4H2XC

Crystal structure of engineered bradyrhizobium japonicum glycine:[carrier protein] ligase complexed with carrier protein from agrobacterium tumefaciens and an analogue of glycyl adenylate
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
77
structure length
77
Chain Sequence
HMNATIREILAKFGQLPTPVDTIADEADLYAAGLSSFASVQLMLGIEEAFDIEFPDNLLNRKSFASIKAIEDTVKLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Amino acid--[acyl-carrier-protein] ligase 1
publication title Adaptation of aminoacyl-tRNA synthetase catalytic core to carrier protein aminoacylation.
pubmed doi rcsb
source organism Bradyrhizobium japonicum
molecule tags Ligase
total genus 23
structure length 77
sequence length 77
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 4h2xC00
1L0HA 2KG6A 2KOOA 2JQ4A 2LL8A 2AVAA 2N5IA 2K93A 2MY5A 1DNYA 1F80D 5KP7B 2KGAA 2CG5B 3NY7B 2FADA 4MRTC 3EJDA 2FQ1A 2KW2A 2MF4A 2XZ0D 2CGQA 4R0MA 2N50A 4IZ6A 2FAEA 2KGDA 2LIUA 2MVVA 1ACPA 1HY8A 4PWVB 1T8KA 2XZ1C 2K0XA 2MR7A 3GZLA 2GDXA 2FVEA 2LPKA 2L22A 3RG2A 2KGCA 4HKGA 2L4BA 1KLPA 1L0IA 2KWLA 2VSQA 2L9FA 3CE7A 2KOQA 2JU1A 2FHSC 1OR5A 2KOSA 2K94A 2AF8A 1X3OA 4H2WC 4CA3A 1HQBA 2KGEA 5HVCA 2MR8A 2MVUA 2LKIA 2AFEA 2KORA 5KP8B 2LMLA 2LOLA 2FVAA 2JGPA 5KP6B 2EHTA 2FACA 2CQ8A 2K92A 2CNRA 2FQ0A 3EJBA 2LIWA 2FVFA 2K2QA 4H2XC 2M5RA 1AF8A 3EJEA 5HV8A 5EJDA 2LTEA 2JU2A 2KOPA 2N6ZA 2PNGA 1NQ4A 2MD9A 2EHSA 2N6YA 4PXHB 2N98A 2K0YA 2N5HA 2QNWA 2AFDA 3GZMA 4BPHA 1DV5A 2GDYA 4BPGA 1VKUA 2KG8A 3LMOA 4H2YC 4NEOA 4DG9A 2L0QA 5CZDB 2ROQA 2X2BA 2KG9A 4BPFA 2DNWA 2KR5A 2GDWA 2FQ2A
chains in the Genus database with same CATH superfamily
5BS1A 3VRLC 3CXCO 2MY5A 1VQ4P 2KGAA 2CG5B 1VQOP 4MRTC 2N50A 1YI2P 2JYLA 4COPA 2LIUA 1HY8A 4PWVB 1T8KA 5HGNA 2E1MA 2GDXA 3I55P 2CWOA 4QKOA 2L22A 3RG2A 1VQNP 3CCEP 1CEIA 4COCA 2VSQA 2L6EA 1IUQA 3OW2O 3LRYA 3DS4A 2ERHA 4H2WC 1YJNP 4XFYA 1D1DA 5HGMA 2AFEA 2KORA 1VQKP 5KP8B 2LMLA 2JO0A 4XRQA 5HGOA 2EHTA 2LIWA 4UHPB 3DS3A 2K2QA 4H2XC 3P05A 3CD6P 3WBHA 5EJDA 2OARA 1K8AQ 3GJNA 2PEOA 1M90Q 4PXHB 1Q82Q 2KODA 2N5HA 1VQ5P 1RO2A 3NTEA 2EFJA 3G4SP 2GDYA 4DG9A 3DS2A 4BPFA 2M8LA 1KQSO 2KR5A 4U0BA 2XV6A 1N8RQ 1BXIA 1L0HA 3M1MA 2KG6A 2JQ4A 1EOQA 2NO8A 1W2BO 2K93A 3B4QA 4R0MA 1Q7YQ 4XFZA 2FAEA 2KGDA 4F37A 1KC8Q 2XZ1C 2K0XA 2Z44A 3HYBA 4XROA 3G29A 3HZQA 3B5IA 2ONTA 2PEKA 5F2NA 1S72P 1KLPA 3DS1A 1L0IA 2JAZA 2JB0A 3CC7P 1HQBA 1AUMA 2KGEA 2XXMA 5I4TG 3G0VA 2VLPA 2LOLA 2JGPA 2CQ8A 2CNRA 2QA4P 1NJIQ 2FVFA 2K5XA 2M5RA 2LF4A 3Q20A 1M74A 2XT1A 3EJEA 3CCQP 5HV8A 2PNGA 3DS0A 2PEQA 4U0CA 1VQ9P 4PH1A 2AFDA 3CCVP 3CPWO 3CC2P 4GR6A 5DCKA 4BPHA 1VKUA 3MGEA 2EG5A 2ROQA 2PEIA 3CCUP 3CMEP 2DNWA 3CMAP 2GZJA 3CCMP 2M8PA 2KOOA 2LL8A 2AVAA 1DNYA 4GR2A 5KP7B 1M6NA 3CC4P 3EJDA 1GXHA 2FQ1A 2XZ0D 2CGQA 1EMVA 2WPTA 4IZ6A 3G21A 2MVVA 2VLOA 3G1IA 1VQPP 1YJ9P 1GPJA 2BUOA 1K30A 3GZLA 2FVEA 2LPKA 4QNBA 2GZFA 1E0HA 4HKGA 2OTJP 4M0IA 1QRJA 2L9FA 1EIAA 2OTLP 3CE7A 2PEJA 2KOQA 3DPHA 2JU1A 2FHSC 1OR5A 3CCLP 1Q86Q 2GYKA 1VQMP 3H0DA 5F2KA 1M6EX 1X3OA 4WYMA 2MR8A 2Z46A 2MVUA 4IPYA 2LKIA 4XFXA 2FVAA 5KP6B 2K92A 2P9XA 3EJBA 2FQ0A 3E2DA 1ZNVA 2Z45A 5EW5E 1KD1Q 1AF8A 3G26A 1E6JP 5JPAA 2JU2A 5HGLA 3G1GA 1YIJP 3I56P 3H4EA 2MD9A 1VHNA 2N6YA 3G28A 2QNWA 3GZMA 2EIAA 4BPGA 2PEMA 5CZDB 1YITP 2PY8A 2X2BA 3H47A 3G71P 4PH0A 2FQ2A 2QEXP 5BS2A 2K0DX 1A43A 2N5IA 1MZ8A 1JJ2O 3U43A 3NY7B 3CCSP 2FADA 1QVFO 2MF4A 2KW2A 1K73Q 1UJZA 1QVGO 1BAJA 1ACPA 1VQ8P 2MR7A 1VQLP 1IMQA 3GKLC 1VQ6P 2KGCA 2L4BA 2KWLA 2GZIA 1YJWP 4U0FA 2KOSA 4U0DA 2K94A 2AF8A 1RO0A 1Z6MA 2VLNA 4CA3A 1IMPA 3DS5A 2M8NA 5HVCA 1FR2A 2BHVA 1RNIA 3G6EP 3RG6C 2FACA 1K9MQ 1ZMBA 2VLQA 3CCRP 2GZEA 1GXGA 2LTEA 1Q81Q 2KOPA 2N6ZA 1AYIA 2GZGA 1NQ4A 1YHQP 2EHSA 1A8OA 2N98A 2K0YA 2JBGA 1VQ7P 2DGYA 1UNKA 1DV5A 7CEIA 2JYGA 4U0EA 2PENA 2KG8A 3DTJA 3LMOA 4U0AA 5F2OA 4H2YC 4NEOA 3CCJP 2L0QA 2KG9A 1M1KQ 2GDWA 1F80D
chains in the Genus database with same CATH topology
1L0HA 2KG6A 2KOOA 2JQ4A 2LL8A 2AVAA 2N5IA 2K93A 2MY5A 1DNYA 1F80D 5KP7B 2KGAA 2CG5B 3NY7B 2FADA 4MRTC 3EJDA 2FQ1A 2KW2A 2MF4A 2XZ0D 2CGQA 4R0MA 2N50A 4IZ6A 2FAEA 2KGDA 2LIUA 2MVVA 1ACPA 1HY8A 4PWVB 1T8KA 2XZ1C 2K0XA 2MR7A 3GZLA 2GDXA 2FVEA 2LPKA 2L22A 3RG2A 2KGCA 4HKGA 2L4BA 1KLPA 1L0IA 2KWLA 2VSQA 2L9FA 3CE7A 2KOQA 2JU1A 2FHSC 1OR5A 2KOSA 2K94A 2AF8A 1X3OA 4H2WC 4CA3A 1HQBA 2KGEA 5HVCA 2MR8A 2MVUA 2LKIA 2AFEA 2KORA 5KP8B 2LMLA 2LOLA 2FVAA 2JGPA 5KP6B 2EHTA 2FACA 2CQ8A 2K92A 2CNRA 2FQ0A 3EJBA 2LIWA 2FVFA 2K2QA 4H2XC 2M5RA 1AF8A 3EJEA 5HV8A 5EJDA 2LTEA 2JU2A 2KOPA 2N6ZA 2PNGA 1NQ4A 2MD9A 2EHSA 2N6YA 4PXHB 2N98A 2K0YA 2N5HA 2QNWA 2AFDA 3GZMA 4BPHA 1DV5A 2GDYA 4BPGA 1VKUA 2KG8A 3LMOA 4H2YC 4NEOA 4DG9A 2L0QA 5CZDB 2ROQA 2X2BA 2KG9A 4BPFA 2DNWA 2KR5A 2GDWA 2FQ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L0H A;  2KG6 A;  2KOO A;  2JQ4 A;  2LL8 A;  2AVA A;  2N5I A;  2K93 A;  2MY5 A;  1DNY A;  1F80 D;  5KP7 B;  2KGA A;  2CG5 B;  3NY7 B;  2FAD A;  4MRT C;  3EJD A;  2FQ1 A;  2KW2 A;  2MF4 A;  2XZ0 D;  2CGQ A;  4R0M A;  2N50 A;  4IZ6 A;  2FAE A;  2KGD A;  2LIU A;  2MVV A;  1ACP A;  1HY8 A;  4PWV B;  1T8K A;  2XZ1 C;  2K0X A;  2MR7 A;  3GZL A;  2GDX A;  2FVE A;  2LPK A;  2L22 A;  3RG2 A;  2KGC A;  4HKG A;  2L4B A;  1KLP A;  1L0I A;  2KWL A;  2VSQ A;  2L9F A;  3CE7 A;  2KOQ A;  2JU1 A;  2FHS C;  1OR5 A;  2KOS A;  2K94 A;  2AF8 A;  1X3O A;  4H2W C;  4CA3 A;  1HQB A;  2KGE A;  5HVC A;  2MR8 A;  2MVU A;  2LKI A;  2AFE A;  2KOR A;  5KP8 B;  2LML A;  2LOL A;  2FVA A;  2JGP A;  5KP6 B;  2EHT A;  2FAC A;  2CQ8 A;  2K92 A;  2CNR A;  2FQ0 A;  3EJB A;  2LIW A;  2FVF A;  2K2Q A;  4H2X C;  2M5R A;  1AF8 A;  3EJE A;  5HV8 A;  5EJD A;  2LTE A;  2JU2 A;  2KOP A;  2N6Z A;  2PNG A;  1NQ4 A;  2MD9 A;  2EHS A;  2N6Y A;  4PXH B;  2N98 A;  2K0Y A;  2N5H A;  2QNW A;  2AFD A;  3GZM A;  4BPH A;  1DV5 A;  2GDY A;  4BPG A;  1VKU A;  2KG8 A;  3LMO A;  4H2Y C;  4NEO A;  4DG9 A;  2L0Q A;  5CZD B;  2ROQ A;  2X2B A;  2KG9 A;  4BPF A;  2DNW A;  2KR5 A;  2GDW A;  2FQ2 A; 
#chains in the Genus database with same CATH topology
 5BS1 A;  3VRL C;  3CXC O;  2MY5 A;  1VQ4 P;  2KGA A;  2CG5 B;  1VQO P;  4MRT C;  2N50 A;  1YI2 P;  2JYL A;  4COP A;  2LIU A;  1HY8 A;  4PWV B;  1T8K A;  5HGN A;  2E1M A;  2GDX A;  3I55 P;  2CWO A;  4QKO A;  2L22 A;  3RG2 A;  1VQN P;  3CCE P;  1CEI A;  4COC A;  2VSQ A;  2L6E A;  1IUQ A;  3OW2 O;  3LRY A;  3DS4 A;  2ERH A;  4H2W C;  1YJN P;  4XFY A;  1D1D A;  5HGM A;  2AFE A;  2KOR A;  1VQK P;  5KP8 B;  2LML A;  2JO0 A;  4XRQ A;  5HGO A;  2EHT A;  2LIW A;  4UHP B;  3DS3 A;  2K2Q A;  4H2X C;  3P05 A;  3CD6 P;  3WBH A;  5EJD A;  2OAR A;  1K8A Q;  3GJN A;  2PEO A;  1M90 Q;  4PXH B;  1Q82 Q;  2KOD A;  2N5H A;  1VQ5 P;  1RO2 A;  3NTE A;  2EFJ A;  3G4S P;  2GDY A;  4DG9 A;  3DS2 A;  4BPF A;  2M8L A;  1KQS O;  2KR5 A;  4U0B A;  2XV6 A;  1N8R Q;  1BXI A;  1L0H A;  3M1M A;  2KG6 A;  2JQ4 A;  1EOQ A;  2NO8 A;  1W2B O;  2K93 A;  3B4Q A;  4R0M A;  1Q7Y Q;  4XFZ A;  2FAE A;  2KGD A;  4F37 A;  1KC8 Q;  2XZ1 C;  2K0X A;  2Z44 A;  3HYB A;  4XRO A;  3G29 A;  3HZQ A;  3B5I A;  2ONT A;  2PEK A;  5F2N A;  1S72 P;  1KLP A;  3DS1 A;  1L0I A;  2JAZ A;  2JB0 A;  3CC7 P;  1HQB A;  1AUM A;  2KGE A;  2XXM A;  5I4T G;  3G0V A;  2VLP A;  2LOL A;  2JGP A;  2CQ8 A;  2CNR A;  2QA4 P;  1NJI Q;  2FVF A;  2K5X A;  2M5R A;  2LF4 A;  3Q20 A;  1M74 A;  2XT1 A;  3EJE A;  3CCQ P;  5HV8 A;  2PNG A;  3DS0 A;  2PEQ A;  4U0C A;  1VQ9 P;  4PH1 A;  2AFD A;  3CCV P;  3CPW O;  3CC2 P;  4GR6 A;  5DCK A;  4BPH A;  1VKU A;  3MGE A;  2EG5 A;  2ROQ A;  2PEI A;  3CCU P;  3CME P;  2DNW A;  3CMA P;  2GZJ A;  3CCM P;  2M8P A;  2KOO A;  2LL8 A;  2AVA A;  1DNY A;  4GR2 A;  5KP7 B;  1M6N A;  3CC4 P;  3EJD A;  1GXH A;  2FQ1 A;  2XZ0 D;  2CGQ A;  1EMV A;  2WPT A;  4IZ6 A;  3G21 A;  2MVV A;  2VLO A;  3G1I A;  1VQP P;  1YJ9 P;  1GPJ A;  2BUO A;  1K30 A;  3GZL A;  2FVE A;  2LPK A;  4QNB A;  2GZF A;  1E0H A;  4HKG A;  2OTJ P;  4M0I A;  1QRJ A;  2L9F A;  1EIA A;  2OTL P;  3CE7 A;  2PEJ A;  2KOQ A;  3DPH A;  2JU1 A;  2FHS C;  1OR5 A;  3CCL P;  1Q86 Q;  2GYK A;  1VQM P;  3H0D A;  5F2K A;  1M6E X;  1X3O A;  4WYM A;  2MR8 A;  2Z46 A;  2MVU A;  4IPY A;  2LKI A;  4XFX A;  2FVA A;  5KP6 B;  2K92 A;  2P9X A;  3EJB A;  2FQ0 A;  3E2D A;  1ZNV A;  2Z45 A;  5EW5 E;  1KD1 Q;  1AF8 A;  3G26 A;  1E6J P;  5JPA A;  2JU2 A;  5HGL A;  3G1G A;  1YIJ P;  3I56 P;  3H4E A;  2MD9 A;  1VHN A;  2N6Y A;  3G28 A;  2QNW A;  3GZM A;  2EIA A;  4BPG A;  2PEM A;  5CZD B;  1YIT P;  2PY8 A;  2X2B A;  3H47 A;  3G71 P;  4PH0 A;  2FQ2 A;  2QEX P;  5BS2 A;  2K0D X;  1A43 A;  2N5I A;  1MZ8 A;  1JJ2 O;  3U43 A;  3NY7 B;  3CCS P;  2FAD A;  1QVF O;  2MF4 A;  2KW2 A;  1K73 Q;  1UJZ A;  1QVG O;  1BAJ A;  1ACP A;  1VQ8 P;  2MR7 A;  1VQL P;  1IMQ A;  3GKL C;  1VQ6 P;  2KGC A;  2L4B A;  2KWL A;  2GZI A;  1YJW P;  4U0F A;  2KOS A;  4U0D A;  2K94 A;  2AF8 A;  1RO0 A;  1Z6M A;  2VLN A;  4CA3 A;  1IMP A;  3DS5 A;  2M8N A;  5HVC A;  1FR2 A;  2BHV A;  1RNI A;  3G6E P;  3RG6 C;  2FAC A;  1K9M Q;  1ZMB A;  2VLQ A;  3CCR P;  2GZE A;  1GXG A;  2LTE A;  1Q81 Q;  2KOP A;  2N6Z A;  1AYI A;  2GZG A;  1NQ4 A;  1YHQ P;  2EHS A;  1A8O A;  2N98 A;  2K0Y A;  2JBG A;  1VQ7 P;  2DGY A;  1UNK A;  1DV5 A;  7CEI A;  2JYG A;  4U0E A;  2PEN A;  2KG8 A;  3DTJ A;  3LMO A;  4U0A A;  5F2O A;  4H2Y C;  4NEO A;  3CCJ P;  2L0Q A;  2KG9 A;  1M1K Q;  2GDW A;  1F80 D; 
#chains in the Genus database with same CATH homology
 1L0H A;  2KG6 A;  2KOO A;  2JQ4 A;  2LL8 A;  2AVA A;  2N5I A;  2K93 A;  2MY5 A;  1DNY A;  1F80 D;  5KP7 B;  2KGA A;  2CG5 B;  3NY7 B;  2FAD A;  4MRT C;  3EJD A;  2FQ1 A;  2KW2 A;  2MF4 A;  2XZ0 D;  2CGQ A;  4R0M A;  2N50 A;  4IZ6 A;  2FAE A;  2KGD A;  2LIU A;  2MVV A;  1ACP A;  1HY8 A;  4PWV B;  1T8K A;  2XZ1 C;  2K0X A;  2MR7 A;  3GZL A;  2GDX A;  2FVE A;  2LPK A;  2L22 A;  3RG2 A;  2KGC A;  4HKG A;  2L4B A;  1KLP A;  1L0I A;  2KWL A;  2VSQ A;  2L9F A;  3CE7 A;  2KOQ A;  2JU1 A;  2FHS C;  1OR5 A;  2KOS A;  2K94 A;  2AF8 A;  1X3O A;  4H2W C;  4CA3 A;  1HQB A;  2KGE A;  5HVC A;  2MR8 A;  2MVU A;  2LKI A;  2AFE A;  2KOR A;  5KP8 B;  2LML A;  2LOL A;  2FVA A;  2JGP A;  5KP6 B;  2EHT A;  2FAC A;  2CQ8 A;  2K92 A;  2CNR A;  2FQ0 A;  3EJB A;  2LIW A;  2FVF A;  2K2Q A;  4H2X C;  2M5R A;  1AF8 A;  3EJE A;  5HV8 A;  5EJD A;  2LTE A;  2JU2 A;  2KOP A;  2N6Z A;  2PNG A;  1NQ4 A;  2MD9 A;  2EHS A;  2N6Y A;  4PXH B;  2N98 A;  2K0Y A;  2N5H A;  2QNW A;  2AFD A;  3GZM A;  4BPH A;  1DV5 A;  2GDY A;  4BPG A;  1VKU A;  2KG8 A;  3LMO A;  4H2Y C;  4NEO A;  4DG9 A;  2L0Q A;  5CZD B;  2ROQ A;  2X2B A;  2KG9 A;  4BPF A;  2DNW A;  2KR5 A;  2GDW A;  2FQ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...