4F37A

Structure of the tethered n-terminus of alzheimer's disease a peptide
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
102
structure length
102
Chain Sequence
DAEFRHDSGYEVHHQKSELKNSISDYTEAEFVQLLKEIEKENVAATDDVLDVLLEHFVKITEHPDGTDLIYYPSDNRDDSPEGIVKEIKEWRAANGKPGFKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Colicin-E7 immunity protein
publication title Structural studies of the tethered N-terminus of the Alzheimer's disease amyloid-beta peptide.
pubmed doi rcsb
source organism Mus musculus
total genus 11
structure length 102
sequence length 102
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01320 Colicin_Pyocin Colicin immunity protein / pyocin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.20 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Colicin E immunity protein 4f37A00
2NO8A 2VLPA 4UHPB 2JBGA 2VLOA 2GZFA 2ERHA 5EW5E 2K5XA 3GKLC 3U43A 1IMQA 4QKOA 3GJNA 2GYKA 1BXIA 1UNKA 2GZEA 1E0HA 1FR2A 1MZ8A 7CEIA 2WPTA 1GXHA 2GZGA 1CEIA 1IMPA 1ZNVA 4F37A 2VLNA 2JB0A 1EMVA 1UJZA 2GZIA 2JAZA 1AYIA 2VLQA 2K0DX 2GZJA 1GXGA
chains in the Genus database with same CATH superfamily
2JU1A 1IUQA 3G29A 3B4QA 2MR7A 1K30A 4XFYA 5BS2A 1KC8Q 1AF8A 3HYBA 2K0XA 2GDYA 2FVAA 1IMPA 2QEXP 1KQSO 4U0DA 4BPFA 3CCEP 1N8RQ 3GZLA 1RNIA 2GZJA 2CWOA 5HV8A 3EJDA 4U0FA 5EJDA 1HQBA 3CCQP 2ROQA 1RO2A 3G4SP 2FAEA 2KGCA 2LF4A 5HGNA 1Q82Q 1VKUA 4U0BA 5KP7B 1VQ6P 1A43A 2NO8A 2VLPA 4U0EA 4BPHA 3G1GA 5F2NA 2OTJP 2K5XA 4M0IA 2MVUA 3DPHA 2K94A 4COCA 4PH0A 1T8KA 2JQ4A 2JGPA 3CD6P 3G0VA 1YJNP 2QA4P 2WPTA 4GR2A 2MR8A 1ZNVA 2JB0A 2LOLA 2PY8A 5HGLA 2M5RA 4COPA 2FADA 3M1MA 3E2DA 2KGEA 4UHPB 2N6ZA 2Z44A 1KD1Q 5HVCA 1K8AQ 2LPKA 3NY7B 3GKLC 2VSQA 1EOQA 2FVFA 3H47A 4U0AA 2ONTA 2K93A 1ACPA 2AF8A 2XT1A 2XZ1C 5HGMA 4HKGA 2XXMA 1RO0A 2FHSC 4NEOA 3CCJP 1DNYA 2QNWA 2PEMA 2KORA 5DCKA 1M90Q 3CCLP 2FQ2A 2AVAA 2GDWA 2M8NA 1Q7YQ 3DS5A 4QNBA 3H4EA 2N98A 1Q86Q 2FQ1A 2VLQA 3DTJA 3WBHA 2L6EA 1VQPP 4PWVB 3NTEA 4GR6A 3HZQA 1YITP 2GZEA 3G21A 2MD9A 1CEIA 3LMOA 1VQLP 2L0QA 3G1IA 2GZIA 2JO0A 3H0DA 2KODA 3I55P 2KR5A 1VQNP 3CC4P 3CMEP 5EW5E 3CCRP 3CCSP 1UNKA 1DV5A 2DGYA 2KG8A 7CEIA 1VQMP 2LL8A 2FACA 3DS4A 2EFJA 2LMLA 2JYLA 3CCUP 2CNRA 2M8PA 1D1DA 2PEOA 2GYKA 4XRQA 4IPYA 2MY5A 2Z46A 2KOOA 1FR2A 1K73Q 2CG5B 2N5HA 4DG9A 2K0YA 2KOQA 2XZ0D 3G26A 1BAJA 2JAZA 2K2QA 1A8OA 3DS1A 2AFEA 2E1MA 2VLOA 1Q81Q 1F80D 4XFXA 2OTLP 4H2XC 2LTEA 3CE7A 3CMAP 1K9MQ 5HGOA 1M74A 3DS2A 4MRTC 4H2WC 3RG2A 1VQ4P 2KW2A 2DNWA 2KG6A 1M6NA 3G71P 1QVGO 2KOPA 1YJWP 2PEIA 4H2YC 3GJNA 1VQ8P 2XV6A 1VHNA 1M6EX 1Z6MA 2PEKA 1VQOP 1M1KQ 4XROA 4XFZA 3CPWO 5KP8B 1VQ7P 2M8LA 1L0IA 3EJBA 2BHVA 5I4TG 2EHSA 2JYGA 3CC2P 3DS0A 2LKIA 3GZMA 1AUMA 1QVFO 2LIUA 4F37A 2VLNA 1L0HA 5KP6B 4R0MA 3MGEA 1NQ4A 5F2KA 2N50A 2KG9A 2EHTA 2ERHA 2GZFA 2MVVA 1ZMBA 1IMQA 1BXIA 1E6JP 2PNGA 2N6YA 2L22A 1GXHA 2KWLA 1EMVA 2OARA 4BPGA 3Q20A 3P05A 3CXCO 1EIAA 3U43A 5CZDB 3LRYA 1VQ5P 2GDXA 2P9XA 1AYIA 2AFDA 2EIAA 1HY8A 1GPJA 2K92A 2X2BA 1OR5A 2EG5A 2MF4A 4PXHB 2PEQA 1E0HA 1MZ8A 4CA3A 1QRJA 3VRLC 3OW2O 1KLPA 2N5IA 1NJIQ 4U0CA 2PEJA 3I56P 2KGDA 2L4BA 3G6EP 2L9FA 1S72P 2FVEA 2KOSA 1VQ9P 2CGQA 2CQ8A 4WYMA 2PENA 3B5IA 3G28A 2FQ0A 2JU2A 1YJ9P 2KGAA 1VQKP 4PH1A 2Z45A 1YHQP 1YI2P 1UJZA 5JPAA 2K0DX 3RG6C 2JBGA 2BUOA 3CCMP 2LIWA 5BS1A 4QKOA 1X3OA 5F2OA 2GZGA 4IZ6A 1YIJP 3DS3A 3CC7P 1W2BO 3CCVP 1JJ2O 3EJEA 1GXGA
chains in the Genus database with same CATH topology
2NO8A 2VLPA 4UHPB 2JBGA 2VLOA 2GZFA 2ERHA 5EW5E 2K5XA 3GKLC 3U43A 1IMQA 4QKOA 3GJNA 2GYKA 1BXIA 1UNKA 2GZEA 1E0HA 1FR2A 1MZ8A 7CEIA 2WPTA 1GXHA 2GZGA 1CEIA 1IMPA 1ZNVA 4F37A 2VLNA 2JB0A 1EMVA 1UJZA 2GZIA 2JAZA 1AYIA 2VLQA 2K0DX 2GZJA 1GXGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NO8 A;  2VLP A;  4UHP B;  2JBG A;  2VLO A;  2GZF A;  2ERH A;  5EW5 E;  2K5X A;  3GKL C;  3U43 A;  1IMQ A;  4QKO A;  3GJN A;  2GYK A;  1BXI A;  1UNK A;  2GZE A;  1E0H A;  1FR2 A;  1MZ8 A;  7CEI A;  2WPT A;  1GXH A;  2GZG A;  1CEI A;  1IMP A;  1ZNV A;  4F37 A;  2VLN A;  2JB0 A;  1EMV A;  1UJZ A;  2GZI A;  2JAZ A;  1AYI A;  2VLQ A;  2K0D X;  2GZJ A;  1GXG A; 
#chains in the Genus database with same CATH topology
 2JU1 A;  1IUQ A;  3G29 A;  3B4Q A;  2MR7 A;  1K30 A;  4XFY A;  5BS2 A;  1KC8 Q;  1AF8 A;  3HYB A;  2K0X A;  2GDY A;  2FVA A;  1IMP A;  2QEX P;  1KQS O;  4U0D A;  4BPF A;  3CCE P;  1N8R Q;  3GZL A;  1RNI A;  2GZJ A;  2CWO A;  5HV8 A;  3EJD A;  4U0F A;  5EJD A;  1HQB A;  3CCQ P;  2ROQ A;  1RO2 A;  3G4S P;  2FAE A;  2KGC A;  2LF4 A;  5HGN A;  1Q82 Q;  1VKU A;  4U0B A;  5KP7 B;  1VQ6 P;  1A43 A;  2NO8 A;  2VLP A;  4U0E A;  4BPH A;  3G1G A;  5F2N A;  2OTJ P;  2K5X A;  4M0I A;  2MVU A;  3DPH A;  2K94 A;  4COC A;  4PH0 A;  1T8K A;  2JQ4 A;  2JGP A;  3CD6 P;  3G0V A;  1YJN P;  2QA4 P;  2WPT A;  4GR2 A;  2MR8 A;  1ZNV A;  2JB0 A;  2LOL A;  2PY8 A;  5HGL A;  2M5R A;  4COP A;  2FAD A;  3M1M A;  3E2D A;  2KGE A;  4UHP B;  2N6Z A;  2Z44 A;  1KD1 Q;  5HVC A;  1K8A Q;  2LPK A;  3NY7 B;  3GKL C;  2VSQ A;  1EOQ A;  2FVF A;  3H47 A;  4U0A A;  2ONT A;  2K93 A;  1ACP A;  2AF8 A;  2XT1 A;  2XZ1 C;  5HGM A;  4HKG A;  2XXM A;  1RO0 A;  2FHS C;  4NEO A;  3CCJ P;  1DNY A;  2QNW A;  2PEM A;  2KOR A;  5DCK A;  1M90 Q;  3CCL P;  2FQ2 A;  2AVA A;  2GDW A;  2M8N A;  1Q7Y Q;  3DS5 A;  4QNB A;  3H4E A;  2N98 A;  1Q86 Q;  2FQ1 A;  2VLQ A;  3DTJ A;  3WBH A;  2L6E A;  1VQP P;  4PWV B;  3NTE A;  4GR6 A;  3HZQ A;  1YIT P;  2GZE A;  3G21 A;  2MD9 A;  1CEI A;  3LMO A;  1VQL P;  2L0Q A;  3G1I A;  2GZI A;  2JO0 A;  3H0D A;  2KOD A;  3I55 P;  2KR5 A;  1VQN P;  3CC4 P;  3CME P;  5EW5 E;  3CCR P;  3CCS P;  1UNK A;  1DV5 A;  2DGY A;  2KG8 A;  7CEI A;  1VQM P;  2LL8 A;  2FAC A;  3DS4 A;  2EFJ A;  2LML A;  2JYL A;  3CCU P;  2CNR A;  2M8P A;  1D1D A;  2PEO A;  2GYK A;  4XRQ A;  4IPY A;  2MY5 A;  2Z46 A;  2KOO A;  1FR2 A;  1K73 Q;  2CG5 B;  2N5H A;  4DG9 A;  2K0Y A;  2KOQ A;  2XZ0 D;  3G26 A;  1BAJ A;  2JAZ A;  2K2Q A;  1A8O A;  3DS1 A;  2AFE A;  2E1M A;  2VLO A;  1Q81 Q;  1F80 D;  4XFX A;  2OTL P;  4H2X C;  2LTE A;  3CE7 A;  3CMA P;  1K9M Q;  5HGO A;  1M74 A;  3DS2 A;  4MRT C;  4H2W C;  3RG2 A;  1VQ4 P;  2KW2 A;  2DNW A;  2KG6 A;  1M6N A;  3G71 P;  1QVG O;  2KOP A;  1YJW P;  2PEI A;  4H2Y C;  3GJN A;  1VQ8 P;  2XV6 A;  1VHN A;  1M6E X;  1Z6M A;  2PEK A;  1VQO P;  1M1K Q;  4XRO A;  4XFZ A;  3CPW O;  5KP8 B;  1VQ7 P;  2M8L A;  1L0I A;  3EJB A;  2BHV A;  5I4T G;  2EHS A;  2JYG A;  3CC2 P;  3DS0 A;  2LKI A;  3GZM A;  1AUM A;  1QVF O;  2LIU A;  4F37 A;  2VLN A;  1L0H A;  5KP6 B;  4R0M A;  3MGE A;  1NQ4 A;  5F2K A;  2N50 A;  2KG9 A;  2EHT A;  2ERH A;  2GZF A;  2MVV A;  1ZMB A;  1IMQ A;  1BXI A;  1E6J P;  2PNG A;  2N6Y A;  2L22 A;  1GXH A;  2KWL A;  1EMV A;  2OAR A;  4BPG A;  3Q20 A;  3P05 A;  3CXC O;  1EIA A;  3U43 A;  5CZD B;  3LRY A;  1VQ5 P;  2GDX A;  2P9X A;  1AYI A;  2AFD A;  2EIA A;  1HY8 A;  1GPJ A;  2K92 A;  2X2B A;  1OR5 A;  2EG5 A;  2MF4 A;  4PXH B;  2PEQ A;  1E0H A;  1MZ8 A;  4CA3 A;  1QRJ A;  3VRL C;  3OW2 O;  1KLP A;  2N5I A;  1NJI Q;  4U0C A;  2PEJ A;  3I56 P;  2KGD A;  2L4B A;  3G6E P;  2L9F A;  1S72 P;  2FVE A;  2KOS A;  1VQ9 P;  2CGQ A;  2CQ8 A;  4WYM A;  2PEN A;  3B5I A;  3G28 A;  2FQ0 A;  2JU2 A;  1YJ9 P;  2KGA A;  1VQK P;  4PH1 A;  2Z45 A;  1YHQ P;  1YI2 P;  1UJZ A;  5JPA A;  2K0D X;  3RG6 C;  2JBG A;  2BUO A;  3CCM P;  2LIW A;  5BS1 A;  4QKO A;  1X3O A;  5F2O A;  2GZG A;  4IZ6 A;  1YIJ P;  3DS3 A;  3CC7 P;  1W2B O;  3CCV P;  1JJ2 O;  3EJE A;  1GXG A; 
#chains in the Genus database with same CATH homology
 2NO8 A;  2VLP A;  4UHP B;  2JBG A;  2VLO A;  2GZF A;  2ERH A;  5EW5 E;  2K5X A;  3GKL C;  3U43 A;  1IMQ A;  4QKO A;  3GJN A;  2GYK A;  1BXI A;  1UNK A;  2GZE A;  1E0H A;  1FR2 A;  1MZ8 A;  7CEI A;  2WPT A;  1GXH A;  2GZG A;  1CEI A;  1IMP A;  1ZNV A;  4F37 A;  2VLN A;  2JB0 A;  1EMV A;  1UJZ A;  2GZI A;  2JAZ A;  1AYI A;  2VLQ A;  2K0D X;  2GZJ A;  1GXG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...