1OR5A

Solution structure of the holo-form of the frenolicin acyl carrier protein, minimized mean structure
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
82
structure length
82
Chain Sequence
b'SALTVDDLKKLLAETAGEDDSVDLAGELDTPFVDLGYDSLALLETAAVLQQRYGIALTDETVGRLGTPRELLDEVNTTPATA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords acyl carrier protein
publication title Solution Structure and Backbone Dynamics of the Holo Form of the Frenolicin Acyl Carrier Protein
pubmed doi rcsb
source organism Streptomyces roseofulvus
molecule tags Biosynthetic protein
total genus 16
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2003-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 1or5A00
2KG6A 2JGPA 1AF8A 2L9FA 2KWLA 2L4BA 2K94A 2N6YA 5HV8A 4BPGA 2KG8A 4H2WC 2N5HA 2FQ2A 1F80D 5EJDA 1HQBA 2L0QA 3EJBA 5KP7B 2LPKA 4H2XC 2CGQA 3NY7B 2FHSC 2K2QA 2DNWA 2XZ1C 1L0IA 2KOOA 2LL8A 2N6ZA 1HY8A 2KOQA 4HKGA 1NQ4A 3CE7A 2AVAA 2K0XA 2FVFA 5KP8B 2CNRA 2MVUA 2MF4A 2K93A 2EHSA 2JU2A 2ROQA 3RG2A 5HVCA 2LIUA 2N98A 4IZ6A 4PXHB 2JQ4A 2KGCA 4MRTC 2X2BA 2MD9A 2AFDA 2GDXA 2MY5A 2EHTA 2K0YA 2MR8A 2KGEA 2LIWA 1DNYA 2XZ0D 2KOPA 2MR7A 2N5IA 2KW2A 4BPHA 2LKIA 2FADA 2FQ0A 2FACA 5KP6B 2KGDA 1X3OA 4H2YC 2KR5A 1KLPA 2KORA 2LOLA 1T8KA 2MVVA 2FVAA 1OR5A 2LMLA 2FQ1A 3GZLA 2CG5B 1DV5A 2CQ8A 2JU1A 2LTEA 2PNGA 2VSQA 4CA3A 2AF8A 2FVEA 2GDWA 2L22A 1ACPA 3GZMA 2FAEA 3EJEA 1VKUA 2AFEA 4PWVB 3EJDA 2QNWA 4R0MA 1L0HA 4BPFA 2K92A 2GDYA 2KGAA 2KG9A 5CZDB 4NEOA 2KOSA 2N50A 4DG9A 2M5RA 3LMOA
chains in the Genus database with same CATH superfamily
3G21A 1VQ9P 2DGYA 3DS5A 1QVFO 3RG6C 4PH0A 2EFJA 1F80D 1RNIA 5EJDA 5KP7B 5F2NA 2GZEA 2Z44A 2DNWA 3CMEP 2PEIA 1FR2A 2XZ1C 1NQ4A 3CE7A 2AVAA 2K0XA 3Q20A 1JJ2O 3G29A 2MVUA 2KODA 2MF4A 3DS1A 4U0BA 4F37A 2MD9A 2GDXA 1Z6MA 3CC4P 1K30A 1VQKP 2LIWA 1RO2A 1KQSO 1M74A 2LKIA 1YJWP 5HGOA 2KGDA 2LF4A 5BS1A 1VQMP 2PEQA 2KR5A 3GJNA 3MGEA 2FVAA 1DV5A 5I4TG 3CD6P 1W2BO 3G26A 1VQ5P 2QA4P 1VHNA 3CXCO 4XFXA 2EG5A 2BUOA 3EJDA 3H4EA 4GR6A 2GDYA 7CEIA 2KOSA 1EOQA 4XROA 1AF8A 2XXMA 2K0DX 1A43A 4BPGA 3G6EP 1Q82Q 4XFYA 4QNBA 2M8LA 2CGQA 1IMQA 2XV6A 3NY7B 1Q7YQ 1E0HA 1M90Q 2K2QA 1YJ9P 4WYMA 1RO0A 2ERHA 4U0AA 2KOQA 4HKGA 2XT1A 2FVFA 1QVGO 2NO8A 2PEOA 3E2DA 2ROQA 3RG2A 2VLPA 2QEXP 2LIUA 2JO0A 1D1DA 5BS2A 3I56P 1K9MQ 2AFDA 1YJNP 2EHTA 2K0YA 3DS2A 1E6JP 1EIAA 5DCKA 2MR7A 5F2KA 4BPHA 3VRLC 2FACA 4U0FA 3G0VA 4COPA 2GYKA 2LOLA 1YIJP 2JB0A 3GZLA 2Z46A 2CQ8A 2GZJA 3H47A 2VSQA 2VLQA 4CA3A 1K8AQ 2FVEA 3M1MA 1ACPA 4U0DA 2AFEA 4PWVB 1QRJA 1IMPA 1YITP 4GR2A 2KG9A 3CCUP 3WBHA 5EW5E 3GKLC 2KG6A 3CCLP 2GZFA 2N6YA 5HV8A 2KG8A 1VQOP 4H2WC 3DTJA 1S72P 2L0QA 3EJBA 3I55P 1AUMA 1IUQA 2FHSC 3CCSP 2OTLP 2KOOA 5JPAA 2LL8A 4COCA 1Q86Q 3CCJP 1NJIQ 2K93A 3OW2O 3CMAP 3CCQP 3CCRP 2N98A 4IZ6A 2JQ4A 1EMVA 4XRQA 1VQ7P 2MR8A 1A8OA 2KGEA 1UNKA 4XFZA 2XZ0D 1UJZA 5F2OA 2KOPA 3DS3A 2EIAA 2ONTA 4QKOA 1VQ4P 1M6NA 2FADA 3P05A 1X3OA 4IPYA 4H2YC 1BXIA 3DS4A 1KLPA 3CC2P 1VQ8P 1OR5A 1M1KQ 2LMLA 2FQ1A 2CG5B 2PENA 3H0DA 2JU1A 3DS0A 5HGNA 4UHPB 1CEIA 2OTJP 1M6EX 2GDWA 3G71P 3GZMA 2GZGA 3EJEA 1VQ6P 1VKUA 2PEJA 2QNWA 1BAJA 1KC8Q 4BPFA 3NTEA 4U0CA 2KGAA 5CZDB 4NEOA 2N50A 4DG9A 4PH1A 3G1GA 2M5RA 1ZMBA 3G28A 4PXHB 3LMOA 2K5XA 5HGLA 5HGMA 2PY8A 2JGPA 3CC7P 2L9FA 2KWLA 2L4BA 2VLOA 2K94A 3G1IA 1Q81Q 2N5HA 2FQ2A 1HQBA 2LPKA 4H2XC 2JYLA 1GXGA 1AYIA 3U43A 3CPWO 3CCMP 1MZ8A 2Z45A 3DPHA 1YHQP 3LRYA 2BHVA 2PEKA 1L0IA 2N6ZA 2E1MA 1HY8A 1VQPP 5KP8B 2CNRA 2EHSA 2JU2A 3HYBA 2JYGA 5HVCA 1GPJA 2GZIA 3B4QA 1KD1Q 2KGCA 1YI2P 4MRTC 2X2BA 2P9XA 2MY5A 1ZNVA 4M0IA 2M8NA 4U0EA 1N8RQ 1DNYA 2N5IA 2KW2A 2WPTA 2JBGA 2CWOA 2FQ0A 5KP6B 2VLNA 3B5IA 2M8PA 2KORA 1T8KA 2MVVA 3G4SP 2LTEA 2PNGA 1K73Q 2AF8A 2L22A 3CCVP 2OARA 1GXHA 2FAEA 2JAZA 3CCEP 2L6EA 4R0MA 1L0HA 3HZQA 2PEMA 2K92A 1VQNP 1VQLP
chains in the Genus database with same CATH topology
2KG6A 2JGPA 1AF8A 2L9FA 2KWLA 2L4BA 2K94A 2N6YA 5HV8A 4BPGA 2KG8A 4H2WC 2N5HA 2FQ2A 1F80D 5EJDA 1HQBA 2L0QA 3EJBA 5KP7B 2LPKA 4H2XC 2CGQA 3NY7B 2FHSC 2K2QA 2DNWA 2XZ1C 1L0IA 2KOOA 2LL8A 2N6ZA 1HY8A 2KOQA 4HKGA 1NQ4A 3CE7A 2AVAA 2K0XA 2FVFA 5KP8B 2CNRA 2MVUA 2MF4A 2K93A 2EHSA 2JU2A 2ROQA 3RG2A 5HVCA 2LIUA 2N98A 4IZ6A 4PXHB 2JQ4A 2KGCA 4MRTC 2X2BA 2MD9A 2AFDA 2GDXA 2MY5A 2EHTA 2K0YA 2MR8A 2KGEA 2LIWA 1DNYA 2XZ0D 2KOPA 2MR7A 2N5IA 2KW2A 4BPHA 2LKIA 2FADA 2FQ0A 2FACA 5KP6B 2KGDA 1X3OA 4H2YC 2KR5A 1KLPA 2KORA 2LOLA 1T8KA 2MVVA 2FVAA 1OR5A 2LMLA 2FQ1A 3GZLA 2CG5B 1DV5A 2CQ8A 2JU1A 2LTEA 2PNGA 2VSQA 4CA3A 2AF8A 2FVEA 2GDWA 2L22A 1ACPA 3GZMA 2FAEA 3EJEA 1VKUA 2AFEA 4PWVB 3EJDA 2QNWA 4R0MA 1L0HA 4BPFA 2K92A 2GDYA 2KGAA 2KG9A 5CZDB 4NEOA 2KOSA 2N50A 4DG9A 2M5RA 3LMOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KG6 A;  2JGP A;  1AF8 A;  2L9F A;  2KWL A;  2L4B A;  2K94 A;  2N6Y A;  5HV8 A;  4BPG A;  2KG8 A;  4H2W C;  2N5H A;  2FQ2 A;  1F80 D;  5EJD A;  1HQB A;  2L0Q A;  3EJB A;  5KP7 B;  2LPK A;  4H2X C;  2CGQ A;  3NY7 B;  2FHS C;  2K2Q A;  2DNW A;  2XZ1 C;  1L0I A;  2KOO A;  2LL8 A;  2N6Z A;  1HY8 A;  2KOQ A;  4HKG A;  1NQ4 A;  3CE7 A;  2AVA A;  2K0X A;  2FVF A;  5KP8 B;  2CNR A;  2MVU A;  2MF4 A;  2K93 A;  2EHS A;  2JU2 A;  2ROQ A;  3RG2 A;  5HVC A;  2LIU A;  2N98 A;  4IZ6 A;  4PXH B;  2JQ4 A;  2KGC A;  4MRT C;  2X2B A;  2MD9 A;  2AFD A;  2GDX A;  2MY5 A;  2EHT A;  2K0Y A;  2MR8 A;  2KGE A;  2LIW A;  1DNY A;  2XZ0 D;  2KOP A;  2MR7 A;  2N5I A;  2KW2 A;  4BPH A;  2LKI A;  2FAD A;  2FQ0 A;  2FAC A;  5KP6 B;  2KGD A;  1X3O A;  4H2Y C;  2KR5 A;  1KLP A;  2KOR A;  2LOL A;  1T8K A;  2MVV A;  2FVA A;  1OR5 A;  2LML A;  2FQ1 A;  3GZL A;  2CG5 B;  1DV5 A;  2CQ8 A;  2JU1 A;  2LTE A;  2PNG A;  2VSQ A;  4CA3 A;  2AF8 A;  2FVE A;  2GDW A;  2L22 A;  1ACP A;  3GZM A;  2FAE A;  3EJE A;  1VKU A;  2AFE A;  4PWV B;  3EJD A;  2QNW A;  4R0M A;  1L0H A;  4BPF A;  2K92 A;  2GDY A;  2KGA A;  2KG9 A;  5CZD B;  4NEO A;  2KOS A;  2N50 A;  4DG9 A;  2M5R A;  3LMO A; 
#chains in the Genus database with same CATH topology
 3G21 A;  1VQ9 P;  2DGY A;  3DS5 A;  1QVF O;  3RG6 C;  4PH0 A;  2EFJ A;  1F80 D;  1RNI A;  5EJD A;  5KP7 B;  5F2N A;  2GZE A;  2Z44 A;  2DNW A;  3CME P;  2PEI A;  1FR2 A;  2XZ1 C;  1NQ4 A;  3CE7 A;  2AVA A;  2K0X A;  3Q20 A;  1JJ2 O;  3G29 A;  2MVU A;  2KOD A;  2MF4 A;  3DS1 A;  4U0B A;  4F37 A;  2MD9 A;  2GDX A;  1Z6M A;  3CC4 P;  1K30 A;  1VQK P;  2LIW A;  1RO2 A;  1KQS O;  1M74 A;  2LKI A;  1YJW P;  5HGO A;  2KGD A;  2LF4 A;  5BS1 A;  1VQM P;  2PEQ A;  2KR5 A;  3GJN A;  3MGE A;  2FVA A;  1DV5 A;  5I4T G;  3CD6 P;  1W2B O;  3G26 A;  1VQ5 P;  2QA4 P;  1VHN A;  3CXC O;  4XFX A;  2EG5 A;  2BUO A;  3EJD A;  3H4E A;  4GR6 A;  2GDY A;  7CEI A;  2KOS A;  1EOQ A;  4XRO A;  1AF8 A;  2XXM A;  2K0D X;  1A43 A;  4BPG A;  3G6E P;  1Q82 Q;  4XFY A;  4QNB A;  2M8L A;  2CGQ A;  1IMQ A;  2XV6 A;  3NY7 B;  1Q7Y Q;  1E0H A;  1M90 Q;  2K2Q A;  1YJ9 P;  4WYM A;  1RO0 A;  2ERH A;  4U0A A;  2KOQ A;  4HKG A;  2XT1 A;  2FVF A;  1QVG O;  2NO8 A;  2PEO A;  3E2D A;  2ROQ A;  3RG2 A;  2VLP A;  2QEX P;  2LIU A;  2JO0 A;  1D1D A;  5BS2 A;  3I56 P;  1K9M Q;  2AFD A;  1YJN P;  2EHT A;  2K0Y A;  3DS2 A;  1E6J P;  1EIA A;  5DCK A;  2MR7 A;  5F2K A;  4BPH A;  3VRL C;  2FAC A;  4U0F A;  3G0V A;  4COP A;  2GYK A;  2LOL A;  1YIJ P;  2JB0 A;  3GZL A;  2Z46 A;  2CQ8 A;  2GZJ A;  3H47 A;  2VSQ A;  2VLQ A;  4CA3 A;  1K8A Q;  2FVE A;  3M1M A;  1ACP A;  4U0D A;  2AFE A;  4PWV B;  1QRJ A;  1IMP A;  1YIT P;  4GR2 A;  2KG9 A;  3CCU P;  3WBH A;  5EW5 E;  3GKL C;  2KG6 A;  3CCL P;  2GZF A;  2N6Y A;  5HV8 A;  2KG8 A;  1VQO P;  4H2W C;  3DTJ A;  1S72 P;  2L0Q A;  3EJB A;  3I55 P;  1AUM A;  1IUQ A;  2FHS C;  3CCS P;  2OTL P;  2KOO A;  5JPA A;  2LL8 A;  4COC A;  1Q86 Q;  3CCJ P;  1NJI Q;  2K93 A;  3OW2 O;  3CMA P;  3CCQ P;  3CCR P;  2N98 A;  4IZ6 A;  2JQ4 A;  1EMV A;  4XRQ A;  1VQ7 P;  2MR8 A;  1A8O A;  2KGE A;  1UNK A;  4XFZ A;  2XZ0 D;  1UJZ A;  5F2O A;  2KOP A;  3DS3 A;  2EIA A;  2ONT A;  4QKO A;  1VQ4 P;  1M6N A;  2FAD A;  3P05 A;  1X3O A;  4IPY A;  4H2Y C;  1BXI A;  3DS4 A;  1KLP A;  3CC2 P;  1VQ8 P;  1OR5 A;  1M1K Q;  2LML A;  2FQ1 A;  2CG5 B;  2PEN A;  3H0D A;  2JU1 A;  3DS0 A;  5HGN A;  4UHP B;  1CEI A;  2OTJ P;  1M6E X;  2GDW A;  3G71 P;  3GZM A;  2GZG A;  3EJE A;  1VQ6 P;  1VKU A;  2PEJ A;  2QNW A;  1BAJ A;  1KC8 Q;  4BPF A;  3NTE A;  4U0C A;  2KGA A;  5CZD B;  4NEO A;  2N50 A;  4DG9 A;  4PH1 A;  3G1G A;  2M5R A;  1ZMB A;  3G28 A;  4PXH B;  3LMO A;  2K5X A;  5HGL A;  5HGM A;  2PY8 A;  2JGP A;  3CC7 P;  2L9F A;  2KWL A;  2L4B A;  2VLO A;  2K94 A;  3G1I A;  1Q81 Q;  2N5H A;  2FQ2 A;  1HQB A;  2LPK A;  4H2X C;  2JYL A;  1GXG A;  1AYI A;  3U43 A;  3CPW O;  3CCM P;  1MZ8 A;  2Z45 A;  3DPH A;  1YHQ P;  3LRY A;  2BHV A;  2PEK A;  1L0I A;  2N6Z A;  2E1M A;  1HY8 A;  1VQP P;  5KP8 B;  2CNR A;  2EHS A;  2JU2 A;  3HYB A;  2JYG A;  5HVC A;  1GPJ A;  2GZI A;  3B4Q A;  1KD1 Q;  2KGC A;  1YI2 P;  4MRT C;  2X2B A;  2P9X A;  2MY5 A;  1ZNV A;  4M0I A;  2M8N A;  4U0E A;  1N8R Q;  1DNY A;  2N5I A;  2KW2 A;  2WPT A;  2JBG A;  2CWO A;  2FQ0 A;  5KP6 B;  2VLN A;  3B5I A;  2M8P A;  2KOR A;  1T8K A;  2MVV A;  3G4S P;  2LTE A;  2PNG A;  1K73 Q;  2AF8 A;  2L22 A;  3CCV P;  2OAR A;  1GXH A;  2FAE A;  2JAZ A;  3CCE P;  2L6E A;  4R0M A;  1L0H A;  3HZQ A;  2PEM A;  2K92 A;  1VQN P;  1VQL P; 
#chains in the Genus database with same CATH homology
 2KG6 A;  2JGP A;  1AF8 A;  2L9F A;  2KWL A;  2L4B A;  2K94 A;  2N6Y A;  5HV8 A;  4BPG A;  2KG8 A;  4H2W C;  2N5H A;  2FQ2 A;  1F80 D;  5EJD A;  1HQB A;  2L0Q A;  3EJB A;  5KP7 B;  2LPK A;  4H2X C;  2CGQ A;  3NY7 B;  2FHS C;  2K2Q A;  2DNW A;  2XZ1 C;  1L0I A;  2KOO A;  2LL8 A;  2N6Z A;  1HY8 A;  2KOQ A;  4HKG A;  1NQ4 A;  3CE7 A;  2AVA A;  2K0X A;  2FVF A;  5KP8 B;  2CNR A;  2MVU A;  2MF4 A;  2K93 A;  2EHS A;  2JU2 A;  2ROQ A;  3RG2 A;  5HVC A;  2LIU A;  2N98 A;  4IZ6 A;  4PXH B;  2JQ4 A;  2KGC A;  4MRT C;  2X2B A;  2MD9 A;  2AFD A;  2GDX A;  2MY5 A;  2EHT A;  2K0Y A;  2MR8 A;  2KGE A;  2LIW A;  1DNY A;  2XZ0 D;  2KOP A;  2MR7 A;  2N5I A;  2KW2 A;  4BPH A;  2LKI A;  2FAD A;  2FQ0 A;  2FAC A;  5KP6 B;  2KGD A;  1X3O A;  4H2Y C;  2KR5 A;  1KLP A;  2KOR A;  2LOL A;  1T8K A;  2MVV A;  2FVA A;  1OR5 A;  2LML A;  2FQ1 A;  3GZL A;  2CG5 B;  1DV5 A;  2CQ8 A;  2JU1 A;  2LTE A;  2PNG A;  2VSQ A;  4CA3 A;  2AF8 A;  2FVE A;  2GDW A;  2L22 A;  1ACP A;  3GZM A;  2FAE A;  3EJE A;  1VKU A;  2AFE A;  4PWV B;  3EJD A;  2QNW A;  4R0M A;  1L0H A;  4BPF A;  2K92 A;  2GDY A;  2KGA A;  2KG9 A;  5CZD B;  4NEO A;  2KOS A;  2N50 A;  4DG9 A;  2M5R A;  3LMO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...