1OR5A

Solution structure of the holo-form of the frenolicin acyl carrier protein, minimized mean structure
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
82
structure length
82
Chain Sequence
SALTVDDLKKLLAETAGEDDSVDLAGELDTPFVDLGYDSLALLETAAVLQQRYGIALTDETVGRLGTPRELLDEVNTTPATA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure and Backbone Dynamics of the Holo Form of the Frenolicin Acyl Carrier Protein
pubmed doi rcsb
source organism Streptomyces roseofulvus
molecule tags Biosynthetic protein
molecule keywords acyl carrier protein
total genus 16
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2003-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 1or5A00
2KOSA 2PNGA 5CZDB 2VSQA 2MVUA 3CE7A 2KOQA 2LIWA 3GZLA 4H2YC 2KGDA 2K93A 2L22A 2LOLA 1X3OA 1F80D 2N6YA 1L0IA 2AVAA 2KGCA 4IZ6A 2MVVA 1ACPA 1VKUA 2JU1A 1DV5A 2L4BA 2FQ1A 2N5IA 2JU2A 4PWVB 2DNWA 2FVAA 2JGPA 2FVFA 2KG9A 2MR7A 3EJBA 3RG2A 2KOOA 2N50A 4BPGA 2L9FA 4H2WC 2ROQA 2LIUA 2K94A 2K0YA 2K0XA 2AFDA 2KGEA 2LMLA 4NEOA 2MY5A 2MF4A 2FADA 2FACA 1NQ4A 2KORA 5KP8B 1DNYA 5KP6B 2K92A 2FQ2A 2KGAA 4H2XC 5HV8A 2N98A 4MRTC 4CA3A 2EHTA 2CGQA 1T8KA 5HVCA 1KLPA 2FVEA 1L0HA 2KW2A 1OR5A 2KWLA 2N6ZA 3EJEA 4R0MA 2CQ8A 2FHSC 2AF8A 2N5HA 3GZMA 2MR8A 2GDXA 2LTEA 2M5RA 2KG8A 5EJDA 3LMOA 2KR5A 5KP7B 2XZ1C 2K2QA 2QNWA 2FQ0A 2GDYA 3NY7B 2X2BA 2LPKA 2XZ0D 2FAEA 2MD9A 2AFEA 4PXHB 2KG6A 2GDWA 4BPFA 2LKIA 4DG9A 2LL8A 2CG5B 1HY8A 2KOPA 4BPHA 2JQ4A 2L0QA 3EJDA 2EHSA 4HKGA 2CNRA 1HQBA 1AF8A
chains in the Genus database with same CATH superfamily
2KOSA 2PNGA 5CZDB 1KC8Q 2PY8A 2VSQA 2MVUA 3G0VA 2LIWA 5JPAA 2GZGA 2KGDA 1KQSO 3CPWO 3U43A 4GR2A 3B5IA 1X3OA 3DTJA 1F80D 2AVAA 1EIAA 3CC2P 1M6NA 1ACPA 3G71P 4F37A 4PWVB 2BUOA 3E2DA 2DNWA 2JGPA 2FVFA 2KG9A 3HYBA 4BPGA 3CCEP 2ROQA 1BAJA 3CC4P 1Q7YQ 4M0IA 2FQ2A 2KGAA 4H2XC 4MRTC 5HVCA 1T8KA 3H4EA 5HGNA 2PEMA 2KW2A 2LF4A 2M8LA 1OR5A 3EJEA 2PEIA 2CQ8A 3GKLC 1IUQA 1D1DA 1VQ9P 2GDXA 3CCQP 1RNIA 5EJDA 3LMOA 2KODA 2XZ1C 2FQ0A 3CXCO 2QA4P 2L6EA 2XV6A 1BXIA 2MD9A 2QEXP 2JYLA 5F2NA 3DS3A 5HGOA 4U0BA 4U0CA 2CNRA 1HQBA 2BHVA 3DS4A 1UNKA 2XT1A 3CE7A 3CCMP 3GZLA 3CCJP 1ZMBA 4H2YC 3MGEA 3G26A 2L22A 2VLQA 3G1GA 5BS1A 5BS2A 2LOLA 2VLPA 4IZ6A 7CEIA 1VQLP 3DPHA 4XFZA 3WBHA 2JU1A 1DV5A 2L4BA 1YITP 1RO2A 3H0DA 2FVAA 1VHNA 1YHQP 3OW2O 3EJBA 2K5XA 1GXHA 4PH1A 2EG5A 2GYKA 1NJIQ 2K94A 2K0YA 2K0XA 2AFDA 2CWOA 2JYGA 2FACA 4PH0A 5KP8B 5KP6B 1DNYA 3G1IA 2N98A 1IMPA 2EHTA 3Q20A 2EIAA 2E1MA 1L0HA 4COCA 2N6ZA 1Q86Q 3G21A 2FHSC 3LRYA 2NO8A 3GZMA 2M5RA 4U0FA 2GZJA 2GZIA 2KR5A 3G28A 2Z45A 2QNWA 3NY7B 2FAEA 2JAZA 1UJZA 4PXHB 2GDWA 1W2BO 2LL8A 1KD1Q 2PEQA 2KOPA 4WYMA 5HGMA 2JB0A 2KOQA 2XXMA 5EW5E 4QNBA 2KGCA 2K0DX 1VQ7P 1VKUA 2N5IA 1ZNVA 1VQPP 2JU2A 5F2KA 2DGYA 3DS0A 1N8RQ 1EMVA 3P05A 2VLNA 1GPJA 2MR7A 1M74A 4GR6A 3RG2A 2KOOA 2N50A 2L9FA 4H2WC 2ERHA 2LIUA 3G29A 1M1KQ 3M1MA 1FR2A 2OARA 2KGEA 1K8AQ 2M8NA 2LMLA 4XFXA 2MF4A 4U0AA 1VQ8P 2KORA 2K92A 1YJWP 1YIJP 1VQ4P 1VQMP 2OTLP 2CGQA 2Z46A 4UHPB 3RG6C 2FVEA 4COPA 1A8OA 1IMQA 4R0MA 3GJNA 2AF8A 2N5HA 3CMAP 3G4SP 1K30A 2OTJP 1GXGA 3DS2A 2GZEA 5KP7B 1MZ8A 1AUMA 2K2QA 2GDYA 4IPYA 3CCUP 1K73Q 2Z44A 1S72P 1EOQA 2AFEA 1AYIA 1Z6MA 1CEIA 4BPFA 1HY8A 2JQ4A 2L0QA 2WPTA 3EJDA 3H47A 5F2OA 2GZFA 4XROA 1VQNP 1A43A 2K93A 1E0HA 4U0EA 3CMEP 2N6YA 1L0IA 2MVVA 2VLOA 2EFJA 3I56P 2JO0A 2PEKA 2FQ1A 1E6JP 2ONTA 2PEJA 2PENA 2PEOA 4XRQA 5I4TG 3NTEA 4XFYA 3DS5A 3CC7P 3HZQA 3I55P 1RO0A 4NEOA 2MY5A 5HGLA 2FADA 1NQ4A 1QVGO 1M90Q 1QVFO 5HV8A 4CA3A 1VQKP 3CD6P 1KLPA 1M6EX 3VRLC 5DCKA 1K9MQ 1VQ6P 3CCLP 2KWLA 2M8PA 1YI2P 1VQOP 3CCVP 4QKOA 1Q81Q 2P9XA 2MR8A 2LTEA 1QRJA 3CCRP 2KG8A 3DS1A 3CCSP 2JBGA 4U0DA 2X2BA 2LPKA 1JJ2O 2XZ0D 1VQ5P 1YJNP 1YJ9P 2KG6A 2LKIA 4DG9A 2CG5B 1Q82Q 4BPHA 3G6EP 3B4QA 2EHSA 4HKGA 1AF8A
chains in the Genus database with same CATH topology
2KOSA 2PNGA 5CZDB 2VSQA 2MVUA 3CE7A 2KOQA 2LIWA 3GZLA 4H2YC 2KGDA 2K93A 2L22A 2LOLA 1X3OA 1F80D 2N6YA 1L0IA 2AVAA 2KGCA 4IZ6A 2MVVA 1ACPA 1VKUA 2JU1A 1DV5A 2L4BA 2FQ1A 2N5IA 2JU2A 4PWVB 2DNWA 2FVAA 2JGPA 2FVFA 2KG9A 2MR7A 3EJBA 3RG2A 2KOOA 2N50A 4BPGA 2L9FA 4H2WC 2ROQA 2LIUA 2K94A 2K0YA 2K0XA 2AFDA 2KGEA 2LMLA 4NEOA 2MY5A 2MF4A 2FADA 2FACA 1NQ4A 2KORA 5KP8B 1DNYA 5KP6B 2K92A 2FQ2A 2KGAA 4H2XC 5HV8A 2N98A 4MRTC 4CA3A 2EHTA 2CGQA 1T8KA 5HVCA 1KLPA 2FVEA 1L0HA 2KW2A 1OR5A 2KWLA 2N6ZA 3EJEA 4R0MA 2CQ8A 2FHSC 2AF8A 2N5HA 3GZMA 2MR8A 2GDXA 2LTEA 2M5RA 2KG8A 5EJDA 3LMOA 2KR5A 5KP7B 2XZ1C 2K2QA 2QNWA 2FQ0A 2GDYA 3NY7B 2X2BA 2LPKA 2XZ0D 2FAEA 2MD9A 2AFEA 4PXHB 2KG6A 2GDWA 4BPFA 2LKIA 4DG9A 2LL8A 2CG5B 1HY8A 2KOPA 4BPHA 2JQ4A 2L0QA 3EJDA 2EHSA 4HKGA 2CNRA 1HQBA 1AF8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KOS A;  2PNG A;  5CZD B;  2VSQ A;  2MVU A;  3CE7 A;  2KOQ A;  2LIW A;  3GZL A;  4H2Y C;  2KGD A;  2K93 A;  2L22 A;  2LOL A;  1X3O A;  1F80 D;  2N6Y A;  1L0I A;  2AVA A;  2KGC A;  4IZ6 A;  2MVV A;  1ACP A;  1VKU A;  2JU1 A;  1DV5 A;  2L4B A;  2FQ1 A;  2N5I A;  2JU2 A;  4PWV B;  2DNW A;  2FVA A;  2JGP A;  2FVF A;  2KG9 A;  2MR7 A;  3EJB A;  3RG2 A;  2KOO A;  2N50 A;  4BPG A;  2L9F A;  4H2W C;  2ROQ A;  2LIU A;  2K94 A;  2K0Y A;  2K0X A;  2AFD A;  2KGE A;  2LML A;  4NEO A;  2MY5 A;  2MF4 A;  2FAD A;  2FAC A;  1NQ4 A;  2KOR A;  5KP8 B;  1DNY A;  5KP6 B;  2K92 A;  2FQ2 A;  2KGA A;  4H2X C;  5HV8 A;  2N98 A;  4MRT C;  4CA3 A;  2EHT A;  2CGQ A;  1T8K A;  5HVC A;  1KLP A;  2FVE A;  1L0H A;  2KW2 A;  1OR5 A;  2KWL A;  2N6Z A;  3EJE A;  4R0M A;  2CQ8 A;  2FHS C;  2AF8 A;  2N5H A;  3GZM A;  2MR8 A;  2GDX A;  2LTE A;  2M5R A;  2KG8 A;  5EJD A;  3LMO A;  2KR5 A;  5KP7 B;  2XZ1 C;  2K2Q A;  2QNW A;  2FQ0 A;  2GDY A;  3NY7 B;  2X2B A;  2LPK A;  2XZ0 D;  2FAE A;  2MD9 A;  2AFE A;  4PXH B;  2KG6 A;  2GDW A;  4BPF A;  2LKI A;  4DG9 A;  2LL8 A;  2CG5 B;  1HY8 A;  2KOP A;  4BPH A;  2JQ4 A;  2L0Q A;  3EJD A;  2EHS A;  4HKG A;  2CNR A;  1HQB A;  1AF8 A; 
#chains in the Genus database with same CATH topology
 2KOS A;  2PNG A;  5CZD B;  1KC8 Q;  2PY8 A;  2VSQ A;  2MVU A;  3G0V A;  2LIW A;  5JPA A;  2GZG A;  2KGD A;  1KQS O;  3CPW O;  3U43 A;  4GR2 A;  3B5I A;  1X3O A;  3DTJ A;  1F80 D;  2AVA A;  1EIA A;  3CC2 P;  1M6N A;  1ACP A;  3G71 P;  4F37 A;  4PWV B;  2BUO A;  3E2D A;  2DNW A;  2JGP A;  2FVF A;  2KG9 A;  3HYB A;  4BPG A;  3CCE P;  2ROQ A;  1BAJ A;  3CC4 P;  1Q7Y Q;  4M0I A;  2FQ2 A;  2KGA A;  4H2X C;  4MRT C;  5HVC A;  1T8K A;  3H4E A;  5HGN A;  2PEM A;  2KW2 A;  2LF4 A;  2M8L A;  1OR5 A;  3EJE A;  2PEI A;  2CQ8 A;  3GKL C;  1IUQ A;  1D1D A;  1VQ9 P;  2GDX A;  3CCQ P;  1RNI A;  5EJD A;  3LMO A;  2KOD A;  2XZ1 C;  2FQ0 A;  3CXC O;  2QA4 P;  2L6E A;  2XV6 A;  1BXI A;  2MD9 A;  2QEX P;  2JYL A;  5F2N A;  3DS3 A;  5HGO A;  4U0B A;  4U0C A;  2CNR A;  1HQB A;  2BHV A;  3DS4 A;  1UNK A;  2XT1 A;  3CE7 A;  3CCM P;  3GZL A;  3CCJ P;  1ZMB A;  4H2Y C;  3MGE A;  3G26 A;  2L22 A;  2VLQ A;  3G1G A;  5BS1 A;  5BS2 A;  2LOL A;  2VLP A;  4IZ6 A;  7CEI A;  1VQL P;  3DPH A;  4XFZ A;  3WBH A;  2JU1 A;  1DV5 A;  2L4B A;  1YIT P;  1RO2 A;  3H0D A;  2FVA A;  1VHN A;  1YHQ P;  3OW2 O;  3EJB A;  2K5X A;  1GXH A;  4PH1 A;  2EG5 A;  2GYK A;  1NJI Q;  2K94 A;  2K0Y A;  2K0X A;  2AFD A;  2CWO A;  2JYG A;  2FAC A;  4PH0 A;  5KP8 B;  5KP6 B;  1DNY A;  3G1I A;  2N98 A;  1IMP A;  2EHT A;  3Q20 A;  2EIA A;  2E1M A;  1L0H A;  4COC A;  2N6Z A;  1Q86 Q;  3G21 A;  2FHS C;  3LRY A;  2NO8 A;  3GZM A;  2M5R A;  4U0F A;  2GZJ A;  2GZI A;  2KR5 A;  3G28 A;  2Z45 A;  2QNW A;  3NY7 B;  2FAE A;  2JAZ A;  1UJZ A;  4PXH B;  2GDW A;  1W2B O;  2LL8 A;  1KD1 Q;  2PEQ A;  2KOP A;  4WYM A;  5HGM A;  2JB0 A;  2KOQ A;  2XXM A;  5EW5 E;  4QNB A;  2KGC A;  2K0D X;  1VQ7 P;  1VKU A;  2N5I A;  1ZNV A;  1VQP P;  2JU2 A;  5F2K A;  2DGY A;  3DS0 A;  1N8R Q;  1EMV A;  3P05 A;  2VLN A;  1GPJ A;  2MR7 A;  1M74 A;  4GR6 A;  3RG2 A;  2KOO A;  2N50 A;  2L9F A;  4H2W C;  2ERH A;  2LIU A;  3G29 A;  1M1K Q;  3M1M A;  1FR2 A;  2OAR A;  2KGE A;  1K8A Q;  2M8N A;  2LML A;  4XFX A;  2MF4 A;  4U0A A;  1VQ8 P;  2KOR A;  2K92 A;  1YJW P;  1YIJ P;  1VQ4 P;  1VQM P;  2OTL P;  2CGQ A;  2Z46 A;  4UHP B;  3RG6 C;  2FVE A;  4COP A;  1A8O A;  1IMQ A;  4R0M A;  3GJN A;  2AF8 A;  2N5H A;  3CMA P;  3G4S P;  1K30 A;  2OTJ P;  1GXG A;  3DS2 A;  2GZE A;  5KP7 B;  1MZ8 A;  1AUM A;  2K2Q A;  2GDY A;  4IPY A;  3CCU P;  1K73 Q;  2Z44 A;  1S72 P;  1EOQ A;  2AFE A;  1AYI A;  1Z6M A;  1CEI A;  4BPF A;  1HY8 A;  2JQ4 A;  2L0Q A;  2WPT A;  3EJD A;  3H47 A;  5F2O A;  2GZF A;  4XRO A;  1VQN P;  1A43 A;  2K93 A;  1E0H A;  4U0E A;  3CME P;  2N6Y A;  1L0I A;  2MVV A;  2VLO A;  2EFJ A;  3I56 P;  2JO0 A;  2PEK A;  2FQ1 A;  1E6J P;  2ONT A;  2PEJ A;  2PEN A;  2PEO A;  4XRQ A;  5I4T G;  3NTE A;  4XFY A;  3DS5 A;  3CC7 P;  3HZQ A;  3I55 P;  1RO0 A;  4NEO A;  2MY5 A;  5HGL A;  2FAD A;  1NQ4 A;  1QVG O;  1M90 Q;  1QVF O;  5HV8 A;  4CA3 A;  1VQK P;  3CD6 P;  1KLP A;  1M6E X;  3VRL C;  5DCK A;  1K9M Q;  1VQ6 P;  3CCL P;  2KWL A;  2M8P A;  1YI2 P;  1VQO P;  3CCV P;  4QKO A;  1Q81 Q;  2P9X A;  2MR8 A;  2LTE A;  1QRJ A;  3CCR P;  2KG8 A;  3DS1 A;  3CCS P;  2JBG A;  4U0D A;  2X2B A;  2LPK A;  1JJ2 O;  2XZ0 D;  1VQ5 P;  1YJN P;  1YJ9 P;  2KG6 A;  2LKI A;  4DG9 A;  2CG5 B;  1Q82 Q;  4BPH A;  3G6E P;  3B4Q A;  2EHS A;  4HKG A;  1AF8 A; 
#chains in the Genus database with same CATH homology
 2KOS A;  2PNG A;  5CZD B;  2VSQ A;  2MVU A;  3CE7 A;  2KOQ A;  2LIW A;  3GZL A;  4H2Y C;  2KGD A;  2K93 A;  2L22 A;  2LOL A;  1X3O A;  1F80 D;  2N6Y A;  1L0I A;  2AVA A;  2KGC A;  4IZ6 A;  2MVV A;  1ACP A;  1VKU A;  2JU1 A;  1DV5 A;  2L4B A;  2FQ1 A;  2N5I A;  2JU2 A;  4PWV B;  2DNW A;  2FVA A;  2JGP A;  2FVF A;  2KG9 A;  2MR7 A;  3EJB A;  3RG2 A;  2KOO A;  2N50 A;  4BPG A;  2L9F A;  4H2W C;  2ROQ A;  2LIU A;  2K94 A;  2K0Y A;  2K0X A;  2AFD A;  2KGE A;  2LML A;  4NEO A;  2MY5 A;  2MF4 A;  2FAD A;  2FAC A;  1NQ4 A;  2KOR A;  5KP8 B;  1DNY A;  5KP6 B;  2K92 A;  2FQ2 A;  2KGA A;  4H2X C;  5HV8 A;  2N98 A;  4MRT C;  4CA3 A;  2EHT A;  2CGQ A;  1T8K A;  5HVC A;  1KLP A;  2FVE A;  1L0H A;  2KW2 A;  1OR5 A;  2KWL A;  2N6Z A;  3EJE A;  4R0M A;  2CQ8 A;  2FHS C;  2AF8 A;  2N5H A;  3GZM A;  2MR8 A;  2GDX A;  2LTE A;  2M5R A;  2KG8 A;  5EJD A;  3LMO A;  2KR5 A;  5KP7 B;  2XZ1 C;  2K2Q A;  2QNW A;  2FQ0 A;  2GDY A;  3NY7 B;  2X2B A;  2LPK A;  2XZ0 D;  2FAE A;  2MD9 A;  2AFE A;  4PXH B;  2KG6 A;  2GDW A;  4BPF A;  2LKI A;  4DG9 A;  2LL8 A;  2CG5 B;  1HY8 A;  2KOP A;  4BPH A;  2JQ4 A;  2L0Q A;  3EJD A;  2EHS A;  4HKG A;  2CNR A;  1HQB A;  1AF8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...