1OR5A

Solution structure of the holo-form of the frenolicin acyl carrier protein, minimized mean structure
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
82
structure length
82
Chain Sequence
SALTVDDLKKLLAETAGEDDSVDLAGELDTPFVDLGYDSLALLETAAVLQQRYGIALTDETVGRLGTPRELLDEVNTTPATA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords acyl carrier protein
publication title Solution Structure and Backbone Dynamics of the Holo Form of the Frenolicin Acyl Carrier Protein
pubmed doi rcsb
source organism Streptomyces roseofulvus
molecule tags Biosynthetic protein
total genus 16
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2003-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 1or5A00
2N50A 1KLPA 2AFDA 2K93A 3CE7A 2L0QA 4CA3A 2KR5A 2L22A 2PNGA 4BPHA 4IZ6A 2CNRA 2GDWA 4R0MA 2LL8A 2MVVA 1AF8A 2GDXA 2K92A 2VSQA 2KGEA 4PXHB 1VKUA 4H2YC 4MRTC 2QNWA 2ROQA 2K0XA 1HY8A 2FQ2A 2N98A 2MR7A 1NQ4A 4H2WC 4HKGA 3EJDA 2JU1A 2JGPA 2KOPA 2LIWA 1T8KA 2KG6A 2XZ1C 2MR8A 4H2XC 2MF4A 4NEOA 1L0HA 3NY7B 2EHSA 2FQ1A 1OR5A 3LMOA 1ACPA 2AVAA 2KGCA 5KP6B 3GZLA 2K0YA 2KOOA 2EHTA 2LPKA 2M5RA 2FACA 1X3OA 2KGAA 2KORA 2LKIA 3EJBA 2LTEA 2FQ0A 2AF8A 2N6ZA 5HV8A 4BPFA 2MD9A 2MY5A 2FVAA 2JQ4A 2N5HA 2L9FA 2KG9A 2FADA 2CG5B 2L4BA 1DNYA 2FVFA 2KW2A 5KP7B 3EJEA 5KP8B 2N6YA 2MVUA 4BPGA 2LMLA 2LIUA 2XZ0D 2LOLA 2N5IA 2KWLA 3GZMA 2GDYA 1L0IA 2KOQA 1F80D 5HVCA 2FHSC 3RG2A 5CZDB 2KGDA 4DG9A 1HQBA 2CGQA 2KG8A 2FAEA 2DNWA 5EJDA 4PWVB 2K94A 2JU2A 2AFEA 1DV5A 2K2QA 2CQ8A 2X2BA 2KOSA 2FVEA
chains in the Genus database with same CATH superfamily
2QA4P 1KLPA 5F2OA 3G28A 3G26A 2VLNA 2OARA 4U0FA 2K0DX 3CD6P 1VQ6P 1E6JP 4COCA 1K8AQ 4IZ6A 2CNRA 2M8PA 3I55P 4U0EA 2MVVA 2KGEA 1VKUA 5F2KA 1EMVA 4PH1A 4HKGA 2JU1A 3CCVP 1W2BO 1YI2P 1Z6MA 1Q81Q 2JBGA 4H2XC 2JYLA 5HGMA 1GXGA 3NY7B 1VQMP 2EHSA 3CCJP 2PY8A 2FQ1A 3M1MA 3LMOA 1ACPA 1IMPA 4M0IA 1A8OA 2KGCA 4F37A 1KD1Q 3GKLC 3G4SP 3EJBA 3DPHA 2LTEA 2N6ZA 3CCMP 2MD9A 3G1GA 3RG6C 5HGLA 2LF4A 2KG9A 1DNYA 2KW2A 5KP7B 3EJEA 2MVUA 3WBHA 2KODA 2N5IA 1VHNA 4UHPB 2PEKA 4IPYA 2Z44A 1VQLP 1QVGO 2GZEA 2PEMA 1DV5A 3MGEA 2PEOA 3B4QA 1K30A 4CA3A 2QEXP 2KR5A 2L22A 1E0HA 2VLQA 7CEIA 3CMAP 2EG5A 1S72P 2LL8A 2M8LA 3DTJA 2GDXA 4XFXA 2K92A 1EOQA 2JAZA 4GR2A 1M6NA 2ERHA 1M74A 1VQKP 1YHQP 4U0DA 2FQ2A 3H0DA 3P05A 2N98A 2MR7A 1NQ4A 5BS2A 3G21A 2KOPA 2LIWA 1Q86Q 2KG6A 2BHVA 2XZ1C 1VQNP 1AYIA 1L0HA 1YIJP 3DS5A 1GXHA 2GZGA 1OR5A 1QRJA 2GZFA 2XT1A 2FACA 2KORA 3G71P 3CCUP 5HV8A 4U0AA 4BPFA 2CWOA 2PENA 3E2DA 3CXCO 2GYKA 1YJWP 2L9FA 3NTEA 2FVFA 4WYMA 2N6YA 2VLPA 4COPA 2M8NA 1K73Q 3DS1A 5HVCA 5CZDB 1D1DA 1HQBA 2KG8A 5BS1A 1K9MQ 5EW5E 5EJDA 2XXMA 2PEQA 1KQSO 5I4TG 2X2BA 2KOSA 2FVEA 4XFYA 2N50A 4XRQA 2K93A 3CE7A 1QVFO 5F2NA 3CCLP 3U43A 4U0BA 1RO2A 4R0MA 2XV6A 3CC7P 1UNKA 3VRLC 3DS2A 2EIAA 2ROQA 2K0XA 1NJIQ 1HY8A 1A43A 1CEIA 4H2WC 1VQ9P 2JGPA 1VQOP 1ZNVA 2BUOA 1JJ2O 3H47A 4QNBA 2EFJA 1Q7YQ 1RO0A 1BXIA 3LRYA 5KP6B 3GZLA 2M5RA 1X3OA 2KGAA 1M1KQ 2JYGA 2DGYA 1AUMA 2FQ0A 2MY5A 5DCKA 3CCQP 2N5HA 2OTJP 2FADA 2CG5B 5KP8B 2LMLA 3CPWO 3CCEP 5JPAA 2KWLA 2KOQA 1F80D 3RG2A 2GZIA 2KGDA 4DG9A 3CCSP 5HGNA 2FAEA 2Z46A 2OTLP 4PWVB 2K94A 2JU2A 2Z45A 1RNIA 2K2QA 3HZQA 2NO8A 1KC8Q 2AFDA 2JO0A 3CMEP 2L0QA 2PNGA 4BPHA 2GDWA 4XFZA 2VLOA 3I56P 2E1MA 1AF8A 1EIAA 1YJNP 2VSQA 3G1IA 4PXHB 4H2YC 4MRTC 2QNWA 3CC2P 1YJ9P 1IMQA 1IUQA 1VQ4P 3EJDA 3DS4A 1VQ5P 2JB0A 2P9XA 3H4EA 4PH0A 3B5IA 1T8KA 2WPTA 2MR8A 2MF4A 4NEOA 3DS3A 1Q82Q 2L6EA 3G29A 3CCRP 1M6EX 2AVAA 1VQPP 4XROA 3DS0A 2GZJA 2PEJA 2K0YA 2KOOA 2EHTA 2K5XA 2LPKA 5HGOA 2LKIA 3G6EP 3Q20A 2AF8A 2FVAA 2JQ4A 1BAJA 4GR6A 1MZ8A 3CC4P 2L4BA 1YITP 3GJNA 1UJZA 4BPGA 1FR2A 2LIUA 2XZ0D 2LOLA 3HYBA 1VQ7P 3GZMA 2GDYA 1L0IA 2FHSC 1N8RQ 1GPJA 1ZMBA 2ONTA 4U0CA 2CGQA 3OW2O 2DNWA 3G0VA 1M90Q 4QKOA 2PEIA 2AFEA 2CQ8A 1VQ8P
chains in the Genus database with same CATH topology
2N50A 1KLPA 2AFDA 2K93A 3CE7A 2L0QA 4CA3A 2KR5A 2L22A 2PNGA 4BPHA 4IZ6A 2CNRA 2GDWA 4R0MA 2LL8A 2MVVA 1AF8A 2GDXA 2K92A 2VSQA 2KGEA 4PXHB 1VKUA 4H2YC 4MRTC 2QNWA 2ROQA 2K0XA 1HY8A 2FQ2A 2N98A 2MR7A 1NQ4A 4H2WC 4HKGA 3EJDA 2JU1A 2JGPA 2KOPA 2LIWA 1T8KA 2KG6A 2XZ1C 2MR8A 4H2XC 2MF4A 4NEOA 1L0HA 3NY7B 2EHSA 2FQ1A 1OR5A 3LMOA 1ACPA 2AVAA 2KGCA 5KP6B 3GZLA 2K0YA 2KOOA 2EHTA 2LPKA 2M5RA 2FACA 1X3OA 2KGAA 2KORA 2LKIA 3EJBA 2LTEA 2FQ0A 2AF8A 2N6ZA 5HV8A 4BPFA 2MD9A 2MY5A 2FVAA 2JQ4A 2N5HA 2L9FA 2KG9A 2FADA 2CG5B 2L4BA 1DNYA 2FVFA 2KW2A 5KP7B 3EJEA 5KP8B 2N6YA 2MVUA 4BPGA 2LMLA 2LIUA 2XZ0D 2LOLA 2N5IA 2KWLA 3GZMA 2GDYA 1L0IA 2KOQA 1F80D 5HVCA 2FHSC 3RG2A 5CZDB 2KGDA 4DG9A 1HQBA 2CGQA 2KG8A 2FAEA 2DNWA 5EJDA 4PWVB 2K94A 2JU2A 2AFEA 1DV5A 2K2QA 2CQ8A 2X2BA 2KOSA 2FVEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N50 A;  1KLP A;  2AFD A;  2K93 A;  3CE7 A;  2L0Q A;  4CA3 A;  2KR5 A;  2L22 A;  2PNG A;  4BPH A;  4IZ6 A;  2CNR A;  2GDW A;  4R0M A;  2LL8 A;  2MVV A;  1AF8 A;  2GDX A;  2K92 A;  2VSQ A;  2KGE A;  4PXH B;  1VKU A;  4H2Y C;  4MRT C;  2QNW A;  2ROQ A;  2K0X A;  1HY8 A;  2FQ2 A;  2N98 A;  2MR7 A;  1NQ4 A;  4H2W C;  4HKG A;  3EJD A;  2JU1 A;  2JGP A;  2KOP A;  2LIW A;  1T8K A;  2KG6 A;  2XZ1 C;  2MR8 A;  4H2X C;  2MF4 A;  4NEO A;  1L0H A;  3NY7 B;  2EHS A;  2FQ1 A;  1OR5 A;  3LMO A;  1ACP A;  2AVA A;  2KGC A;  5KP6 B;  3GZL A;  2K0Y A;  2KOO A;  2EHT A;  2LPK A;  2M5R A;  2FAC A;  1X3O A;  2KGA A;  2KOR A;  2LKI A;  3EJB A;  2LTE A;  2FQ0 A;  2AF8 A;  2N6Z A;  5HV8 A;  4BPF A;  2MD9 A;  2MY5 A;  2FVA A;  2JQ4 A;  2N5H A;  2L9F A;  2KG9 A;  2FAD A;  2CG5 B;  2L4B A;  1DNY A;  2FVF A;  2KW2 A;  5KP7 B;  3EJE A;  5KP8 B;  2N6Y A;  2MVU A;  4BPG A;  2LML A;  2LIU A;  2XZ0 D;  2LOL A;  2N5I A;  2KWL A;  3GZM A;  2GDY A;  1L0I A;  2KOQ A;  1F80 D;  5HVC A;  2FHS C;  3RG2 A;  5CZD B;  2KGD A;  4DG9 A;  1HQB A;  2CGQ A;  2KG8 A;  2FAE A;  2DNW A;  5EJD A;  4PWV B;  2K94 A;  2JU2 A;  2AFE A;  1DV5 A;  2K2Q A;  2CQ8 A;  2X2B A;  2KOS A;  2FVE A; 
#chains in the Genus database with same CATH topology
 2QA4 P;  1KLP A;  5F2O A;  3G28 A;  3G26 A;  2VLN A;  2OAR A;  4U0F A;  2K0D X;  3CD6 P;  1VQ6 P;  1E6J P;  4COC A;  1K8A Q;  4IZ6 A;  2CNR A;  2M8P A;  3I55 P;  4U0E A;  2MVV A;  2KGE A;  1VKU A;  5F2K A;  1EMV A;  4PH1 A;  4HKG A;  2JU1 A;  3CCV P;  1W2B O;  1YI2 P;  1Z6M A;  1Q81 Q;  2JBG A;  4H2X C;  2JYL A;  5HGM A;  1GXG A;  3NY7 B;  1VQM P;  2EHS A;  3CCJ P;  2PY8 A;  2FQ1 A;  3M1M A;  3LMO A;  1ACP A;  1IMP A;  4M0I A;  1A8O A;  2KGC A;  4F37 A;  1KD1 Q;  3GKL C;  3G4S P;  3EJB A;  3DPH A;  2LTE A;  2N6Z A;  3CCM P;  2MD9 A;  3G1G A;  3RG6 C;  5HGL A;  2LF4 A;  2KG9 A;  1DNY A;  2KW2 A;  5KP7 B;  3EJE A;  2MVU A;  3WBH A;  2KOD A;  2N5I A;  1VHN A;  4UHP B;  2PEK A;  4IPY A;  2Z44 A;  1VQL P;  1QVG O;  2GZE A;  2PEM A;  1DV5 A;  3MGE A;  2PEO A;  3B4Q A;  1K30 A;  4CA3 A;  2QEX P;  2KR5 A;  2L22 A;  1E0H A;  2VLQ A;  7CEI A;  3CMA P;  2EG5 A;  1S72 P;  2LL8 A;  2M8L A;  3DTJ A;  2GDX A;  4XFX A;  2K92 A;  1EOQ A;  2JAZ A;  4GR2 A;  1M6N A;  2ERH A;  1M74 A;  1VQK P;  1YHQ P;  4U0D A;  2FQ2 A;  3H0D A;  3P05 A;  2N98 A;  2MR7 A;  1NQ4 A;  5BS2 A;  3G21 A;  2KOP A;  2LIW A;  1Q86 Q;  2KG6 A;  2BHV A;  2XZ1 C;  1VQN P;  1AYI A;  1L0H A;  1YIJ P;  3DS5 A;  1GXH A;  2GZG A;  1OR5 A;  1QRJ A;  2GZF A;  2XT1 A;  2FAC A;  2KOR A;  3G71 P;  3CCU P;  5HV8 A;  4U0A A;  4BPF A;  2CWO A;  2PEN A;  3E2D A;  3CXC O;  2GYK A;  1YJW P;  2L9F A;  3NTE A;  2FVF A;  4WYM A;  2N6Y A;  2VLP A;  4COP A;  2M8N A;  1K73 Q;  3DS1 A;  5HVC A;  5CZD B;  1D1D A;  1HQB A;  2KG8 A;  5BS1 A;  1K9M Q;  5EW5 E;  5EJD A;  2XXM A;  2PEQ A;  1KQS O;  5I4T G;  2X2B A;  2KOS A;  2FVE A;  4XFY A;  2N50 A;  4XRQ A;  2K93 A;  3CE7 A;  1QVF O;  5F2N A;  3CCL P;  3U43 A;  4U0B A;  1RO2 A;  4R0M A;  2XV6 A;  3CC7 P;  1UNK A;  3VRL C;  3DS2 A;  2EIA A;  2ROQ A;  2K0X A;  1NJI Q;  1HY8 A;  1A43 A;  1CEI A;  4H2W C;  1VQ9 P;  2JGP A;  1VQO P;  1ZNV A;  2BUO A;  1JJ2 O;  3H47 A;  4QNB A;  2EFJ A;  1Q7Y Q;  1RO0 A;  1BXI A;  3LRY A;  5KP6 B;  3GZL A;  2M5R A;  1X3O A;  2KGA A;  1M1K Q;  2JYG A;  2DGY A;  1AUM A;  2FQ0 A;  2MY5 A;  5DCK A;  3CCQ P;  2N5H A;  2OTJ P;  2FAD A;  2CG5 B;  5KP8 B;  2LML A;  3CPW O;  3CCE P;  5JPA A;  2KWL A;  2KOQ A;  1F80 D;  3RG2 A;  2GZI A;  2KGD A;  4DG9 A;  3CCS P;  5HGN A;  2FAE A;  2Z46 A;  2OTL P;  4PWV B;  2K94 A;  2JU2 A;  2Z45 A;  1RNI A;  2K2Q A;  3HZQ A;  2NO8 A;  1KC8 Q;  2AFD A;  2JO0 A;  3CME P;  2L0Q A;  2PNG A;  4BPH A;  2GDW A;  4XFZ A;  2VLO A;  3I56 P;  2E1M A;  1AF8 A;  1EIA A;  1YJN P;  2VSQ A;  3G1I A;  4PXH B;  4H2Y C;  4MRT C;  2QNW A;  3CC2 P;  1YJ9 P;  1IMQ A;  1IUQ A;  1VQ4 P;  3EJD A;  3DS4 A;  1VQ5 P;  2JB0 A;  2P9X A;  3H4E A;  4PH0 A;  3B5I A;  1T8K A;  2WPT A;  2MR8 A;  2MF4 A;  4NEO A;  3DS3 A;  1Q82 Q;  2L6E A;  3G29 A;  3CCR P;  1M6E X;  2AVA A;  1VQP P;  4XRO A;  3DS0 A;  2GZJ A;  2PEJ A;  2K0Y A;  2KOO A;  2EHT A;  2K5X A;  2LPK A;  5HGO A;  2LKI A;  3G6E P;  3Q20 A;  2AF8 A;  2FVA A;  2JQ4 A;  1BAJ A;  4GR6 A;  1MZ8 A;  3CC4 P;  2L4B A;  1YIT P;  3GJN A;  1UJZ A;  4BPG A;  1FR2 A;  2LIU A;  2XZ0 D;  2LOL A;  3HYB A;  1VQ7 P;  3GZM A;  2GDY A;  1L0I A;  2FHS C;  1N8R Q;  1GPJ A;  1ZMB A;  2ONT A;  4U0C A;  2CGQ A;  3OW2 O;  2DNW A;  3G0V A;  1M90 Q;  4QKO A;  2PEI A;  2AFE A;  2CQ8 A;  1VQ8 P; 
#chains in the Genus database with same CATH homology
 2N50 A;  1KLP A;  2AFD A;  2K93 A;  3CE7 A;  2L0Q A;  4CA3 A;  2KR5 A;  2L22 A;  2PNG A;  4BPH A;  4IZ6 A;  2CNR A;  2GDW A;  4R0M A;  2LL8 A;  2MVV A;  1AF8 A;  2GDX A;  2K92 A;  2VSQ A;  2KGE A;  4PXH B;  1VKU A;  4H2Y C;  4MRT C;  2QNW A;  2ROQ A;  2K0X A;  1HY8 A;  2FQ2 A;  2N98 A;  2MR7 A;  1NQ4 A;  4H2W C;  4HKG A;  3EJD A;  2JU1 A;  2JGP A;  2KOP A;  2LIW A;  1T8K A;  2KG6 A;  2XZ1 C;  2MR8 A;  4H2X C;  2MF4 A;  4NEO A;  1L0H A;  3NY7 B;  2EHS A;  2FQ1 A;  1OR5 A;  3LMO A;  1ACP A;  2AVA A;  2KGC A;  5KP6 B;  3GZL A;  2K0Y A;  2KOO A;  2EHT A;  2LPK A;  2M5R A;  2FAC A;  1X3O A;  2KGA A;  2KOR A;  2LKI A;  3EJB A;  2LTE A;  2FQ0 A;  2AF8 A;  2N6Z A;  5HV8 A;  4BPF A;  2MD9 A;  2MY5 A;  2FVA A;  2JQ4 A;  2N5H A;  2L9F A;  2KG9 A;  2FAD A;  2CG5 B;  2L4B A;  1DNY A;  2FVF A;  2KW2 A;  5KP7 B;  3EJE A;  5KP8 B;  2N6Y A;  2MVU A;  4BPG A;  2LML A;  2LIU A;  2XZ0 D;  2LOL A;  2N5I A;  2KWL A;  3GZM A;  2GDY A;  1L0I A;  2KOQ A;  1F80 D;  5HVC A;  2FHS C;  3RG2 A;  5CZD B;  2KGD A;  4DG9 A;  1HQB A;  2CGQ A;  2KG8 A;  2FAE A;  2DNW A;  5EJD A;  4PWV B;  2K94 A;  2JU2 A;  2AFE A;  1DV5 A;  2K2Q A;  2CQ8 A;  2X2B A;  2KOS A;  2FVE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...