4H2XC

Crystal structure of engineered bradyrhizobium japonicum glycine:[carrier protein] ligase complexed with carrier protein from agrobacterium tumefaciens and an analogue of glycyl adenylate
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
77
structure length
77
Chain Sequence
HMNATIREILAKFGQLPTPVDTIADEADLYAAGLSSFASVQLMLGIEEAFDIEFPDNLLNRKSFASIKAIEDTVKLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Amino acid--[acyl-carrier-protein] ligase 1
publication title Adaptation of aminoacyl-tRNA synthetase catalytic core to carrier protein aminoacylation.
pubmed doi rcsb
source organism Bradyrhizobium japonicum
molecule tags Ligase
total genus 23
structure length 77
sequence length 77
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 4h2xC00
3EJEA 2FADA 1OR5A 2QNWA 1ACPA 1X3OA 2FQ1A 2FVFA 2FVEA 2MF4A 2MY5A 4MRTC 3EJBA 1KLPA 1DV5A 2PNGA 1L0HA 2JU1A 5EJDA 2EHSA 2CQ8A 2N6ZA 4H2XC 2LPKA 2N50A 2LMLA 2LIUA 2KOQA 2VSQA 2N5HA 3GZLA 2CGQA 4DG9A 2KGAA 3CE7A 2KGEA 2LL8A 2LOLA 2LKIA 2CG5B 2KG8A 2KR5A 3GZMA 2FVAA 4PWVB 4H2YC 1L0IA 2K2QA 2N5IA 3NY7B 5HVCA 4IZ6A 2X2BA 2LIWA 1T8KA 1F80D 3RG2A 5CZDB 2DNWA 2KW2A 2EHTA 2MVVA 2CNRA 2L4BA 2L9FA 2GDYA 2JGPA 2MR8A 2K0YA 2XZ0D 1VKUA 2JQ4A 4H2WC 2M5RA 2L0QA 4BPFA 2KGDA 4R0MA 2FQ0A 2L22A 2GDWA 2GDXA 2K0XA 2ROQA 2FACA 2AFEA 2K94A 2K93A 3EJDA 1DNYA 2MR7A 2N98A 2JU2A 2KORA 2MVUA 4NEOA 5KP6B 2AVAA 2KOSA 5KP7B 2N6YA 4PXHB 2FAEA 2KG6A 2KWLA 2AFDA 2KGCA 2XZ1C 3LMOA 1AF8A 2KOPA 4BPGA 2KOOA 2AF8A 2LTEA 4HKGA 2K92A 1HQBA 1NQ4A 2MD9A 4BPHA 1HY8A 5HV8A 4CA3A 2FQ2A 2KG9A 5KP8B 2FHSC
chains in the Genus database with same CATH superfamily
2FADA 1OR5A 1RO0A 1ACPA 3CCSP 4UHPB 5BS1A 4PH1A 1KLPA 4IPYA 2L6EA 2PNGA 1L0HA 4U0AA 1CEIA 2EHSA 1GXGA 2M8NA 3I56P 2N50A 4PH0A 3CC4P 2KR5A 2FVAA 4PWVB 1L0IA 2K2QA 3I55P 4M0IA 1EMVA 2X2BA 5JPAA 3CCVP 3Q20A 1IMPA 5CZDB 1M6EX 1E0HA 1QRJA 2L9FA 2CNRA 2QEXP 2GDYA 2MR8A 3GKLC 2OTJP 2VLPA 1MZ8A 4XFZA 2GZGA 2M8LA 1M74A 3DS0A 4XRQA 1GPJA 2FQ0A 2GDWA 2GDXA 2K0XA 1E6JP 3DPHA 3EJDA 2N98A 2JU2A 4NEOA 3CPWO 2KOSA 4QNBA 5KP7B 2KGCA 3LMOA 3B4QA 3CMEP 2AF8A 1Q86Q 1JJ2O 1NJIQ 1UNKA 2K0DX 3CC7P 5HV8A 4CA3A 2FQ2A 4GR2A 3G6EP 1W2BO 5BS2A 2GYKA 2XXMA 1KQSO 2XV6A 5HGMA 3DTJA 1X3OA 2MF4A 1YJWP 3HYBA 4MRTC 3EJBA 3B5IA 4U0EA 5EJDA 4H2XC 2PENA 1BXIA 2BHVA 2EFJA 1EOQA 2N5HA 3P05A 3GZLA 2PEKA 3CE7A 3G26A 1UJZA 2CWOA 1M1KQ 2JYGA 2LKIA 3GZMA 1YJNP 5HVCA 4IZ6A 3CCLP 2EG5A 1A43A 2PEQA 1T8KA 3WBHA 5I4TG 2EHTA 2MVVA 2JO0A 2XZ0D 5F2OA 1Z6MA 4H2WC 1K9MQ 2Z45A 4XFXA 2L22A 1ZMBA 2E1MA 2FACA 2K94A 3CCUP 1YJ9P 4PXHB 2AFDA 1AF8A 3DS1A 2KOOA 2K92A 1YITP 4U0CA 3DS4A 3G28A 1KD1Q 2GZFA 4GR6A 2K5XA 1K30A 2OTLP 1VQ9P 1KC8Q 2OARA 2KODA 3H0DA 3EJEA 2QNWA 2FQ1A 2EIAA 2PEMA 3LRYA 2MY5A 2NO8A 1DV5A 1VQOP 2JU1A 1Q7YQ 4XROA 2N6ZA 1ZNVA 3CD6P 5HGNA 2LMLA 3U43A 1K8AQ 2LIUA 3CXCO 1IMQA 1FR2A 2CGQA 2KGAA 2LL8A 2LOLA 2KG8A 1YI2P 3G1IA 2VLQA 1RNIA 2JBGA 3E2DA 3NY7B 1GXHA 5DCKA 2PEOA 1VQNP 4U0BA 3CCRP 3RG2A 2VLOA 2DNWA 1D1DA 2KW2A 2BUOA 1YHQP 1VQ4P 1AUMA 1VQ6P 2M5RA 5F2NA 2L0QA 3CC2P 4BPFA 3OW2O 3DS5A 2ONTA 1N8RQ 2PY8A 2K93A 4WYMA 1M90Q 1QVFO 2MVUA 4U0DA 2AVAA 1K73Q 2KG6A 2KWLA 4COPA 3NTEA 4XFYA 2XZ1C 1VQKP 3G1GA 2KOPA 1HQBA 2PEJA 2GZIA 2MD9A 3CCEP 4BPHA 2Z46A 2KG9A 5KP8B 2FHSC 1YIJP 3CCQP 3VRLC 3H4EA 2FVFA 2FVEA 2Z44A 4U0FA 3DS3A 3GJNA 1QVGO 3G71P 1AYIA 2CQ8A 2PEIA 4QKOA 5HGOA 2LPKA 1VQMP 3G21A 2KOQA 2VSQA 7CEIA 3G0VA 3HZQA 4DG9A 2KGEA 2ERHA 1RO2A 2CG5B 2JYLA 4H2YC 2N5IA 2VLNA 1IUQA 1EIAA 2LIWA 1Q81Q 1A8OA 1F80D 2GZJA 3G4SP 2L4BA 2JGPA 1BAJA 2K0YA 1VKUA 2WPTA 2JQ4A 1VHNA 1VQLP 5EW5E 1M6NA 3H47A 3CCMP 4F37A 2KGDA 3CMAP 4R0MA 3M1MA 1VQPP 2ROQA 3DS2A 2AFEA 1S72P 1DNYA 2MR7A 2KORA 5KP6B 2JB0A 2N6YA 2DGYA 2FAEA 1VQ5P 1VQ8P 5HGLA 3RG6C 5F2KA 4BPGA 3CCJP 4HKGA 2LTEA 4COCA 3G29A 1NQ4A 2GZEA 1HY8A 2XT1A 2LF4A 1VQ7P 2M8PA 3MGEA 2JAZA 2P9XA 2QA4P 1Q82Q
chains in the Genus database with same CATH topology
3EJEA 2FADA 1OR5A 2QNWA 1ACPA 1X3OA 2FQ1A 2FVFA 2FVEA 2MF4A 2MY5A 4MRTC 3EJBA 1KLPA 1DV5A 2PNGA 1L0HA 2JU1A 5EJDA 2EHSA 2CQ8A 2N6ZA 4H2XC 2LPKA 2N50A 2LMLA 2LIUA 2KOQA 2VSQA 2N5HA 3GZLA 2CGQA 4DG9A 2KGAA 3CE7A 2KGEA 2LL8A 2LOLA 2LKIA 2CG5B 2KG8A 2KR5A 3GZMA 2FVAA 4PWVB 4H2YC 1L0IA 2K2QA 2N5IA 3NY7B 5HVCA 4IZ6A 2X2BA 2LIWA 1T8KA 1F80D 3RG2A 5CZDB 2DNWA 2KW2A 2EHTA 2MVVA 2CNRA 2L4BA 2L9FA 2GDYA 2JGPA 2MR8A 2K0YA 2XZ0D 1VKUA 2JQ4A 4H2WC 2M5RA 2L0QA 4BPFA 2KGDA 4R0MA 2FQ0A 2L22A 2GDWA 2GDXA 2K0XA 2ROQA 2FACA 2AFEA 2K94A 2K93A 3EJDA 1DNYA 2MR7A 2N98A 2JU2A 2KORA 2MVUA 4NEOA 5KP6B 2AVAA 2KOSA 5KP7B 2N6YA 4PXHB 2FAEA 2KG6A 2KWLA 2AFDA 2KGCA 2XZ1C 3LMOA 1AF8A 2KOPA 4BPGA 2KOOA 2AF8A 2LTEA 4HKGA 2K92A 1HQBA 1NQ4A 2MD9A 4BPHA 1HY8A 5HV8A 4CA3A 2FQ2A 2KG9A 5KP8B 2FHSC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EJE A;  2FAD A;  1OR5 A;  2QNW A;  1ACP A;  1X3O A;  2FQ1 A;  2FVF A;  2FVE A;  2MF4 A;  2MY5 A;  4MRT C;  3EJB A;  1KLP A;  1DV5 A;  2PNG A;  1L0H A;  2JU1 A;  5EJD A;  2EHS A;  2CQ8 A;  2N6Z A;  4H2X C;  2LPK A;  2N50 A;  2LML A;  2LIU A;  2KOQ A;  2VSQ A;  2N5H A;  3GZL A;  2CGQ A;  4DG9 A;  2KGA A;  3CE7 A;  2KGE A;  2LL8 A;  2LOL A;  2LKI A;  2CG5 B;  2KG8 A;  2KR5 A;  3GZM A;  2FVA A;  4PWV B;  4H2Y C;  1L0I A;  2K2Q A;  2N5I A;  3NY7 B;  5HVC A;  4IZ6 A;  2X2B A;  2LIW A;  1T8K A;  1F80 D;  3RG2 A;  5CZD B;  2DNW A;  2KW2 A;  2EHT A;  2MVV A;  2CNR A;  2L4B A;  2L9F A;  2GDY A;  2JGP A;  2MR8 A;  2K0Y A;  2XZ0 D;  1VKU A;  2JQ4 A;  4H2W C;  2M5R A;  2L0Q A;  4BPF A;  2KGD A;  4R0M A;  2FQ0 A;  2L22 A;  2GDW A;  2GDX A;  2K0X A;  2ROQ A;  2FAC A;  2AFE A;  2K94 A;  2K93 A;  3EJD A;  1DNY A;  2MR7 A;  2N98 A;  2JU2 A;  2KOR A;  2MVU A;  4NEO A;  5KP6 B;  2AVA A;  2KOS A;  5KP7 B;  2N6Y A;  4PXH B;  2FAE A;  2KG6 A;  2KWL A;  2AFD A;  2KGC A;  2XZ1 C;  3LMO A;  1AF8 A;  2KOP A;  4BPG A;  2KOO A;  2AF8 A;  2LTE A;  4HKG A;  2K92 A;  1HQB A;  1NQ4 A;  2MD9 A;  4BPH A;  1HY8 A;  5HV8 A;  4CA3 A;  2FQ2 A;  2KG9 A;  5KP8 B;  2FHS C; 
#chains in the Genus database with same CATH topology
 2FAD A;  1OR5 A;  1RO0 A;  1ACP A;  3CCS P;  4UHP B;  5BS1 A;  4PH1 A;  1KLP A;  4IPY A;  2L6E A;  2PNG A;  1L0H A;  4U0A A;  1CEI A;  2EHS A;  1GXG A;  2M8N A;  3I56 P;  2N50 A;  4PH0 A;  3CC4 P;  2KR5 A;  2FVA A;  4PWV B;  1L0I A;  2K2Q A;  3I55 P;  4M0I A;  1EMV A;  2X2B A;  5JPA A;  3CCV P;  3Q20 A;  1IMP A;  5CZD B;  1M6E X;  1E0H A;  1QRJ A;  2L9F A;  2CNR A;  2QEX P;  2GDY A;  2MR8 A;  3GKL C;  2OTJ P;  2VLP A;  1MZ8 A;  4XFZ A;  2GZG A;  2M8L A;  1M74 A;  3DS0 A;  4XRQ A;  1GPJ A;  2FQ0 A;  2GDW A;  2GDX A;  2K0X A;  1E6J P;  3DPH A;  3EJD A;  2N98 A;  2JU2 A;  4NEO A;  3CPW O;  2KOS A;  4QNB A;  5KP7 B;  2KGC A;  3LMO A;  3B4Q A;  3CME P;  2AF8 A;  1Q86 Q;  1JJ2 O;  1NJI Q;  1UNK A;  2K0D X;  3CC7 P;  5HV8 A;  4CA3 A;  2FQ2 A;  4GR2 A;  3G6E P;  1W2B O;  5BS2 A;  2GYK A;  2XXM A;  1KQS O;  2XV6 A;  5HGM A;  3DTJ A;  1X3O A;  2MF4 A;  1YJW P;  3HYB A;  4MRT C;  3EJB A;  3B5I A;  4U0E A;  5EJD A;  4H2X C;  2PEN A;  1BXI A;  2BHV A;  2EFJ A;  1EOQ A;  2N5H A;  3P05 A;  3GZL A;  2PEK A;  3CE7 A;  3G26 A;  1UJZ A;  2CWO A;  1M1K Q;  2JYG A;  2LKI A;  3GZM A;  1YJN P;  5HVC A;  4IZ6 A;  3CCL P;  2EG5 A;  1A43 A;  2PEQ A;  1T8K A;  3WBH A;  5I4T G;  2EHT A;  2MVV A;  2JO0 A;  2XZ0 D;  5F2O A;  1Z6M A;  4H2W C;  1K9M Q;  2Z45 A;  4XFX A;  2L22 A;  1ZMB A;  2E1M A;  2FAC A;  2K94 A;  3CCU P;  1YJ9 P;  4PXH B;  2AFD A;  1AF8 A;  3DS1 A;  2KOO A;  2K92 A;  1YIT P;  4U0C A;  3DS4 A;  3G28 A;  1KD1 Q;  2GZF A;  4GR6 A;  2K5X A;  1K30 A;  2OTL P;  1VQ9 P;  1KC8 Q;  2OAR A;  2KOD A;  3H0D A;  3EJE A;  2QNW A;  2FQ1 A;  2EIA A;  2PEM A;  3LRY A;  2MY5 A;  2NO8 A;  1DV5 A;  1VQO P;  2JU1 A;  1Q7Y Q;  4XRO A;  2N6Z A;  1ZNV A;  3CD6 P;  5HGN A;  2LML A;  3U43 A;  1K8A Q;  2LIU A;  3CXC O;  1IMQ A;  1FR2 A;  2CGQ A;  2KGA A;  2LL8 A;  2LOL A;  2KG8 A;  1YI2 P;  3G1I A;  2VLQ A;  1RNI A;  2JBG A;  3E2D A;  3NY7 B;  1GXH A;  5DCK A;  2PEO A;  1VQN P;  4U0B A;  3CCR P;  3RG2 A;  2VLO A;  2DNW A;  1D1D A;  2KW2 A;  2BUO A;  1YHQ P;  1VQ4 P;  1AUM A;  1VQ6 P;  2M5R A;  5F2N A;  2L0Q A;  3CC2 P;  4BPF A;  3OW2 O;  3DS5 A;  2ONT A;  1N8R Q;  2PY8 A;  2K93 A;  4WYM A;  1M90 Q;  1QVF O;  2MVU A;  4U0D A;  2AVA A;  1K73 Q;  2KG6 A;  2KWL A;  4COP A;  3NTE A;  4XFY A;  2XZ1 C;  1VQK P;  3G1G A;  2KOP A;  1HQB A;  2PEJ A;  2GZI A;  2MD9 A;  3CCE P;  4BPH A;  2Z46 A;  2KG9 A;  5KP8 B;  2FHS C;  1YIJ P;  3CCQ P;  3VRL C;  3H4E A;  2FVF A;  2FVE A;  2Z44 A;  4U0F A;  3DS3 A;  3GJN A;  1QVG O;  3G71 P;  1AYI A;  2CQ8 A;  2PEI A;  4QKO A;  5HGO A;  2LPK A;  1VQM P;  3G21 A;  2KOQ A;  2VSQ A;  7CEI A;  3G0V A;  3HZQ A;  4DG9 A;  2KGE A;  2ERH A;  1RO2 A;  2CG5 B;  2JYL A;  4H2Y C;  2N5I A;  2VLN A;  1IUQ A;  1EIA A;  2LIW A;  1Q81 Q;  1A8O A;  1F80 D;  2GZJ A;  3G4S P;  2L4B A;  2JGP A;  1BAJ A;  2K0Y A;  1VKU A;  2WPT A;  2JQ4 A;  1VHN A;  1VQL P;  5EW5 E;  1M6N A;  3H47 A;  3CCM P;  4F37 A;  2KGD A;  3CMA P;  4R0M A;  3M1M A;  1VQP P;  2ROQ A;  3DS2 A;  2AFE A;  1S72 P;  1DNY A;  2MR7 A;  2KOR A;  5KP6 B;  2JB0 A;  2N6Y A;  2DGY A;  2FAE A;  1VQ5 P;  1VQ8 P;  5HGL A;  3RG6 C;  5F2K A;  4BPG A;  3CCJ P;  4HKG A;  2LTE A;  4COC A;  3G29 A;  1NQ4 A;  2GZE A;  1HY8 A;  2XT1 A;  2LF4 A;  1VQ7 P;  2M8P A;  3MGE A;  2JAZ A;  2P9X A;  2QA4 P;  1Q82 Q; 
#chains in the Genus database with same CATH homology
 3EJE A;  2FAD A;  1OR5 A;  2QNW A;  1ACP A;  1X3O A;  2FQ1 A;  2FVF A;  2FVE A;  2MF4 A;  2MY5 A;  4MRT C;  3EJB A;  1KLP A;  1DV5 A;  2PNG A;  1L0H A;  2JU1 A;  5EJD A;  2EHS A;  2CQ8 A;  2N6Z A;  4H2X C;  2LPK A;  2N50 A;  2LML A;  2LIU A;  2KOQ A;  2VSQ A;  2N5H A;  3GZL A;  2CGQ A;  4DG9 A;  2KGA A;  3CE7 A;  2KGE A;  2LL8 A;  2LOL A;  2LKI A;  2CG5 B;  2KG8 A;  2KR5 A;  3GZM A;  2FVA A;  4PWV B;  4H2Y C;  1L0I A;  2K2Q A;  2N5I A;  3NY7 B;  5HVC A;  4IZ6 A;  2X2B A;  2LIW A;  1T8K A;  1F80 D;  3RG2 A;  5CZD B;  2DNW A;  2KW2 A;  2EHT A;  2MVV A;  2CNR A;  2L4B A;  2L9F A;  2GDY A;  2JGP A;  2MR8 A;  2K0Y A;  2XZ0 D;  1VKU A;  2JQ4 A;  4H2W C;  2M5R A;  2L0Q A;  4BPF A;  2KGD A;  4R0M A;  2FQ0 A;  2L22 A;  2GDW A;  2GDX A;  2K0X A;  2ROQ A;  2FAC A;  2AFE A;  2K94 A;  2K93 A;  3EJD A;  1DNY A;  2MR7 A;  2N98 A;  2JU2 A;  2KOR A;  2MVU A;  4NEO A;  5KP6 B;  2AVA A;  2KOS A;  5KP7 B;  2N6Y A;  4PXH B;  2FAE A;  2KG6 A;  2KWL A;  2AFD A;  2KGC A;  2XZ1 C;  3LMO A;  1AF8 A;  2KOP A;  4BPG A;  2KOO A;  2AF8 A;  2LTE A;  4HKG A;  2K92 A;  1HQB A;  1NQ4 A;  2MD9 A;  4BPH A;  1HY8 A;  5HV8 A;  4CA3 A;  2FQ2 A;  2KG9 A;  5KP8 B;  2FHS C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...