4F37A

Structure of the tethered n-terminus of alzheimer's disease a peptide
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
102
structure length
102
Chain Sequence
b'DAEFRHDSGYEVHHQKSELKNSISDYTEAEFVQLLKEIEKENVAATDDVLDVLLEHFVKITEHPDGTDLIYYPSDNRDDSPEGIVKEIKEWRAANGKPGFKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Colicin-E7 immunity protein
publication title Structural studies of the tethered N-terminus of the Alzheimer's disease amyloid-beta peptide.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 11
structure length 102
sequence length 102
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01320 Colicin_Pyocin Colicin immunity protein / pyocin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.20 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Colicin E immunity protein 4f37A00
1GXGA 3GJNA 2GZJA 5EW5E 2GZIA 1FR2A 2JAZA 1BXIA 2JBGA 4UHPB 2GZEA 2GYKA 2VLQA 1GXHA 3U43A 1UJZA 2JB0A 1EMVA 2K5XA 1IMPA 2VLPA 1AYIA 2K0DX 1UNKA 2VLOA 2GZFA 1E0HA 1MZ8A 1IMQA 1CEIA 1ZNVA 7CEIA 4QKOA 2VLNA 2WPTA 3GKLC 2ERHA 2GZGA 4F37A 2NO8A
chains in the Genus database with same CATH superfamily
1RNIA 4BPHA 2BHVA 2LL8A 1M90Q 4PH0A 2KORA 2QA4P 3GZLA 1KQSO 2CWOA 4QKOA 1Z6MA 3Q20A 2K93A 4XFXA 2EFJA 1VQ9P 1AUMA 2JYGA 4U0CA 2MR8A 2KG9A 4XFYA 2JGPA 3H4EA 4CA3A 1ZNVA 3EJEA 2Z45A 3CMEP 2KG6A 3P05A 2ERHA 1HY8A 2PEOA 1VQLP 2JBGA 1S72P 2FAEA 3DS0A 2VLQA 1IMPA 2VLPA 2JQ4A 2FQ2A 3M1MA 2GDYA 3CCEP 2K92A 2PENA 2MVUA 2L9FA 1Q86Q 1M1KQ 1NJIQ 1GPJA 2L4BA 1YITP 5BS1A 1BXIA 2KW2A 1N8RQ 2CNRA 1RO2A 1K73Q 3G0VA 4U0EA 2PEJA 3EJDA 2OTJP 2KWLA 1VQ7P 1MZ8A 2L6EA 2PEKA 4U0AA 3GKLC 4R0MA 2KG8A 5EW5E 1M6NA 2DNWA 1M74A 3E2DA 5HGMA 3RG2A 2AFEA 3I56P 3CMAP 4U0DA 1RO0A 1M6EX 2KGCA 1VQNP 2DGYA 3DPHA 2GZGA 1VQ5P 4IZ6A 1GXGA 2CQ8A 2LTEA 1Q82Q 2JO0A 5CZDB 3LRYA 2LKIA 2KOOA 3G1GA 2MY5A 2N5HA 1YI2P 1Q7YQ 2QNWA 5HV8A 4PH1A 1K8AQ 1NQ4A 2GDXA 3G71P 1Q81Q 2VLNA 2WPTA 2KOPA 3CCMP 3H47A 3CPWO 1IUQA 2FHSC 3VRLC 3OW2O 2N6ZA 5F2OA 3G21A 2EHTA 2EIAA 4GR2A 4COCA 1T8KA 5DCKA 4WYMA 2MR7A 2FVEA 1L0HA 3DS3A 2MVVA 2XZ0D 4U0FA 4IPYA 3CCQP 3G6EP 1KLPA 4PWVB 2N6YA 3I55P 5F2KA 2JB0A 2LF4A 2KODA 2OTLP 1E0HA 1E6JP 3CCRP 3CC2P 3EJBA 1VQ8P 4HKGA 1YJ9P 1VQPP 1A8OA 5HGOA 2KOSA 4H2YC 2FACA 3NY7B 1EMVA 4DG9A 2OARA 1AYIA 2GZFA 2Z46A 1QRJA 2K94A 3RG6C 5JPAA 2QEXP 2XXMA 2KR5A 3CCJP 2JYLA 2KGEA 3G28A 2XV6A 4BPGA 2K2QA 3B5IA 1W2BO 4H2WC 1JJ2O 3HYBA 1D1DA 2CGQA 4GR6A 2X2BA 3DS1A 2K0XA 2PEQA 3DTJA 4F37A 3DS4A 5KP6B 4COPA 5F2NA 2JAZA 3CC4P 4QNBA 2GYKA 2EG5A 3U43A 2N98A 3WBHA 1UNKA 3DS5A 1IMQA 3CE7A 2JU1A 3CD6P 7CEIA 2P9XA 3GZMA 5HGLA 2GZJA 2GZEA 1YJNP 1F80D 1YIJP 5EJDA 1AF8A 2FQ1A 1A43A 1DNYA 2JU2A 1QVGO 1X3OA 5KP7B 2PEMA 2M8LA 1YJWP 4M0IA 1ACPA 5BS2A 3DS2A 4NEOA 2PEIA 2M8NA 4MRTC 2VSQA 2MD9A 3CCLP 2FADA 2CG5B 1BAJA 2MF4A 4BPFA 4U0BA 2Z44A 3MGEA 1EOQA 1L0IA 2KGDA 2LPKA 2L22A 3B4QA 5KP8B 4H2XC 2LIUA 5HGNA 4XROA 1KD1Q 2N5IA 3CCVP 1QVFO 2E1MA 3CXCO 1VQ6P 2LIWA 1UJZA 2AVAA 3CCUP 2EHSA 1OR5A 5HVCA 3HZQA 1VKUA 3CCSP 2FVAA 1HQBA 2GDWA 3G4SP 2GZIA 3NTEA 3CC7P 4UHPB 3G1IA 2XZ1C 1K30A 2ONTA 2FQ0A 2M8PA 2XT1A 2KGAA 1KC8Q 2AF8A 1VQKP 2L0QA 2VLOA 1ZMBA 1CEIA 1YHQP 2PY8A 2BUOA 2LMLA 2N50A 4XFZA 3H0DA 2KOQA 2NO8A 3G26A 2PNGA 3GJNA 1FR2A 2M5RA 5I4TG 1VQOP 3LMOA 2LOLA 2K0YA 1VQMP 4PXHB 1GXHA 4XRQA 2K5XA 1EIAA 1DV5A 2K0DX 2AFDA 1VHNA 2FVFA 1K9MQ 1VQ4P 3G29A 2ROQA
chains in the Genus database with same CATH topology
1GXGA 3GJNA 2GZJA 5EW5E 2GZIA 1FR2A 2JAZA 1BXIA 2JBGA 4UHPB 2GZEA 2GYKA 2VLQA 1GXHA 3U43A 1UJZA 2JB0A 1EMVA 2K5XA 1IMPA 2VLPA 1AYIA 2K0DX 1UNKA 2VLOA 2GZFA 1E0HA 1MZ8A 1IMQA 1CEIA 1ZNVA 7CEIA 4QKOA 2VLNA 2WPTA 3GKLC 2ERHA 2GZGA 4F37A 2NO8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GXG A;  3GJN A;  2GZJ A;  5EW5 E;  2GZI A;  1FR2 A;  2JAZ A;  1BXI A;  2JBG A;  4UHP B;  2GZE A;  2GYK A;  2VLQ A;  1GXH A;  3U43 A;  1UJZ A;  2JB0 A;  1EMV A;  2K5X A;  1IMP A;  2VLP A;  1AYI A;  2K0D X;  1UNK A;  2VLO A;  2GZF A;  1E0H A;  1MZ8 A;  1IMQ A;  1CEI A;  1ZNV A;  7CEI A;  4QKO A;  2VLN A;  2WPT A;  3GKL C;  2ERH A;  2GZG A;  4F37 A;  2NO8 A; 
#chains in the Genus database with same CATH topology
 1RNI A;  4BPH A;  2BHV A;  2LL8 A;  1M90 Q;  4PH0 A;  2KOR A;  2QA4 P;  3GZL A;  1KQS O;  2CWO A;  4QKO A;  1Z6M A;  3Q20 A;  2K93 A;  4XFX A;  2EFJ A;  1VQ9 P;  1AUM A;  2JYG A;  4U0C A;  2MR8 A;  2KG9 A;  4XFY A;  2JGP A;  3H4E A;  4CA3 A;  1ZNV A;  3EJE A;  2Z45 A;  3CME P;  2KG6 A;  3P05 A;  2ERH A;  1HY8 A;  2PEO A;  1VQL P;  2JBG A;  1S72 P;  2FAE A;  3DS0 A;  2VLQ A;  1IMP A;  2VLP A;  2JQ4 A;  2FQ2 A;  3M1M A;  2GDY A;  3CCE P;  2K92 A;  2PEN A;  2MVU A;  2L9F A;  1Q86 Q;  1M1K Q;  1NJI Q;  1GPJ A;  2L4B A;  1YIT P;  5BS1 A;  1BXI A;  2KW2 A;  1N8R Q;  2CNR A;  1RO2 A;  1K73 Q;  3G0V A;  4U0E A;  2PEJ A;  3EJD A;  2OTJ P;  2KWL A;  1VQ7 P;  1MZ8 A;  2L6E A;  2PEK A;  4U0A A;  3GKL C;  4R0M A;  2KG8 A;  5EW5 E;  1M6N A;  2DNW A;  1M74 A;  3E2D A;  5HGM A;  3RG2 A;  2AFE A;  3I56 P;  3CMA P;  4U0D A;  1RO0 A;  1M6E X;  2KGC A;  1VQN P;  2DGY A;  3DPH A;  2GZG A;  1VQ5 P;  4IZ6 A;  1GXG A;  2CQ8 A;  2LTE A;  1Q82 Q;  2JO0 A;  5CZD B;  3LRY A;  2LKI A;  2KOO A;  3G1G A;  2MY5 A;  2N5H A;  1YI2 P;  1Q7Y Q;  2QNW A;  5HV8 A;  4PH1 A;  1K8A Q;  1NQ4 A;  2GDX A;  3G71 P;  1Q81 Q;  2VLN A;  2WPT A;  2KOP A;  3CCM P;  3H47 A;  3CPW O;  1IUQ A;  2FHS C;  3VRL C;  3OW2 O;  2N6Z A;  5F2O A;  3G21 A;  2EHT A;  2EIA A;  4GR2 A;  4COC A;  1T8K A;  5DCK A;  4WYM A;  2MR7 A;  2FVE A;  1L0H A;  3DS3 A;  2MVV A;  2XZ0 D;  4U0F A;  4IPY A;  3CCQ P;  3G6E P;  1KLP A;  4PWV B;  2N6Y A;  3I55 P;  5F2K A;  2JB0 A;  2LF4 A;  2KOD A;  2OTL P;  1E0H A;  1E6J P;  3CCR P;  3CC2 P;  3EJB A;  1VQ8 P;  4HKG A;  1YJ9 P;  1VQP P;  1A8O A;  5HGO A;  2KOS A;  4H2Y C;  2FAC A;  3NY7 B;  1EMV A;  4DG9 A;  2OAR A;  1AYI A;  2GZF A;  2Z46 A;  1QRJ A;  2K94 A;  3RG6 C;  5JPA A;  2QEX P;  2XXM A;  2KR5 A;  3CCJ P;  2JYL A;  2KGE A;  3G28 A;  2XV6 A;  4BPG A;  2K2Q A;  3B5I A;  1W2B O;  4H2W C;  1JJ2 O;  3HYB A;  1D1D A;  2CGQ A;  4GR6 A;  2X2B A;  3DS1 A;  2K0X A;  2PEQ A;  3DTJ A;  4F37 A;  3DS4 A;  5KP6 B;  4COP A;  5F2N A;  2JAZ A;  3CC4 P;  4QNB A;  2GYK A;  2EG5 A;  3U43 A;  2N98 A;  3WBH A;  1UNK A;  3DS5 A;  1IMQ A;  3CE7 A;  2JU1 A;  3CD6 P;  7CEI A;  2P9X A;  3GZM A;  5HGL A;  2GZJ A;  2GZE A;  1YJN P;  1F80 D;  1YIJ P;  5EJD A;  1AF8 A;  2FQ1 A;  1A43 A;  1DNY A;  2JU2 A;  1QVG O;  1X3O A;  5KP7 B;  2PEM A;  2M8L A;  1YJW P;  4M0I A;  1ACP A;  5BS2 A;  3DS2 A;  4NEO A;  2PEI A;  2M8N A;  4MRT C;  2VSQ A;  2MD9 A;  3CCL P;  2FAD A;  2CG5 B;  1BAJ A;  2MF4 A;  4BPF A;  4U0B A;  2Z44 A;  3MGE A;  1EOQ A;  1L0I A;  2KGD A;  2LPK A;  2L22 A;  3B4Q A;  5KP8 B;  4H2X C;  2LIU A;  5HGN A;  4XRO A;  1KD1 Q;  2N5I A;  3CCV P;  1QVF O;  2E1M A;  3CXC O;  1VQ6 P;  2LIW A;  1UJZ A;  2AVA A;  3CCU P;  2EHS A;  1OR5 A;  5HVC A;  3HZQ A;  1VKU A;  3CCS P;  2FVA A;  1HQB A;  2GDW A;  3G4S P;  2GZI A;  3NTE A;  3CC7 P;  4UHP B;  3G1I A;  2XZ1 C;  1K30 A;  2ONT A;  2FQ0 A;  2M8P A;  2XT1 A;  2KGA A;  1KC8 Q;  2AF8 A;  1VQK P;  2L0Q A;  2VLO A;  1ZMB A;  1CEI A;  1YHQ P;  2PY8 A;  2BUO A;  2LML A;  2N50 A;  4XFZ A;  3H0D A;  2KOQ A;  2NO8 A;  3G26 A;  2PNG A;  3GJN A;  1FR2 A;  2M5R A;  5I4T G;  1VQO P;  3LMO A;  2LOL A;  2K0Y A;  1VQM P;  4PXH B;  1GXH A;  4XRQ A;  2K5X A;  1EIA A;  1DV5 A;  2K0D X;  2AFD A;  1VHN A;  2FVF A;  1K9M Q;  1VQ4 P;  3G29 A;  2ROQ A; 
#chains in the Genus database with same CATH homology
 1GXG A;  3GJN A;  2GZJ A;  5EW5 E;  2GZI A;  1FR2 A;  2JAZ A;  1BXI A;  2JBG A;  4UHP B;  2GZE A;  2GYK A;  2VLQ A;  1GXH A;  3U43 A;  1UJZ A;  2JB0 A;  1EMV A;  2K5X A;  1IMP A;  2VLP A;  1AYI A;  2K0D X;  1UNK A;  2VLO A;  2GZF A;  1E0H A;  1MZ8 A;  1IMQ A;  1CEI A;  1ZNV A;  7CEI A;  4QKO A;  2VLN A;  2WPT A;  3GKL C;  2ERH A;  2GZG A;  4F37 A;  2NO8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...