4F37A

Structure of the tethered n-terminus of alzheimer's disease a peptide
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
102
structure length
102
Chain Sequence
DAEFRHDSGYEVHHQKSELKNSISDYTEAEFVQLLKEIEKENVAATDDVLDVLLEHFVKITEHPDGTDLIYYPSDNRDDSPEGIVKEIKEWRAANGKPGFKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Colicin-E7 immunity protein
publication title Structural studies of the tethered N-terminus of the Alzheimer's disease amyloid-beta peptide.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 11
structure length 102
sequence length 102
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01320 Colicin_Pyocin Colicin immunity protein / pyocin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.20 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Colicin E immunity protein 4f37A00
2GZIA 2JB0A 1MZ8A 2VLNA 1ZNVA 4UHPB 1IMQA 3GKLC 2JAZA 2GZGA 1GXGA 3GJNA 1AYIA 2GYKA 1CEIA 2K0DX 1GXHA 1BXIA 1IMPA 1FR2A 2ERHA 2VLPA 2K5XA 7CEIA 2VLQA 1UJZA 1EMVA 2GZFA 5EW5E 1UNKA 2GZEA 2WPTA 3U43A 1E0HA 4F37A 2NO8A 4QKOA 2VLOA 2GZJA 2JBGA
chains in the Genus database with same CATH superfamily
2FACA 2GZIA 3DS5A 2MY5A 2VLNA 4IPYA 3G71P 4COPA 3GJNA 2FQ0A 3E2DA 4WYMA 3HZQA 2KOOA 1Q81Q 2CQ8A 4GR6A 3NY7B 4F37A 1A43A 2BHVA 2N6YA 2XT1A 3CE7A 1MZ8A 2M8LA 2MR8A 2N50A 1K8AQ 3DS2A 1DV5A 3GZMA 2KG9A 1EIAA 1VQ9P 1BXIA 3HYBA 1BAJA 2PEMA 2LTEA 1EMVA 1KLPA 2M8PA 4NEOA 1K30A 3RG6C 1K73Q 3EJEA 4XROA 2LF4A 2L9FA 2K0DX 5KP6B 2E1MA 1YJNP 3P05A 1T8KA 1UJZA 3G0VA 2ROQA 2L22A 3CC7P 1IUQA 4BPHA 4H2XC 2Z46A 2KR5A 2PEIA 2GDYA 4XRQA 1ACPA 2ONTA 2QNWA 1X3OA 1DNYA 3DS0A 3CXCO 3B4QA 3CCSP 1Q82Q 2N6ZA 1GXGA 1ZMBA 5HGLA 5F2NA 1D1DA 1W2BO 3CCVP 2EIAA 1QVFO 4U0AA 5EW5E 1M74A 4PH0A 4XFZA 2KW2A 2Z45A 3G6EP 2FADA 4U0DA 2BUOA 3CMAP 5HGMA 1IMQA 1QVGO 1EOQA 2XXMA 2PEQA 2GYKA 2CG5B 2N5HA 1YJWP 1Q86Q 1GXHA 2KORA 2XZ0D 2FQ1A 3G29A 2M5RA 2LMLA 2Z44A 2MVUA 3DS1A 3U43A 2KGEA 3CCRP 5F2KA 2AF8A 2KOPA 2CNRA 2KG6A 2MR7A 1L0IA 4U0EA 2N98A 2JO0A 2KGCA 4IZ6A 1Q7YQ 3CC4P 2LIWA 3RG2A 2XZ1C 3B5IA 3CCEP 3CCMP 3I55P 3G4SP 1KD1Q 2FAEA 4BPFA 4CA3A 2K94A 3CD6P 1M90Q 1YJ9P 1QRJA 2QA4P 2AVAA 3WBHA 1VQ8P 2FQ2A 2PEOA 2JYLA 1AUMA 2CWOA 3Q20A 2JU2A 2LPKA 1VQ7P 1NJIQ 4M0IA 2N5IA 5HGOA 2JB0A 5F2OA 4PH1A 3NTEA 5DCKA 2MVVA 2FVEA 4COCA 1M1KQ 2VLQA 2JQ4A 2GZFA 4MRTC 1M6NA 5CZDB 2GZEA 3LRYA 1YHQP 2L6EA 3CCLP 5HGNA 1VHNA 2JYGA 2JAZA 1YIJP 2GZGA 1KQSO 2MD9A 2JU1A 4PWVB 2KODA 2OARA 3H0DA 1VQOP 2M8NA 3CCQP 1Z6MA 4GR2A 2GDXA 3CCJP 4XFXA 1ZNVA 2LL8A 3EJBA 1AYIA 3G28A 1VQMP 2LOLA 2LIUA 5HV8A 4HKGA 2KOQA 2FHSC 2XV6A 2QEXP 2EFJA 2CGQA 3DTJA 4R0MA 2AFEA 3GKLC 2PENA 3G26A 4PXHB 1L0HA 1RNIA 2VSQA 1CEIA 3H4EA 5EJDA 1FR2A 1A8OA 3G1IA 2L4BA 3VRLC 3H47A 2P9XA 3OW2O 2EHTA 1VQ6P 2K92A 1HY8A 4UHPB 1VQ4P 3MGEA 2PY8A 2K0XA 4H2YC 1VQLP 2OTJP 2FVFA 2FVAA 3CCUP 2AFDA 1YITP 2K0YA 1KC8Q 3DS3A 5KP7B 1RO0A 4QKOA 4QNBA 2KGDA 2JGPA 1S72P 2K93A 2PNGA 5BS2A 1OR5A 4DG9A 1AF8A 2EHSA 7CEIA 2L0QA 2KG8A 3I56P 3DPHA 1HQBA 1UNKA 1JJ2O 2VLOA 2KOSA 1E0HA 4BPGA 1YI2P 1F80D 3DS4A 4U0CA 4U0BA 3G21A 1NQ4A 2LKIA 2VLPA 2ERHA 1E6JP 1VQPP 2EG5A 5JPAA 3CMEP 3G1GA 2MF4A 1VKUA 1RO2A 4H2WC 3EJDA 2WPTA 4XFYA 2KGAA 2X2BA 2GZJA 3LMOA 2OTLP 2PEJA 5BS1A 1K9MQ 1N8RQ 3GZLA 2DNWA 1GPJA 3CPWO 1M6EX 1VQKP 5I4TG 1VQNP 1VQ5P 1IMPA 2GDWA 2K5XA 4U0FA 2PEKA 3CC2P 2DGYA 3M1MA 5KP8B 2KWLA 2K2QA 2NO8A 5HVCA 2JBGA
chains in the Genus database with same CATH topology
2GZIA 2JB0A 1MZ8A 2VLNA 1ZNVA 4UHPB 1IMQA 3GKLC 2JAZA 2GZGA 1GXGA 3GJNA 1AYIA 2GYKA 1CEIA 2K0DX 1GXHA 1BXIA 1IMPA 1FR2A 2ERHA 2VLPA 2K5XA 7CEIA 2VLQA 1UJZA 1EMVA 2GZFA 5EW5E 1UNKA 2GZEA 2WPTA 3U43A 1E0HA 4F37A 2NO8A 4QKOA 2VLOA 2GZJA 2JBGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GZI A;  2JB0 A;  1MZ8 A;  2VLN A;  1ZNV A;  4UHP B;  1IMQ A;  3GKL C;  2JAZ A;  2GZG A;  1GXG A;  3GJN A;  1AYI A;  2GYK A;  1CEI A;  2K0D X;  1GXH A;  1BXI A;  1IMP A;  1FR2 A;  2ERH A;  2VLP A;  2K5X A;  7CEI A;  2VLQ A;  1UJZ A;  1EMV A;  2GZF A;  5EW5 E;  1UNK A;  2GZE A;  2WPT A;  3U43 A;  1E0H A;  4F37 A;  2NO8 A;  4QKO A;  2VLO A;  2GZJ A;  2JBG A; 
#chains in the Genus database with same CATH topology
 2FAC A;  2GZI A;  3DS5 A;  2MY5 A;  2VLN A;  4IPY A;  3G71 P;  4COP A;  3GJN A;  2FQ0 A;  3E2D A;  4WYM A;  3HZQ A;  2KOO A;  1Q81 Q;  2CQ8 A;  4GR6 A;  3NY7 B;  4F37 A;  1A43 A;  2BHV A;  2N6Y A;  2XT1 A;  3CE7 A;  1MZ8 A;  2M8L A;  2MR8 A;  2N50 A;  1K8A Q;  3DS2 A;  1DV5 A;  3GZM A;  2KG9 A;  1EIA A;  1VQ9 P;  1BXI A;  3HYB A;  1BAJ A;  2PEM A;  2LTE A;  1EMV A;  1KLP A;  2M8P A;  4NEO A;  1K30 A;  3RG6 C;  1K73 Q;  3EJE A;  4XRO A;  2LF4 A;  2L9F A;  2K0D X;  5KP6 B;  2E1M A;  1YJN P;  3P05 A;  1T8K A;  1UJZ A;  3G0V A;  2ROQ A;  2L22 A;  3CC7 P;  1IUQ A;  4BPH A;  4H2X C;  2Z46 A;  2KR5 A;  2PEI A;  2GDY A;  4XRQ A;  1ACP A;  2ONT A;  2QNW A;  1X3O A;  1DNY A;  3DS0 A;  3CXC O;  3B4Q A;  3CCS P;  1Q82 Q;  2N6Z A;  1GXG A;  1ZMB A;  5HGL A;  5F2N A;  1D1D A;  1W2B O;  3CCV P;  2EIA A;  1QVF O;  4U0A A;  5EW5 E;  1M74 A;  4PH0 A;  4XFZ A;  2KW2 A;  2Z45 A;  3G6E P;  2FAD A;  4U0D A;  2BUO A;  3CMA P;  5HGM A;  1IMQ A;  1QVG O;  1EOQ A;  2XXM A;  2PEQ A;  2GYK A;  2CG5 B;  2N5H A;  1YJW P;  1Q86 Q;  1GXH A;  2KOR A;  2XZ0 D;  2FQ1 A;  3G29 A;  2M5R A;  2LML A;  2Z44 A;  2MVU A;  3DS1 A;  3U43 A;  2KGE A;  3CCR P;  5F2K A;  2AF8 A;  2KOP A;  2CNR A;  2KG6 A;  2MR7 A;  1L0I A;  4U0E A;  2N98 A;  2JO0 A;  2KGC A;  4IZ6 A;  1Q7Y Q;  3CC4 P;  2LIW A;  3RG2 A;  2XZ1 C;  3B5I A;  3CCE P;  3CCM P;  3I55 P;  3G4S P;  1KD1 Q;  2FAE A;  4BPF A;  4CA3 A;  2K94 A;  3CD6 P;  1M90 Q;  1YJ9 P;  1QRJ A;  2QA4 P;  2AVA A;  3WBH A;  1VQ8 P;  2FQ2 A;  2PEO A;  2JYL A;  1AUM A;  2CWO A;  3Q20 A;  2JU2 A;  2LPK A;  1VQ7 P;  1NJI Q;  4M0I A;  2N5I A;  5HGO A;  2JB0 A;  5F2O A;  4PH1 A;  3NTE A;  5DCK A;  2MVV A;  2FVE A;  4COC A;  1M1K Q;  2VLQ A;  2JQ4 A;  2GZF A;  4MRT C;  1M6N A;  5CZD B;  2GZE A;  3LRY A;  1YHQ P;  2L6E A;  3CCL P;  5HGN A;  1VHN A;  2JYG A;  2JAZ A;  1YIJ P;  2GZG A;  1KQS O;  2MD9 A;  2JU1 A;  4PWV B;  2KOD A;  2OAR A;  3H0D A;  1VQO P;  2M8N A;  3CCQ P;  1Z6M A;  4GR2 A;  2GDX A;  3CCJ P;  4XFX A;  1ZNV A;  2LL8 A;  3EJB A;  1AYI A;  3G28 A;  1VQM P;  2LOL A;  2LIU A;  5HV8 A;  4HKG A;  2KOQ A;  2FHS C;  2XV6 A;  2QEX P;  2EFJ A;  2CGQ A;  3DTJ A;  4R0M A;  2AFE A;  3GKL C;  2PEN A;  3G26 A;  4PXH B;  1L0H A;  1RNI A;  2VSQ A;  1CEI A;  3H4E A;  5EJD A;  1FR2 A;  1A8O A;  3G1I A;  2L4B A;  3VRL C;  3H47 A;  2P9X A;  3OW2 O;  2EHT A;  1VQ6 P;  2K92 A;  1HY8 A;  4UHP B;  1VQ4 P;  3MGE A;  2PY8 A;  2K0X A;  4H2Y C;  1VQL P;  2OTJ P;  2FVF A;  2FVA A;  3CCU P;  2AFD A;  1YIT P;  2K0Y A;  1KC8 Q;  3DS3 A;  5KP7 B;  1RO0 A;  4QKO A;  4QNB A;  2KGD A;  2JGP A;  1S72 P;  2K93 A;  2PNG A;  5BS2 A;  1OR5 A;  4DG9 A;  1AF8 A;  2EHS A;  7CEI A;  2L0Q A;  2KG8 A;  3I56 P;  3DPH A;  1HQB A;  1UNK A;  1JJ2 O;  2VLO A;  2KOS A;  1E0H A;  4BPG A;  1YI2 P;  1F80 D;  3DS4 A;  4U0C A;  4U0B A;  3G21 A;  1NQ4 A;  2LKI A;  2VLP A;  2ERH A;  1E6J P;  1VQP P;  2EG5 A;  5JPA A;  3CME P;  3G1G A;  2MF4 A;  1VKU A;  1RO2 A;  4H2W C;  3EJD A;  2WPT A;  4XFY A;  2KGA A;  2X2B A;  2GZJ A;  3LMO A;  2OTL P;  2PEJ A;  5BS1 A;  1K9M Q;  1N8R Q;  3GZL A;  2DNW A;  1GPJ A;  3CPW O;  1M6E X;  1VQK P;  5I4T G;  1VQN P;  1VQ5 P;  1IMP A;  2GDW A;  2K5X A;  4U0F A;  2PEK A;  3CC2 P;  2DGY A;  3M1M A;  5KP8 B;  2KWL A;  2K2Q A;  2NO8 A;  5HVC A;  2JBG A; 
#chains in the Genus database with same CATH homology
 2GZI A;  2JB0 A;  1MZ8 A;  2VLN A;  1ZNV A;  4UHP B;  1IMQ A;  3GKL C;  2JAZ A;  2GZG A;  1GXG A;  3GJN A;  1AYI A;  2GYK A;  1CEI A;  2K0D X;  1GXH A;  1BXI A;  1IMP A;  1FR2 A;  2ERH A;  2VLP A;  2K5X A;  7CEI A;  2VLQ A;  1UJZ A;  1EMV A;  2GZF A;  5EW5 E;  1UNK A;  2GZE A;  2WPT A;  3U43 A;  1E0H A;  4F37 A;  2NO8 A;  4QKO A;  2VLO A;  2GZJ A;  2JBG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...