4H2XC

Crystal structure of engineered bradyrhizobium japonicum glycine:[carrier protein] ligase complexed with carrier protein from agrobacterium tumefaciens and an analogue of glycyl adenylate
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
77
structure length
77
Chain Sequence
HMNATIREILAKFGQLPTPVDTIADEADLYAAGLSSFASVQLMLGIEEAFDIEFPDNLLNRKSFASIKAIEDTVKLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Amino acid--[acyl-carrier-protein] ligase 1
publication title Adaptation of aminoacyl-tRNA synthetase catalytic core to carrier protein aminoacylation.
pubmed doi rcsb
source organism Bradyrhizobium japonicum
total genus 23
structure length 77
sequence length 77
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 4h2xC00
2KORA 4CA3A 2M5RA 1L0IA 1KLPA 4PWVB 1VKUA 2PNGA 2LIUA 2KGCA 2KG8A 5CZDB 4H2WC 2JGPA 2KGAA 4DG9A 2MVVA 2JQ4A 2GDXA 2FACA 2L9FA 1HY8A 2FQ0A 2LPKA 2ROQA 2KG9A 2LOLA 2KWLA 2LKIA 1X3OA 2GDWA 2L4BA 2FVFA 3CE7A 2N5HA 1L0HA 3LMOA 2N5IA 2CNRA 1ACPA 2K93A 2FQ1A 4PXHB 2N50A 2CQ8A 2CG5B 2FHSC 1T8KA 2MR8A 5EJDA 2KGEA 2AF8A 2MR7A 2L22A 3EJBA 2L0QA 1OR5A 2FADA 2KGDA 4MRTC 2AFDA 2EHTA 2AVAA 2XZ0D 3RG2A 5HV8A 2KOQA 4HKGA 2KG6A 2N6YA 2MD9A 2LTEA 2QNWA 5KP7B 5HVCA 2LMLA 2K0XA 4IZ6A 2KOSA 2EHSA 2JU2A 2AFEA 2KW2A 4BPHA 2LL8A 2K94A 3NY7B 4H2XC 2FAEA 2N6ZA 2N98A 4R0MA 2X2BA 1DV5A 2K0YA 2MVUA 2K92A 3GZLA 1F80D 4NEOA 1NQ4A 2MY5A 3EJDA 2FVEA 2DNWA 1AF8A 1DNYA 2K2QA 2GDYA 2KR5A 5KP6B 2FQ2A 2FVAA 3EJEA 1HQBA 4H2YC 2JU1A 4BPFA 2KOOA 5KP8B 2VSQA 2KOPA 2XZ1C 3GZMA 4BPGA 2MF4A 2LIWA 2CGQA
chains in the Genus database with same CATH superfamily
2GZJA 2VLOA 1A8OA 1KLPA 1UJZA 5DCKA 1QRJA 4XRQA 1N8RQ 4U0CA 2GZGA 1VQ6P 2KGAA 3GJNA 4QNBA 2FACA 2CWOA 4PH0A 1HY8A 2KG9A 1BAJA 1MZ8A 2N5HA 1ACPA 2CQ8A 3CPWO 5EJDA 2L0QA 1FR2A 2FADA 2PEIA 3DS0A 5HV8A 1UNKA 2KOQA 3B4QA 1AUMA 1EOQA 1S72P 1E0HA 5HVCA 1YHQP 2KOSA 1M90Q 1Q82Q 4COCA 4BPHA 4PH1A 2K94A 3NY7B 4QKOA 2WPTA 4F37A 3DTJA 3G6EP 3CCVP 2PEJA 2JO0A 3M1MA 2JYGA 2FVEA 3CCJP 3G4SP 2E1MA 4U0BA 2K2QA 1VQ4P 2XXMA 4H2YC 2KODA 2OTLP 1YITP 4COPA 3DS3A 2PEKA 1ZMBA 4BPGA 3DS1A 1VQ9P 2CGQA 1Q81Q 2M5RA 4IPYA 2PEMA 1L0IA 4PWVB 2DGYA 5CZDB 1K8AQ 1YJWP 4DG9A 2JQ4A 5HGOA 2GDXA 2L9FA 2ROQA 2LOLA 5I4TG 2KWLA 2GDWA 1GXGA 2N5IA 2K93A 3HYBA 2FQ1A 4PXHB 7CEIA 2ONTA 2CG5B 2FHSC 1T8KA 2XT1A 3I56P 3Q20A 2KGEA 2AF8A 2P9XA 4M0IA 4MRTC 3CCRP 2AFDA 3H0DA 2JAZA 4U0FA 1E6JP 4U0DA 4WYMA 4HKGA 1M74A 2N6YA 2OTJP 2QNWA 5KP7B 1QVGO 1RO0A 2K0XA 5EW5E 3H47A 3DS2A 5BS1A 4H2XC 2N98A 4R0MA 2XV6A 2L6EA 2K92A 1RO2A 4NEOA 1D1DA 1EMVA 2BHVA 1AF8A 1DNYA 1VQ5P 1K9MQ 3CCUP 2K5XA 5HGLA 2VLPA 2GZFA 3CC2P 2KOPA 1VQLP 2MF4A 1VQKP 2PY8A 4XFXA 4CA3A 1VKUA 1KQSO 2PENA 2KGCA 2KG8A 3DS5A 5BS2A 2JGPA 4U0EA 3CCQP 2MVVA 1VQOP 5F2KA 3U43A 1EIAA 4XFYA 3NTEA 3VRLC 3CMAP 2LKIA 2NO8A 2M8LA 2JB0A 1VQPP 3CE7A 3LMOA 3DS4A 1IMPA 2OARA 2N50A 1KD1Q 3B5IA 2GYKA 3G71P 1K73Q 2QEXP 2MR7A 2VLQA 2EHTA 2AVAA 3RG2A 3CCMP 2KG6A 1NJIQ 3CCSP 2JBGA 1Q86Q 5HGMA 2JU2A 3MGEA 1VQNP 2AFEA 1RNIA 2M8PA 1W2BO 2KW2A 1VHNA 2FAEA 1BXIA 3CC4P 2N6ZA 2K0YA 1GXHA 5HGNA 5F2NA 1F80D 2M8NA 1NQ4A 3CXCO 3EJDA 1VQ8P 1A43A 5F2OA 2DNWA 1YJ9P 2Z44A 3DPHA 2KR5A 3P05A 5KP6B 2FQ2A 3CCLP 2FVAA 1HQBA 2JU1A 2EIAA 1YIJP 2KOOA 1CEIA 2GZIA 5KP8B 3G1GA 1VQMP 2GZEA 2VSQA 4XFZA 1YJNP 2XZ1C 2KORA 1IUQA 1KC8Q 1QVFO 2Z46A 3H4EA 3CMEP 1M6EX 4U0AA 2PNGA 2EG5A 3OW2O 3G0VA 2LIUA 4H2WC 3G26A 3E2DA 2FQ0A 2LPKA 2QA4P 1Q7YQ 1X3OA 2L4BA 3CCEP 2FVFA 4GR2A 1L0HA 1M6NA 2CNRA 1JJ2O 2VLNA 2JYLA 2MR8A 3EJBA 3RG6C 2L22A 1OR5A 2KGDA 3HZQA 1YI2P 3I55P 2XZ0D 3CC7P 2LTEA 2MD9A 3G28A 2Z45A 2LF4A 4GR6A 2BUOA 2LMLA 1AYIA 4IZ6A 2EHSA 3G29A 3G1IA 2ERHA 2LL8A 2PEOA 4UHPB 1IMQA 1DV5A 2X2BA 3G21A 1K30A 2MVUA 3GZLA 3WBHA 1GPJA 2MY5A 4XROA 2PEQA 5JPAA 1ZNVA 1Z6MA 2GDYA 2LIWA 3EJEA 2K0DX 2EFJA 4BPFA 3CD6P 1VQ7P 3GKLC 1M1KQ 3GZMA 3LRYA
chains in the Genus database with same CATH topology
2KORA 4CA3A 2M5RA 1L0IA 1KLPA 4PWVB 1VKUA 2PNGA 2LIUA 2KGCA 2KG8A 5CZDB 4H2WC 2JGPA 2KGAA 4DG9A 2MVVA 2JQ4A 2GDXA 2FACA 2L9FA 1HY8A 2FQ0A 2LPKA 2ROQA 2KG9A 2LOLA 2KWLA 2LKIA 1X3OA 2GDWA 2L4BA 2FVFA 3CE7A 2N5HA 1L0HA 3LMOA 2N5IA 2CNRA 1ACPA 2K93A 2FQ1A 4PXHB 2N50A 2CQ8A 2CG5B 2FHSC 1T8KA 2MR8A 5EJDA 2KGEA 2AF8A 2MR7A 2L22A 3EJBA 2L0QA 1OR5A 2FADA 2KGDA 4MRTC 2AFDA 2EHTA 2AVAA 2XZ0D 3RG2A 5HV8A 2KOQA 4HKGA 2KG6A 2N6YA 2MD9A 2LTEA 2QNWA 5KP7B 5HVCA 2LMLA 2K0XA 4IZ6A 2KOSA 2EHSA 2JU2A 2AFEA 2KW2A 4BPHA 2LL8A 2K94A 3NY7B 4H2XC 2FAEA 2N6ZA 2N98A 4R0MA 2X2BA 1DV5A 2K0YA 2MVUA 2K92A 3GZLA 1F80D 4NEOA 1NQ4A 2MY5A 3EJDA 2FVEA 2DNWA 1AF8A 1DNYA 2K2QA 2GDYA 2KR5A 5KP6B 2FQ2A 2FVAA 3EJEA 1HQBA 4H2YC 2JU1A 4BPFA 2KOOA 5KP8B 2VSQA 2KOPA 2XZ1C 3GZMA 4BPGA 2MF4A 2LIWA 2CGQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KOR A;  4CA3 A;  2M5R A;  1L0I A;  1KLP A;  4PWV B;  1VKU A;  2PNG A;  2LIU A;  2KGC A;  2KG8 A;  5CZD B;  4H2W C;  2JGP A;  2KGA A;  4DG9 A;  2MVV A;  2JQ4 A;  2GDX A;  2FAC A;  2L9F A;  1HY8 A;  2FQ0 A;  2LPK A;  2ROQ A;  2KG9 A;  2LOL A;  2KWL A;  2LKI A;  1X3O A;  2GDW A;  2L4B A;  2FVF A;  3CE7 A;  2N5H A;  1L0H A;  3LMO A;  2N5I A;  2CNR A;  1ACP A;  2K93 A;  2FQ1 A;  4PXH B;  2N50 A;  2CQ8 A;  2CG5 B;  2FHS C;  1T8K A;  2MR8 A;  5EJD A;  2KGE A;  2AF8 A;  2MR7 A;  2L22 A;  3EJB A;  2L0Q A;  1OR5 A;  2FAD A;  2KGD A;  4MRT C;  2AFD A;  2EHT A;  2AVA A;  2XZ0 D;  3RG2 A;  5HV8 A;  2KOQ A;  4HKG A;  2KG6 A;  2N6Y A;  2MD9 A;  2LTE A;  2QNW A;  5KP7 B;  5HVC A;  2LML A;  2K0X A;  4IZ6 A;  2KOS A;  2EHS A;  2JU2 A;  2AFE A;  2KW2 A;  4BPH A;  2LL8 A;  2K94 A;  3NY7 B;  4H2X C;  2FAE A;  2N6Z A;  2N98 A;  4R0M A;  2X2B A;  1DV5 A;  2K0Y A;  2MVU A;  2K92 A;  3GZL A;  1F80 D;  4NEO A;  1NQ4 A;  2MY5 A;  3EJD A;  2FVE A;  2DNW A;  1AF8 A;  1DNY A;  2K2Q A;  2GDY A;  2KR5 A;  5KP6 B;  2FQ2 A;  2FVA A;  3EJE A;  1HQB A;  4H2Y C;  2JU1 A;  4BPF A;  2KOO A;  5KP8 B;  2VSQ A;  2KOP A;  2XZ1 C;  3GZM A;  4BPG A;  2MF4 A;  2LIW A;  2CGQ A; 
#chains in the Genus database with same CATH topology
 2GZJ A;  2VLO A;  1A8O A;  1KLP A;  1UJZ A;  5DCK A;  1QRJ A;  4XRQ A;  1N8R Q;  4U0C A;  2GZG A;  1VQ6 P;  2KGA A;  3GJN A;  4QNB A;  2FAC A;  2CWO A;  4PH0 A;  1HY8 A;  2KG9 A;  1BAJ A;  1MZ8 A;  2N5H A;  1ACP A;  2CQ8 A;  3CPW O;  5EJD A;  2L0Q A;  1FR2 A;  2FAD A;  2PEI A;  3DS0 A;  5HV8 A;  1UNK A;  2KOQ A;  3B4Q A;  1AUM A;  1EOQ A;  1S72 P;  1E0H A;  5HVC A;  1YHQ P;  2KOS A;  1M90 Q;  1Q82 Q;  4COC A;  4BPH A;  4PH1 A;  2K94 A;  3NY7 B;  4QKO A;  2WPT A;  4F37 A;  3DTJ A;  3G6E P;  3CCV P;  2PEJ A;  2JO0 A;  3M1M A;  2JYG A;  2FVE A;  3CCJ P;  3G4S P;  2E1M A;  4U0B A;  2K2Q A;  1VQ4 P;  2XXM A;  4H2Y C;  2KOD A;  2OTL P;  1YIT P;  4COP A;  3DS3 A;  2PEK A;  1ZMB A;  4BPG A;  3DS1 A;  1VQ9 P;  2CGQ A;  1Q81 Q;  2M5R A;  4IPY A;  2PEM A;  1L0I A;  4PWV B;  2DGY A;  5CZD B;  1K8A Q;  1YJW P;  4DG9 A;  2JQ4 A;  5HGO A;  2GDX A;  2L9F A;  2ROQ A;  2LOL A;  5I4T G;  2KWL A;  2GDW A;  1GXG A;  2N5I A;  2K93 A;  3HYB A;  2FQ1 A;  4PXH B;  7CEI A;  2ONT A;  2CG5 B;  2FHS C;  1T8K A;  2XT1 A;  3I56 P;  3Q20 A;  2KGE A;  2AF8 A;  2P9X A;  4M0I A;  4MRT C;  3CCR P;  2AFD A;  3H0D A;  2JAZ A;  4U0F A;  1E6J P;  4U0D A;  4WYM A;  4HKG A;  1M74 A;  2N6Y A;  2OTJ P;  2QNW A;  5KP7 B;  1QVG O;  1RO0 A;  2K0X A;  5EW5 E;  3H47 A;  3DS2 A;  5BS1 A;  4H2X C;  2N98 A;  4R0M A;  2XV6 A;  2L6E A;  2K92 A;  1RO2 A;  4NEO A;  1D1D A;  1EMV A;  2BHV A;  1AF8 A;  1DNY A;  1VQ5 P;  1K9M Q;  3CCU P;  2K5X A;  5HGL A;  2VLP A;  2GZF A;  3CC2 P;  2KOP A;  1VQL P;  2MF4 A;  1VQK P;  2PY8 A;  4XFX A;  4CA3 A;  1VKU A;  1KQS O;  2PEN A;  2KGC A;  2KG8 A;  3DS5 A;  5BS2 A;  2JGP A;  4U0E A;  3CCQ P;  2MVV A;  1VQO P;  5F2K A;  3U43 A;  1EIA A;  4XFY A;  3NTE A;  3VRL C;  3CMA P;  2LKI A;  2NO8 A;  2M8L A;  2JB0 A;  1VQP P;  3CE7 A;  3LMO A;  3DS4 A;  1IMP A;  2OAR A;  2N50 A;  1KD1 Q;  3B5I A;  2GYK A;  3G71 P;  1K73 Q;  2QEX P;  2MR7 A;  2VLQ A;  2EHT A;  2AVA A;  3RG2 A;  3CCM P;  2KG6 A;  1NJI Q;  3CCS P;  2JBG A;  1Q86 Q;  5HGM A;  2JU2 A;  3MGE A;  1VQN P;  2AFE A;  1RNI A;  2M8P A;  1W2B O;  2KW2 A;  1VHN A;  2FAE A;  1BXI A;  3CC4 P;  2N6Z A;  2K0Y A;  1GXH A;  5HGN A;  5F2N A;  1F80 D;  2M8N A;  1NQ4 A;  3CXC O;  3EJD A;  1VQ8 P;  1A43 A;  5F2O A;  2DNW A;  1YJ9 P;  2Z44 A;  3DPH A;  2KR5 A;  3P05 A;  5KP6 B;  2FQ2 A;  3CCL P;  2FVA A;  1HQB A;  2JU1 A;  2EIA A;  1YIJ P;  2KOO A;  1CEI A;  2GZI A;  5KP8 B;  3G1G A;  1VQM P;  2GZE A;  2VSQ A;  4XFZ A;  1YJN P;  2XZ1 C;  2KOR A;  1IUQ A;  1KC8 Q;  1QVF O;  2Z46 A;  3H4E A;  3CME P;  1M6E X;  4U0A A;  2PNG A;  2EG5 A;  3OW2 O;  3G0V A;  2LIU A;  4H2W C;  3G26 A;  3E2D A;  2FQ0 A;  2LPK A;  2QA4 P;  1Q7Y Q;  1X3O A;  2L4B A;  3CCE P;  2FVF A;  4GR2 A;  1L0H A;  1M6N A;  2CNR A;  1JJ2 O;  2VLN A;  2JYL A;  2MR8 A;  3EJB A;  3RG6 C;  2L22 A;  1OR5 A;  2KGD A;  3HZQ A;  1YI2 P;  3I55 P;  2XZ0 D;  3CC7 P;  2LTE A;  2MD9 A;  3G28 A;  2Z45 A;  2LF4 A;  4GR6 A;  2BUO A;  2LML A;  1AYI A;  4IZ6 A;  2EHS A;  3G29 A;  3G1I A;  2ERH A;  2LL8 A;  2PEO A;  4UHP B;  1IMQ A;  1DV5 A;  2X2B A;  3G21 A;  1K30 A;  2MVU A;  3GZL A;  3WBH A;  1GPJ A;  2MY5 A;  4XRO A;  2PEQ A;  5JPA A;  1ZNV A;  1Z6M A;  2GDY A;  2LIW A;  3EJE A;  2K0D X;  2EFJ A;  4BPF A;  3CD6 P;  1VQ7 P;  3GKL C;  1M1K Q;  3GZM A;  3LRY A; 
#chains in the Genus database with same CATH homology
 2KOR A;  4CA3 A;  2M5R A;  1L0I A;  1KLP A;  4PWV B;  1VKU A;  2PNG A;  2LIU A;  2KGC A;  2KG8 A;  5CZD B;  4H2W C;  2JGP A;  2KGA A;  4DG9 A;  2MVV A;  2JQ4 A;  2GDX A;  2FAC A;  2L9F A;  1HY8 A;  2FQ0 A;  2LPK A;  2ROQ A;  2KG9 A;  2LOL A;  2KWL A;  2LKI A;  1X3O A;  2GDW A;  2L4B A;  2FVF A;  3CE7 A;  2N5H A;  1L0H A;  3LMO A;  2N5I A;  2CNR A;  1ACP A;  2K93 A;  2FQ1 A;  4PXH B;  2N50 A;  2CQ8 A;  2CG5 B;  2FHS C;  1T8K A;  2MR8 A;  5EJD A;  2KGE A;  2AF8 A;  2MR7 A;  2L22 A;  3EJB A;  2L0Q A;  1OR5 A;  2FAD A;  2KGD A;  4MRT C;  2AFD A;  2EHT A;  2AVA A;  2XZ0 D;  3RG2 A;  5HV8 A;  2KOQ A;  4HKG A;  2KG6 A;  2N6Y A;  2MD9 A;  2LTE A;  2QNW A;  5KP7 B;  5HVC A;  2LML A;  2K0X A;  4IZ6 A;  2KOS A;  2EHS A;  2JU2 A;  2AFE A;  2KW2 A;  4BPH A;  2LL8 A;  2K94 A;  3NY7 B;  4H2X C;  2FAE A;  2N6Z A;  2N98 A;  4R0M A;  2X2B A;  1DV5 A;  2K0Y A;  2MVU A;  2K92 A;  3GZL A;  1F80 D;  4NEO A;  1NQ4 A;  2MY5 A;  3EJD A;  2FVE A;  2DNW A;  1AF8 A;  1DNY A;  2K2Q A;  2GDY A;  2KR5 A;  5KP6 B;  2FQ2 A;  2FVA A;  3EJE A;  1HQB A;  4H2Y C;  2JU1 A;  4BPF A;  2KOO A;  5KP8 B;  2VSQ A;  2KOP A;  2XZ1 C;  3GZM A;  4BPG A;  2MF4 A;  2LIW A;  2CGQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...