG8 A;  5HVC A;  2EHS A;  2X2B A;  1KD1 Q;  1VQ5 P;  1RO2 A;  5DCK A;  1KLP A;  2K5X A;  4R0M A;  2WPT A;  2NO8 A;  2CNR A;  3CCV P;  4QKO A;  3P05 A;  1Q7Y Q;  2JB0 A;  2N6Y A;  4GR2 A;  5KP6 B;  3RG6 C;  1RO0 A;  2JYL A;  2KG6 A;  7CEI A;  1FR2 A;  2GDX A;  3DS2 A;  1N8R Q;  1HQB A;  1ACP A;  2LML A;  1YJ9 P;  2JGP A;  2GDY A;  3H47 A;  1HY8 A;  1BAJ A;  1IMQ A;  2MVU A;  2OTJ P;  4U0D A;  2PEO A;  4U0F A;  2QEX P;  1ZMB A;  1VQ8 P;  1CEI A;  4H2X C;  3CCE P;  2JU2 A;  3G4S P;  2OTL P;  2GZE A;  1YIJ P;  2KOP A;  1IUQ A;  3G0V A;  3CCR P;  2KG9 A;  2N98 A;  5HGN A;  1AUM A;  2L4B A;  3E2D A;  4WYM A;  1Z6M A;  1VQL P;  4HKG A;  1YIT P;  2Z45 A;  2BUO A;  1EIA A;  2KOQ A;  2PEI A;  2PEM A;  2LTE A;  3NTE A;  2JYG A;  3DS4 A;  1OR5 A;  3GJN A;  5BS1 A;  2CQ8 A;  2EHT A;  2AFE A;  4H2W C;  3I56 P;  2P9X A;  2MF4 A;  3CCL P;  5EJD A;  2N50 A;  4PH0 A;  3GZM A;  2N5I A;  3CCJ P;  4GR6 A;  1A8O A;  2MR7 A;  2FAD A;  2EFJ A;  2ERH A;  2M5R A;  3I55 P;  1UNK A;  1M74 A;  5F2N A;  2K92 A;  2KW2 A;  2M8P A;  2N6Z A;  1YJW P;  1NQ4 A;  4UHP B;  4XRO A;  2LKI A;  1A43 A;  1JJ2 O;  2JU1 A;  4F37 A;  2FQ1 A;  5I4T G;  2OAR A;  2XXM A;  4XFY A;  2L22 A;  5EW5 E;  2LF4 A;  3DS3 A;  2KR5 A;  4U0C A;  2FAC A;  3CCM P;  1EMV A;  1K73 Q;  1VQ7 P;  2KGD A;  5KP7 B;  4IPY A;  2E1M A;  1EOQ A;  2QNW A;  2PEQ A;  2GZJ A;  1UJZ A;  2VLP A;  2CWO A;  4U0A A;  4COC A;  1L0I A;  3CCS P;  2MD9 A;  2JAZ A;  2GYK A;  2PEJ A;  3LMO A;  2BHV A;  3CMA P;  3CC7 P;  2PEN A;  3EJE A;  1W2B O;  5HGM A;  1AYI A;  4QNB A;  3G71 P;  2K2Q A;  2N5H A;  3CC4 P;  3M1M A;  1IMP A;  3VRL C;  2ROQ A;  1VQM P;  2VLO A;  2JBG A;  3CD6 P;  1VQP P;  1Q86 Q;  1VQK P;  4U0E A;  4M0I A;  1K8A Q;  3WBH A;  2GZF A;  3OW2 O;  3G28 A;  2EIA A;  2L0Q A;  3EJB A;  2DNW A;  2XT1 A;  2AVA A;  3DS0 A;  2PY8 A;  5HGL A;  2KGE A;  1F80 D;  1DNY A;  3HZQ A;  4XRQ A;  3NY7 B;  3CE7 A;  1Q82 Q;  2K94 A;  3GZL A;  1YI2 P;  3CXC O;  1K9M Q;  3G26 A;  5F2O A;  1VKU A;  1GXH A;  3U43 A;  4BPG A;  2CGQ A;  1E6J P;  1BXI A;  1VQ4 P;  4U0B A;  2GZG A;  4PWV B;  1DV5 A;  2GZI A;  5JPA A;  4PH1 A;  3CPW O;  3H0D A;  2KOD A;  3G6E P;  1M90 Q;  1YJN P;  3DPH A;  2L9F A;  2KOR A;  2KOO A;  2M8N A;  3CCQ P;  2K0Y A;  1VQ6 P;  1KQS O;  2PNG A;  2PEK A;  2FVF A;  4H2Y C;  1KC8 Q;  2XV6 A;  2XZ1 C;  1S72 P;  2FQ2 A;  1QRJ A;  2FQ0 A;  2LIU A;  3H4E A;  2L6E A;  1GPJ A;  3G21 A;  3G29 A;  2JO0 A;  1YHQ P;  2MVV A;  5CZD B;  4DG9 A;  1NJI Q;  2KGC A;  3CC2 P;  2KWL A;  2FVA A;  2ONT A;  2M8L A;  3DS1 A;  3GKL C;  2LPK A;  1AF8 A;  2EG5 A;  4BPH A;  1T8K A;  1VQN P;  5KP8 B;  2VSQ A;  2K0D X;  4NEO A;  1QVF O;  2FVE A;  1K30 A;  3G1G A;  2VLQ A;  2XZ0 D;  4COP A;  4XFX A;  1M6N A;  3LRY A;  2QA4 P;  1VQO P;  1QVG O;  2GDW A; 
#chains in the Genus database with same CATH homology
 2K92 A;  1F80 D;  2CG5 B;  2GDX A;  2LL8 A;  1DNY A;  3NY7 B;  3CE7 A;  2KW2 A;  1L0H A;  1HQB A;  2FAE A;  2K94 A;  2N6Z A;  3GZL A;  1ACP A;  2LML A;  2JGP A;  1VKU A;  2GDY A;  1NQ4 A;  4BPG A;  2CGQ A;  2LKI A;  1HY8 A;  2JU1 A;  2K93 A;  2MVU A;  2K0X A;  2JQ4 A;  2FQ1 A;  1X3O A;  4PWV B;  1DV5 A;  4H2X C;  2JU2 A;  4MRT C;  2LOL A;  2LIW A;  2L22 A;  2KOP A;  2KGA A;  2KR5 A;  2AFD A;  2L9F A;  4BPF A;  2FAC A;  2KOR A;  2MY5 A;  5HV8 A;  2FHS C;  2KOS A;  2KGD A;  2KOO A;  4PXH B;  5KP7 B;  2KG9 A;  2N98 A;  4IZ6 A;  4CA3 A;  2L4B A;  2QNW A;  4HKG A;  2KOQ A;  2K0Y A;  1L0I A;  2MD9 A;  2PNG A;  2FVF A;  4H2Y C;  3LMO A;  2LTE A;  1OR5 A;  2XZ1 C;  2FQ2 A;  3EJD A;  2MR8 A;  2FQ0 A;  2LIU A;  2CQ8 A;  2EHT A;  3EJE A;  2AFE A;  4H2W C;  2AF8 A;  3RG2 A;  2KG8 A;  5HVC A;  2MF4 A;  2MVV A;  5CZD B;  5EJD A;  2EHS A;  2N50 A;  2K2Q A;  4DG9 A;  2N5H A;  2X2B A;  3GZM A;  2N5I A;  2KGC A;  1KLP A;  2KWL A;  2ROQ A;  4R0M A;  2FVA A;  2MR7 A;  2FAD A;  1AF8 A;  2LPK A;  4BPH A;  1T8K A;  2M5R A;  5KP8 B;  2CNR A;  2VSQ A;  4NEO A;  2FVE A;  2L0Q A;  3EJB A;  2N6Y A;  5KP6 B;  2DNW A;  2XZ0 D;  2AVA A;  2KG6 A;  2GDW A;  2KGE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...