1OR5A

Solution structure of the holo-form of the frenolicin acyl carrier protein, minimized mean structure
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
82
structure length
82
Chain Sequence
SALTVDDLKKLLAETAGEDDSVDLAGELDTPFVDLGYDSLALLETAAVLQQRYGIALTDETVGRLGTPRELLDEVNTTPATA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure and Backbone Dynamics of the Holo Form of the Frenolicin Acyl Carrier Protein
pubmed doi rcsb
source organism Streptomyces roseofulvus
molecule tags Biosynthetic protein
molecule keywords acyl carrier protein
total genus 16
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2003-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 1or5A00
2XZ0D 2N98A 2KGEA 5EJDA 2ROQA 2KR5A 2LL8A 2XZ1C 2KGAA 2N5HA 2KOQA 2MR7A 1ACPA 2AFDA 2JGPA 2MR8A 2FADA 1HY8A 2MF4A 2CNRA 4CA3A 2MD9A 2FAEA 2L4BA 2QNWA 2KGCA 2AFEA 2FHSC 4HKGA 4IZ6A 1AF8A 2CG5B 4MRTC 2LIUA 5KP8B 2KG8A 2KG6A 2MVUA 2KOOA 4R0MA 2JQ4A 2KG9A 5KP7B 2KWLA 2MY5A 1X3OA 2FVAA 2L9FA 2FVEA 5HVCA 3LMOA 2KW2A 4PWVB 2K93A 2M5RA 2DNWA 2K2QA 3RG2A 2K92A 2LOLA 2LIWA 2EHSA 1VKUA 2N50A 4NEOA 2VSQA 2KOSA 2CGQA 2LKIA 2KGDA 1DNYA 1T8KA 3GZLA 1OR5A 2JU2A 2JU1A 2K0YA 3CE7A 2L22A 5KP6B 1L0HA 2N6YA 2K94A 4BPHA 2AVAA 2FACA 2MVVA 1HQBA 2EHTA 4BPFA 2LTEA 2KORA 3GZMA 2GDWA 2GDXA 4BPGA 2L0QA 2CQ8A 3EJEA 2N5IA 2FQ1A 1NQ4A 3EJBA 1F80D 1L0IA 4H2YC 4PXHB 4H2WC 3NY7B 5CZDB 2LMLA 2FQ0A 2FVFA 3EJDA 4DG9A 2K0XA 5HV8A 2LPKA 2FQ2A 4H2XC 2PNGA 1DV5A 2N6ZA 1KLPA 2AF8A 2GDYA 2X2BA 2KOPA
chains in the Genus database with same CATH superfamily
4UHPB 2KGEA 3I55P 2ROQA 5BS1A 2XZ1C 2JGPA 2MF4A 4U0DA 3G4SP 1N8RQ 1Q81Q 2MD9A 1QVGO 1BXIA 4HKGA 4IZ6A 2CG5B 4MRTC 3I56P 2KG8A 2KG6A 2KOOA 3HYBA 3CPWO 3G28A 2L9FA 2FVEA 5HVCA 1FR2A 2M5RA 5I4TG 1QRJA 2NO8A 2N50A 2JBGA 4PH0A 3VRLC 2Z46A 1VQKP 2CGQA 2GZGA 1DNYA 2OARA 4IPYA 1S72P 3GKLC 3CMEP 1M90Q 3H4EA 2K0YA 2L22A 1JJ2O 1VQ7P 1K30A 2KORA 3G6EP 2CQ8A 3EJEA 2N5IA 2FQ1A 3EJBA 3H0DA 4PXHB 1RO0A 3NY7B 3DPHA 2FQ0A 2M8PA 4XROA 2K0XA 2PEKA 2LPKA 2VLNA 1EMVA 2N6ZA 1KD1Q 2X2BA 2N98A 1MZ8A 1ZMBA 5EW5E 2K0DX 5EJDA 1YJNP 3CCEP 2KR5A 2MR7A 3G1IA 2FADA 3P05A 4XFYA 4COCA 2KGCA 1VQNP 3G0VA 2FHSC 1AF8A 2M8NA 1ZNVA 1RNIA 1AYIA 4PH1A 5HGNA 1YHQP 1EOQA 2JQ4A 5KP7B 1IMQA 2MY5A 1GPJA 4QKOA 2KW2A 3U43A 2DNWA 2E1MA 2LOLA 2EHSA 3CC2P 2BUOA 2VSQA 3E2DA 3G21A 2PENA 2WPTA 5JPAA 2KGDA 2JYGA 3GZLA 1AUMA 1OR5A 1Q86Q 3Q20A 5HGLA 1A43A 3CCQP 2K94A 4BPHA 2AVAA 5HGMA 2MVVA 2JO0A 3LRYA 1GXHA 2LTEA 3GZMA 1YIJP 2L0QA 2PEOA 2GZFA 5CZDB 2LMLA 3EJDA 4DG9A 2QEXP 1YITP 1K73Q 4GR6A 4U0EA 4U0CA 2EG5A 1VQ8P 2AF8A 2GDYA 2KOPA 2XZ0D 1NJIQ 3NTEA 1YJWP 2L6EA 1GXGA 5F2NA 2KGAA 2N5HA 2VLQA 3H47A 1QVFO 2AFDA 2DGYA 1EIAA 2GZJA 2JYLA 3CCSP 2GYKA 2CNRA 4CA3A 1E6JP 4GR2A 2QNWA 2AFEA 2K5XA 3CC7P 5KP8B 4U0FA 1VQOP 3CCJP 4XFXA 4R0MA 2KWLA 4U0AA 3RG6C 1X3OA 1K8AQ 3LMOA 3WBHA 5F2OA 4PWVB 2K93A 2OTLP 3CCRP 2K92A 4XRQA 2LIWA 2JB0A 3OW2O 1VKUA 2Z45A 4F37A 5HGOA 1VQPP 1Z6MA 3HZQA 2QA4P 1D1DA 3B5IA 3G1GA 3CE7A 5KP6B 1L0HA 2N6YA 1IUQA 1UJZA 1HQBA 1M1KQ 2GDXA 1Q7YQ 1NQ4A 3DS5A 4COPA 1F80D 1M6EX 1L0IA 1Q82Q 4H2YC 2XV6A 3DS4A 1BAJA 1VQ6P 1E0HA 1YI2P 5HV8A 1VQMP 1VQ5P 2FQ2A 4H2XC 1CEIA 2PNGA 1KQSO 1K9MQ 3CXCO 1DV5A 1KC8Q 1VHNA 2KODA 3CCMP 1VQ9P 3CMAP 3G29A 4U0BA 4QNBA 2LL8A 2KOQA 2VLOA 1ACPA 2CWOA 2MR8A 2LF4A 1HY8A 2P9XA 3CCLP 3DS1A 2FAEA 2L4BA 5F2KA 3GJNA 3G26A 2ONTA 2M8LA 3CCUP 3CCVP 2LIUA 2JAZA 2MVUA 2PEJA 4M0IA 2KG9A 2PY8A 3G71P 2FVAA 1RO2A 3DS3A 2VLPA 2K2QA 3RG2A 5BS2A 1VQLP 2EIAA 2PEIA 4XFZA 1YJ9P 4NEOA 2KOSA 1VQ4P 2EFJA 2XT1A 5DCKA 3DS0A 2LKIA 2Z44A 3CC4P 1T8KA 2BHVA 2JU2A 1A8OA 3M1MA 2OTJP 2JU1A 2PEQA 2PEMA 1W2BO 3B4QA 2FACA 1M6NA 3DTJA 2EHTA 4BPFA 1M74A 4BPGA 2GZEA 1UNKA 2ERHA 4WYMA 2GZIA 7CEIA 4H2WC 2FVFA 3CD6P 3DS2A 1IMPA 2XXMA 3MGEA 1KLPA 2GDWA
chains in the Genus database with same CATH topology
2XZ0D 2N98A 2KGEA 5EJDA 2ROQA 2KR5A 2LL8A 2XZ1C 2KGAA 2N5HA 2KOQA 2MR7A 1ACPA 2AFDA 2JGPA 2MR8A 2FADA 1HY8A 2MF4A 2CNRA 4CA3A 2MD9A 2FAEA 2L4BA 2QNWA 2KGCA 2AFEA 2FHSC 4HKGA 4IZ6A 1AF8A 2CG5B 4MRTC 2LIUA 5KP8B 2KG8A 2KG6A 2MVUA 2KOOA 4R0MA 2JQ4A 2KG9A 5KP7B 2KWLA 2MY5A 1X3OA 2FVAA 2L9FA 2FVEA 5HVCA 3LMOA 2KW2A 4PWVB 2K93A 2M5RA 2DNWA 2K2QA 3RG2A 2K92A 2LOLA 2LIWA 2EHSA 1VKUA 2N50A 4NEOA 2VSQA 2KOSA 2CGQA 2LKIA 2KGDA 1DNYA 1T8KA 3GZLA 1OR5A 2JU2A 2JU1A 2K0YA 3CE7A 2L22A 5KP6B 1L0HA 2N6YA 2K94A 4BPHA 2AVAA 2FACA 2MVVA 1HQBA 2EHTA 4BPFA 2LTEA 2KORA 3GZMA 2GDWA 2GDXA 4BPGA 2L0QA 2CQ8A 3EJEA 2N5IA 2FQ1A 1NQ4A 3EJBA 1F80D 1L0IA 4H2YC 4PXHB 4H2WC 3NY7B 5CZDB 2LMLA 2FQ0A 2FVFA 3EJDA 4DG9A 2K0XA 5HV8A 2LPKA 2FQ2A 4H2XC 2PNGA 1DV5A 2N6ZA 1KLPA 2AF8A 2GDYA 2X2BA 2KOPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XZ0 D;  2N98 A;  2KGE A;  5EJD A;  2ROQ A;  2KR5 A;  2LL8 A;  2XZ1 C;  2KGA A;  2N5H A;  2KOQ A;  2MR7 A;  1ACP A;  2AFD A;  2JGP A;  2MR8 A;  2FAD A;  1HY8 A;  2MF4 A;  2CNR A;  4CA3 A;  2MD9 A;  2FAE A;  2L4B A;  2QNW A;  2KGC A;  2AFE A;  2FHS C;  4HKG A;  4IZ6 A;  1AF8 A;  2CG5 B;  4MRT C;  2LIU A;  5KP8 B;  2KG8 A;  2KG6 A;  2MVU A;  2KOO A;  4R0M A;  2JQ4 A;  2KG9 A;  5KP7 B;  2KWL A;  2MY5 A;  1X3O A;  2FVA A;  2L9F A;  2FVE A;  5HVC A;  3LMO A;  2KW2 A;  4PWV B;  2K93 A;  2M5R A;  2DNW A;  2K2Q A;  3RG2 A;  2K92 A;  2LOL A;  2LIW A;  2EHS A;  1VKU A;  2N50 A;  4NEO A;  2VSQ A;  2KOS A;  2CGQ A;  2LKI A;  2KGD A;  1DNY A;  1T8K A;  3GZL A;  1OR5 A;  2JU2 A;  2JU1 A;  2K0Y A;  3CE7 A;  2L22 A;  5KP6 B;  1L0H A;  2N6Y A;  2K94 A;  4BPH A;  2AVA A;  2FAC A;  2MVV A;  1HQB A;  2EHT A;  4BPF A;  2LTE A;  2KOR A;  3GZM A;  2GDW A;  2GDX A;  4BPG A;  2L0Q A;  2CQ8 A;  3EJE A;  2N5I A;  2FQ1 A;  1NQ4 A;  3EJB A;  1F80 D;  1L0I A;  4H2Y C;  4PXH B;  4H2W C;  3NY7 B;  5CZD B;  2LML A;  2FQ0 A;  2FVF A;  3EJD A;  4DG9 A;  2K0X A;  5HV8 A;  2LPK A;  2FQ2 A;  4H2X C;  2PNG A;  1DV5 A;  2N6Z A;  1KLP A;  2AF8 A;  2GDY A;  2X2B A;  2KOP A; 
#chains in the Genus database with same CATH topology
 4UHP B;  2KGE A;  3I55 P;  2ROQ A;  5BS1 A;  2XZ1 C;  2JGP A;  2MF4 A;  4U0D A;  3G4S P;  1N8R Q;  1Q81 Q;  2MD9 A;  1QVG O;  1BXI A;  4HKG A;  4IZ6 A;  2CG5 B;  4MRT C;  3I56 P;  2KG8 A;  2KG6 A;  2KOO A;  3HYB A;  3CPW O;  3G28 A;  2L9F A;  2FVE A;  5HVC A;  1FR2 A;  2M5R A;  5I4T G;  1QRJ A;  2NO8 A;  2N50 A;  2JBG A;  4PH0 A;  3VRL C;  2Z46 A;  1VQK P;  2CGQ A;  2GZG A;  1DNY A;  2OAR A;  4IPY A;  1S72 P;  3GKL C;  3CME P;  1M90 Q;  3H4E A;  2K0Y A;  2L22 A;  1JJ2 O;  1VQ7 P;  1K30 A;  2KOR A;  3G6E P;  2CQ8 A;  3EJE A;  2N5I A;  2FQ1 A;  3EJB A;  3H0D A;  4PXH B;  1RO0 A;  3NY7 B;  3DPH A;  2FQ0 A;  2M8P A;  4XRO A;  2K0X A;  2PEK A;  2LPK A;  2VLN A;  1EMV A;  2N6Z A;  1KD1 Q;  2X2B A;  2N98 A;  1MZ8 A;  1ZMB A;  5EW5 E;  2K0D X;  5EJD A;  1YJN P;  3CCE P;  2KR5 A;  2MR7 A;  3G1I A;  2FAD A;  3P05 A;  4XFY A;  4COC A;  2KGC A;  1VQN P;  3G0V A;  2FHS C;  1AF8 A;  2M8N A;  1ZNV A;  1RNI A;  1AYI A;  4PH1 A;  5HGN A;  1YHQ P;  1EOQ A;  2JQ4 A;  5KP7 B;  1IMQ A;  2MY5 A;  1GPJ A;  4QKO A;  2KW2 A;  3U43 A;  2DNW A;  2E1M A;  2LOL A;  2EHS A;  3CC2 P;  2BUO A;  2VSQ A;  3E2D A;  3G21 A;  2PEN A;  2WPT A;  5JPA A;  2KGD A;  2JYG A;  3GZL A;  1AUM A;  1OR5 A;  1Q86 Q;  3Q20 A;  5HGL A;  1A43 A;  3CCQ P;  2K94 A;  4BPH A;  2AVA A;  5HGM A;  2MVV A;  2JO0 A;  3LRY A;  1GXH A;  2LTE A;  3GZM A;  1YIJ P;  2L0Q A;  2PEO A;  2GZF A;  5CZD B;  2LML A;  3EJD A;  4DG9 A;  2QEX P;  1YIT P;  1K73 Q;  4GR6 A;  4U0E A;  4U0C A;  2EG5 A;  1VQ8 P;  2AF8 A;  2GDY A;  2KOP A;  2XZ0 D;  1NJI Q;  3NTE A;  1YJW P;  2L6E A;  1GXG A;  5F2N A;  2KGA A;  2N5H A;  2VLQ A;  3H47 A;  1QVF O;  2AFD A;  2DGY A;  1EIA A;  2GZJ A;  2JYL A;  3CCS P;  2GYK A;  2CNR A;  4CA3 A;  1E6J P;  4GR2 A;  2QNW A;  2AFE A;  2K5X A;  3CC7 P;  5KP8 B;  4U0F A;  1VQO P;  3CCJ P;  4XFX A;  4R0M A;  2KWL A;  4U0A A;  3RG6 C;  1X3O A;  1K8A Q;  3LMO A;  3WBH A;  5F2O A;  4PWV B;  2K93 A;  2OTL P;  3CCR P;  2K92 A;  4XRQ A;  2LIW A;  2JB0 A;  3OW2 O;  1VKU A;  2Z45 A;  4F37 A;  5HGO A;  1VQP P;  1Z6M A;  3HZQ A;  2QA4 P;  1D1D A;  3B5I A;  3G1G A;  3CE7 A;  5KP6 B;  1L0H A;  2N6Y A;  1IUQ A;  1UJZ A;  1HQB A;  1M1K Q;  2GDX A;  1Q7Y Q;  1NQ4 A;  3DS5 A;  4COP A;  1F80 D;  1M6E X;  1L0I A;  1Q82 Q;  4H2Y C;  2XV6 A;  3DS4 A;  1BAJ A;  1VQ6 P;  1E0H A;  1YI2 P;  5HV8 A;  1VQM P;  1VQ5 P;  2FQ2 A;  4H2X C;  1CEI A;  2PNG A;  1KQS O;  1K9M Q;  3CXC O;  1DV5 A;  1KC8 Q;  1VHN A;  2KOD A;  3CCM P;  1VQ9 P;  3CMA P;  3G29 A;  4U0B A;  4QNB A;  2LL8 A;  2KOQ A;  2VLO A;  1ACP A;  2CWO A;  2MR8 A;  2LF4 A;  1HY8 A;  2P9X A;  3CCL P;  3DS1 A;  2FAE A;  2L4B A;  5F2K A;  3GJN A;  3G26 A;  2ONT A;  2M8L A;  3CCU P;  3CCV P;  2LIU A;  2JAZ A;  2MVU A;  2PEJ A;  4M0I A;  2KG9 A;  2PY8 A;  3G71 P;  2FVA A;  1RO2 A;  3DS3 A;  2VLP A;  2K2Q A;  3RG2 A;  5BS2 A;  1VQL P;  2EIA A;  2PEI A;  4XFZ A;  1YJ9 P;  4NEO A;  2KOS A;  1VQ4 P;  2EFJ A;  2XT1 A;  5DCK A;  3DS0 A;  2LKI A;  2Z44 A;  3CC4 P;  1T8K A;  2BHV A;  2JU2 A;  1A8O A;  3M1M A;  2OTJ P;  2JU1 A;  2PEQ A;  2PEM A;  1W2B O;  3B4Q A;  2FAC A;  1M6N A;  3DTJ A;  2EHT A;  4BPF A;  1M74 A;  4BPG A;  2GZE A;  1UNK A;  2ERH A;  4WYM A;  2GZI A;  7CEI A;  4H2W C;  2FVF A;  3CD6 P;  3DS2 A;  1IMP A;  2XXM A;  3MGE A;  1KLP A;  2GDW A; 
#chains in the Genus database with same CATH homology
 2XZ0 D;  2N98 A;  2KGE A;  5EJD A;  2ROQ A;  2KR5 A;  2LL8 A;  2XZ1 C;  2KGA A;  2N5H A;  2KOQ A;  2MR7 A;  1ACP A;  2AFD A;  2JGP A;  2MR8 A;  2FAD A;  1HY8 A;  2MF4 A;  2CNR A;  4CA3 A;  2MD9 A;  2FAE A;  2L4B A;  2QNW A;  2KGC A;  2AFE A;  2FHS C;  4HKG A;  4IZ6 A;  1AF8 A;  2CG5 B;  4MRT C;  2LIU A;  5KP8 B;  2KG8 A;  2KG6 A;  2MVU A;  2KOO A;  4R0M A;  2JQ4 A;  2KG9 A;  5KP7 B;  2KWL A;  2MY5 A;  1X3O A;  2FVA A;  2L9F A;  2FVE A;  5HVC A;  3LMO A;  2KW2 A;  4PWV B;  2K93 A;  2M5R A;  2DNW A;  2K2Q A;  3RG2 A;  2K92 A;  2LOL A;  2LIW A;  2EHS A;  1VKU A;  2N50 A;  4NEO A;  2VSQ A;  2KOS A;  2CGQ A;  2LKI A;  2KGD A;  1DNY A;  1T8K A;  3GZL A;  1OR5 A;  2JU2 A;  2JU1 A;  2K0Y A;  3CE7 A;  2L22 A;  5KP6 B;  1L0H A;  2N6Y A;  2K94 A;  4BPH A;  2AVA A;  2FAC A;  2MVV A;  1HQB A;  2EHT A;  4BPF A;  2LTE A;  2KOR A;  3GZM A;  2GDW A;  2GDX A;  4BPG A;  2L0Q A;  2CQ8 A;  3EJE A;  2N5I A;  2FQ1 A;  1NQ4 A;  3EJB A;  1F80 D;  1L0I A;  4H2Y C;  4PXH B;  4H2W C;  3NY7 B;  5CZD B;  2LML A;  2FQ0 A;  2FVF A;  3EJD A;  4DG9 A;  2K0X A;  5HV8 A;  2LPK A;  2FQ2 A;  4H2X C;  2PNG A;  1DV5 A;  2N6Z A;  1KLP A;  2AF8 A;  2GDY A;  2X2B A;  2KOP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...