3CC2P

The refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution with rrna sequence for the 23s rrna and genome-derived sequences for r-proteins
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
total genus 48
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2008-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3cc2P03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 3cc2P01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 3cc2P02
3G4SP 1N8RQ 3OW2O 3G6EP 1YIJP 1YJWP 1QVGO 3CCRP 3CC2P 3CCUP 1M90Q 3CD6P 3CCJP 3CPWO 3CXCO 1K73Q 1VQ9P 1YITP 1YJ9P 2OTJP 3CMEP 1S72P 3CMAP 2OTLP 3G71P 3CC7P 1YI2P 1Q82Q 1QVFO 1K8AQ 1Q86Q 1VQPP 1VQ7P 3CCQP 3CC4P 1M1KQ 3I55P 1KC8Q 1K9MQ 3I56P 1VQMP 1KD1Q 1VQ6P 1Q81Q 1VQNP 1Q7YQ 2QA4P 3CCLP 1VQ8P 3CCEP 1KQSO 1YHQP 3CCMP 1YJNP 1VQLP 1VQOP 1VQ5P 1W2BO 3CCSP 3CCVP 1NJIQ 1VQKP 2QEXP 1VQ4P 1JJ2O
chains in the Genus database with same CATH superfamily
2Q3IA 2GUSA 3RBXA 3DS3A 2FQ0A 3T97B 2BCCG 2KODA 1PPJG 1SQXD 3IR9A 2OYIA 1K05A 1DEBA 5KLVD 2KIKA 3RK2C 1Y9BA 1P84I 1PL5A 5F2NA 1L4AC 4DG9A 2DW3A 3WUTA 1PZQA 2BUOA 2K0XA 2PP6A 2KSJA 4U3FJ 1AFOA 1NTMK 3L72J 2W6JH 2Z44A 2XNXA 3LW5H 3KYQA 1OW8A 2V7QH 3BRVB 3DS1A 3AE5C 3KPEA 1L0ND 1GD2E 5TJHA 3CMAP 2P10A 1SQVK 4EYYQ 3C8VA 2QJKC 1PEOA 1OIPA 1RE4A 1CI6B 3FWNA 4IFFA 1N7LA 1PGOA 2KGEA 4ZNCA 4U0CA 4EIJA 2K0YA 1FZCC 1N7SC 2Y0DA 3D6YA 1NGMB 4PV1D 1QEXA 1AYIA 2MR7A 2LPKA 2ZXEB 3A5TA 1RE3A 3CX5E 1W2EA 2R5BA 2GYKA 2QEXP 2OGUA 1P84D 4MRTC 3H0DA 1QL2A 3JSVC 2GZJA 4OH8B 1JTHA 3GF3A 1OVVA 3H1JE 2FXOA 2QJPB 1D1DA 1N86A 2QJYC 2O01H 2Q1KA 2EIAA 1DX7A 4H13D 1DV5A 1BSHA 2RH0A 3FXDA 1UJZA 3RGUA 5KLVE 1D7MA 3MGEA 3TGUE 3I5CA 2FYUE 2IBZI 5KLVG 4H0LD 1X9VA 3U43A 4PV1C 3BCCE 1BCCJ 1N7SD 1K8AQ 2FYUD 1G2CA 4WY4D 2D2CC 1LP1B 2XU6A 1F80D 3VTPC 1M1JB 4IL6X 3BRTB 2YMYA 4KT0J 2XV5A 1NTMD 1LNQA 3RL0g 2A06E 4I1LA 1EQ7A 2Q6QA 3RBZA 4C7NB 2IDBA 2KOGA 2WSFH 3H1JJ 1JTHB 1RE3C 1AJYA 1PP9D 2IBZD 4XFXA 1Y8AA 1T3JA 2K9JA 1GU5A 1FZCA 2MY5A 3P8CD 2GA1A 2PEMA 1L0LE 1SQXK 1KQLA 3HUSB 2MF4A 1GXGA 1K30A 1PP9E 1YIJP 3AEBC 1SQVG 5HVCA 3FGAD 3B5NB 2JO1A 1RE4C 5TISH 3F89A 2P67A 4WY4B 3PLNA 2V7QJ 4GOFA 3PTZA 1JY3P 2M3EA 1ZXGA 3Q5PA 4Y99C 3MUDA 3L75J 4W80A 3G4SP 2XDJA 2CPSA 1SQXE 5APSA 3G3ZA 5AW5B 5JPAA 2PY8A 5AW2B 1OMIA 2IBZE 4H44D 3JCUH 3HTKA 1EOQA 3JCUE 4N78E 4UB6E 2KS1A 1YHQP 2J5UA 4XROA 1JY2P 2GZFA 4Y28J 2KXPB 4DJGA 1N73A 1OFCX 2M5RA 4RO0A 2WSFJ 3CXHH 1LJ2A 2M5AB 2H89C 1J2JB 3ZDMA 1NAFA 2A45I 1NTZJ 4W7YA 2PFXA 5BU8B 2I8DA 1NQ4A 4U0DA 1JM0A 1GW4A 2JGPA 1JJ2O 2IX7C 1IK7A 1FZCB 3ITKA 2PNGA 4ASVA 1NHLA 2JAZA 2AFDA 2OYIB 1VPCA 3RK3E 1ZV8A 2P1JA 1KYOE 3T97A 3U1AA 3CC4P 1FAVA 3L73J 2FVAA 3PJSK 3I55P 2Q7CA 1S9KD 1VF5C 3L73D 2OYIC 1M6EX 3B5ND 1HWTC 1G1JA 3KXDA 2FYNC 3P8CE 1WT6A 1BXIA 2BEZF 1GDTA 1YQ4C 3GKLC 2EHSA 1PGJA 3G71P 3TGUG 1QVFO 2PEIA 4GKGA 5CCGD 2OYHC 1SFCA 5CJ4A 2N98A 2VLPA 4ZMDA 2B89A 4RKUJ 3KZIH 5AW8B 1SQBE 1EZVD 2OYHB 2D2CB 1T2KC 1M1JC 1S9KE 3BCCJ 1VQPP 1NOHA 3O6QB 3H1LJ 4D6TE 1FZAA 4Z1MH 1GL2D 3TF5A 2WSCJ 1OW6A 4H0LB 1NTKG 3MGNA 5KTBA 1GZLA 3H1LG 4I7ZC 3TDKA 1CW5A 3NFQA 4HKGA 3FX0A 2FQ1A 3L70G 4K35A 1LWUA 1NTKJ 4LGDE 1ACPA 5CCHA 2WMMA 5AW6B 1AF8A 3KQGA 1X8YA 3M9QA 2Z46A 2ZFCA 3DS2A 4JYCA 2OTLP 1RO0A 1BSNA 1IFIA 3M06A 4Y99B 1SQQD 2CK3H 4BWNA 2WTYA 1AQ5A 2KGAA 4MN4C 1RO2A 1ZMBA 2CPBA 4D6TJ 2KW2A 3U1CA 3CC2P 1DD3A 4OGQC 4L75A 2XZ0D 2LIUA 1J1EB 2WPQA 2W6BA 3HE4A 5KAIH 2CGQA 1PEMA 4GIFA 5APVA 3E7KA 2FVFA 3AECC 4PWVB 2FACA 3H1JD 5AW0B 1S5LE 2N5HA 4QKOA 3B4QA 2ZVNB 1PEUA 4DCKA 1T2KD 4IPYA 3HE4B 3TNUA 3QH9A 2KOQA 1SQQE 2R44A 5APQA 1SQVE 1NH4A 5AVRB 1DIPA 2PENA 2J58A 3VRLC 3KHUA 4HJGH 5KJ7C 3TYYA 4GODA 3G29A 3L72D 1E79H 1HQBA 4QNBA 1HBWA 1UNKA 1IK9A 1HTLC 1L4AB 2Z5HA 3A7OA 3GHGA 3A0HE 2QE7H 2ERHA 3F5HA 3I56P 4H2WC 3A0HH 4I2LC 3DS0A 1L0NJ 1NKNA 2LMLA 1BE3G 4L76A 3L71J 1J1DC 1YJWP 3WMM0 1M57D 2JU1A 5BS2A 2QG4A 1KFNA 1NU1J 3H32B 2KOOA 3L70J 2MVVA 2L5GB 3FXEA 1NTMG 2QNWA 4AQRD 1FJKA 3L74G 5HGNA 3H1IJ 3M1MA 4DT0A 1DEEG 1KZUB 5AVQB 1H89A 3AE2C 3KDPB 1X3OA 2E75D 2ZT9C 1NTZD 2W90A 2FY8A 2Z5IA 2MKVA 2WPRA 4WY4A 3GZMA 3VYIA 2WPTA 2WITA 3CL3D 5CHXA 3UIAA 3OJAB 3HTKB 3NXSA 3BCCG 4LC1A 2ZYGA 5KKZB 1URQC 4H0LC 3Q2YA 3LIDA 1EDKA 2R3CA 2K9JB 3AE1C 1N8RQ 2MJZA 4C46A 1JY2O 1URQB 3CXHI 1R8EA 1BCCG 2FYZA 2FYNB 2N1TA 5AVTB 2FFDB 3RK3D 1PIXA 2Y0CA 4HYTB 1MKMA 2C9LY 1VL2A 2H88C 2EFJA 4BXLA 3RG6C 3S9OA 1EXJA 4BPGA 3P8MC 1LT9C 2E76B 2M3BA 1JY3O 1FU1A 2AXTH 1OWAA 1GMJA 3B71A 5AW3B 5HGLA 1FE6A 1ZNVA 2E74D 3TGUJ 2CNRA 2SPZA 3TGUD 2LXBA 1KB9D 4F37A 2AEMA 2YXQB 1KD1Q 1SQPE 3MHVA 4WY4C 1KTMA 2K1AA 2Y0EA 1OZHA 3L71G 3L35A 1ZRTD 1G1IA 3LMOA 1FZFA 1GPJA 3P32A 1YI2P 1NTME 1NTKD 3Q5SA 3A2AA 3N4XA 1RF1A 1LTJC 1SQBD 1EZVE 4CA3A 2ZYDA 1IJDB 2K3RA 4I6MC 1IO4A 1VKUA 4XFYA 2LL8A 4C7RA 1JCDA 3E1IA 3VMAA 2HG5D 4U3FG 2RN0A 4LLHA 2CWOA 5AVZB 1KB9I 5APUA 1EC5A 2BQ1E 2BASA 2BCCE 1PV3A 3WBHA 3L74E 1BCCD 5H2FH 2FYUG 1PGPA 3EFFK 3WUUA 1YTZT 2KR5A 3L73E 2KOSA 3BASA 4BPHA 1NU1E 1SFCC 5AVSB 3CX5I 2VLQA 2E75C 2OYHA 4H2XC 1HH0A 3H1IG 1SQQG 3QWOC 4WYMA 2ZVOB 1HUCA 1SQXJ 2NPSC 3GHGC 2W6AA 2IYPA 2AVAA 2RKLA 2L4BA 1NKZB 2PGDA 4IFDK 1PPJD 1QRJA 1XTGB 2GUVA 3G26A 2K92A 1QLED 3MIWA 4U3FD 1X22A 2WT7A 5F2KA 1RF0C 1Y47A 1OVRA 1NTZE 1VQLP 2WSSH 3D6ZA 1KFMA 1NYHA 1SLQA 4GDOA 3PH0A 1SVFA 1YQ3C 1LTBC 1HF9A 2YNYA 1YJ9P 3CMEP 2Y9YA 1VF5B 2QM8A 2KOPA 2L9FA 1MFZA 1IFMA 2LIWA 1QX8A 2WSCH 2NZ2A 4A7PA 3IFMA 1BDCA 1FDIA 2YXRB 3SSUA 1M8OB 2WPVB 3RL0B 1KORA 2WSEJ 5B5EE 3CD6P 1KB9H 2OYOA 4L74A 3SWYA 2HYNA 4BRYA 5B5EH 3H6PA 5E79E 3GJNA 3H4EA 1YBKA 4IOIH 2E1MA 2WQYC 3TK1A 1UIXA 2BHVA 2J59M 1JY3N 3HD7A 3V6IA 1H0TA 4O9BA 3MUDC 1X79B 3H1KE 4H44B 2HFED 1USDA 2HPCA 5KLVJ 2FHSC 2LF4A 2QJYB 3V2PA 2O01J 1BDDA 2N9BA 1PP9G 4CPGA 3OW2O 3G6EP 3B5NC 2ITAA 3R2PA 1M90Q 1L0LG 1YITP 2OTJP 1JY2N 3KZIE 3AE4C 2ZAEB 3D70A 2PAJA 2YIUB 1MUUA 2Z45A 1A02J 3IF4A 1AVOA 2YKQA 1IMQA 5DJUB 2LTEA 3AE9C 5B66H 3NMDA 2IYOA 3L4FA 1VHNA 2GDYA 1OVUA 3H1HJ 2I1KA 4R4MA 2PEKA 3PRJA 5APXA 4ZKPA 1KC8Q 3L73G 3VMYA 2LKIA 3DS5A 1IZNB 1FC2C 2JQ4A 1LT1A 1NWQA 1PFIA 5GTIH 5AVYB 1LTIC 1BE3J 2FVEA 1FJPA 3A3YB 5AW7B 5GTIE 1R5SA 5CCGC 2ONTA 1NAYA 2HPCB 1U7MA 1FBMA 2XNDH 3II6A 1SP4A 3CLQA 1ZR2A 2GM4A 2FYUK 1KILD 1JMMA 1EZVI 2K2QA 5GTHE 4XRQA 2IBZG 2YKOA 1K9MQ 1OX3A 3VMZA 1RF1B 4WWIA 2IZ0A 2YO3A 3Q3DA 3IAOA 3CCJP 2KYVA 2ZJSE 3C1LA 1S5LH 1P84E 2HR3A 3CCQP 1K04A 2E74C 3HUSA 2QA4P 2AXTE 3A0BH 2JB0A 2KUBA 3CCSP 2A45H 1NTKK 3L75E 4HH2A 3MP7B 2C0WA 2E74B 2D2CD 4JF7A 3W67A 1IFPA 2LXCB 4YXDC 4WVZA 2M0BA 2WSEH 1M1KQ 1ZLLA 2Q3EA 1VQ6P 1JCCA 3FWLA 1FDMA 2L91A 2QIWA 1VQ5P 4UHPB 1LWUB 2M8LA 5CJ0A 4H13C 2M8RA 3H1HE 5KKZC 3V2NA 2RMZA 3S1KA 4N3YB 4DOJA 3H1IE 5KLIC 3CX5H 4JPZB 3VOPA 4YTPC 1CSBA 3G28A 1L0NK 3HZQA 1PPJE 1GTWA 1M7LA 3Q1MA 3L75D 3D71A 4EDFA 3VP9A 2FFDA 3R4YA 2N1TB 2K37A 2XZRA 2CG5B 2AXCA 4HB1A 2LR2A 4KJMA 2E5TA 3LIEA 2A06G 5AVVB 4C7NA 1BGYG 2EHTA 1BE3E 1SQPG 4EOTA 2JKVA 2N50A 3VP8A 1FS0E 2XV6A 1S4XA 3SFDC 1LT9B 2E76C 3DPHA 1LTSC 3H1ID 4YXWH 3GMAA 1A43A 1MZ8A 1SQVJ 2VRSA 2MD9A 5HGOA 3Q5RA 2KLVA 5BU5A 3G0VA 2WWWA 1HY8A 2KG8A 4U0FA 1L0IA 2KWLA 2FXPA 2ZXXA 1N7SA 4TLFA 4N6JA 4NPEA 1KILB 3CWBE 1KILE 2FBWC 3H1JG 1N73C 1RY3A 2M8PA 4PJ0H 3HUSC 3AEGC 1FR2A 1CEIA 2NRGA 1L0NE 5AW4B 4GR2A 5M1BA 2YIUC 3Q20A 1VDFA 2JO0A 3V2QA 1K73Q 1AQTA 1LTTC 4D6TD 2N6ZA 2QVAA 2BEQD 1J1EC 1L0NG 1VQMP 3EJDA 4PH0A 1OXZA 4XE5B 1FDOA 2K93A 1FZGA 1QL1A 2FADA 1NTMJ 2PRRA 2Q9IA 3O6QA 2DGYA 2FXMA 3TSIA 1PP9J 2GZEA 2VSQA 2HLOA 1U57A 2ZT9D 3H32A 3CXHD 3EJEA 1KMIZ 5DCKA 3BCCD 3H1LD 1DD4A 2E42A 3CXHE 3G1GA 5AW9B 1IUQA 2KP8A 2KNCB 4COCA 1HGZA 1JEKA 3CI9A 3BATA 1S2EA 5CCGA 1JO5A 2N5IA 1L4AA 2K94A 1RQUA 1ZW0A 2GZIA 2H43A 4IL6E 1GK4A 1BGYE 1KYOD 2IPPA 1VQ9P 1S5LX 3AEFC 3VMXA 3GF7A 3M0AA 2FFDC 3L70E 2H8PD 2K88A 2O01N 4XFZA 2WPSA 1XTCC 5H2FE 3G1IA 2N9YB 1NU1G 3L70D 1NO4A 5KJ7D 3H1KD 3L37A 3RK2D 1NTKE 5AVXB 4PV1B 1SQVD 2FYUJ 3H1KJ 2KZIA 4IL6H 1GL2C 1M74A 3CWBJ 1RHZB 1LP1A 3M0DC 2JYGA 3RL0D 3CWBD 4M3LA 3EWKA 1GU4A 2H7HA 2FKWB 2MVUA 1GL2B 5GTHH 1SQPJ 5C39A 2DNWA 4RJTA 1BGYJ 1ZN5A 4R0MA 1H8AA 1BAJA 2JR8A 4U0EA 2N1TD 3N7NA 2B9BA 5L8RJ 1IMPA 1EZVG 3L75G 1HGVA 4XFJA 4OGQD 4RESB 3CC7P 4UB8E 1FZBA 5APTA 5DJTB 1Q7YQ 3S4RA 3P05A 2K0DX 3JC22 2VLNA 1UIIA 5B66E 3EQ2A 5KP7B 1EDLA 2KGDA 4AUWA 3HYBA 4H2YC 5KLVK 3C9IA 1QVGO 3CCUP 4JQ0D 1T3UA 2Q5UA 1MFTA 3EFGA 2KG6A 3V2RA 5BVZA 2EG5A 1RNIA 5CZDB 5I4TG 2P58A 4B86A 4EI2A 1P84H 5APWA 3CCEP 1RQVA 3SWFA 4PH1A 1EDJA 3P7KA 5KP6B 1NU1D 3M9BA 1A02F 2JEEA 3MD0A 1USEA 1RF0A 3U59A 2ROQA 1Z56A 1OR5A 1WMKA 3L36A 3G21A 4D6TG 3VN0A 1HVVA 4OWFA 1W2BO 3MZWB 2JDIH 4R4LA 3AEDC 3EJBA 2GZGA 2OTKE 1IC2A 1FOSE 3NTNA 3GLMA 1LTAC 1N73B 1E5WA 2A06D 1Q82Q 2XXMA 1HJBA 2NPSB 2L0QA 3PHLA 5TISE 1M6NA 2WZ7A 1JUNA 3E2DA 2KB7P 2NPSA 1Q2NA 1H88A 2LOLA 1J1DB 5CBOA 1IFDA 1KN7A 3WUVA 3OAKA 1SQBG 1VF5D 1JB0J 1L0LK 1LTGC 5F2OA 3CCRP 3B5NA 5EJDA 4XA4A 3HE5B 2O1JA 1DNYA 3DS4A 4GR6A 3AE7C 2JYLA 1SQPD 2ZT9B 1AA0A 1ZMEC 1SFCB 2YMKA 3MTUE 1Q81Q 2W8ZA 4OVNF 3G9RA 1KQSO 4ASWA 3AE3C 5KAFE 3SWKA 2E76D 2GDWA 3HD7C 2R32A 2JWAA 1SFCD 3GHGB 4K3AA 1NVOA 1KQFB 1IFJA 2BCCJ 3V4WA 1E6JP 3NY7B 3L74J 1GK6A 4KHXA 1LTJA 3AEAC 3RG2A 2N6YA 3BVHA 1VQ8P 2AEJA 1YJNP 1EMVA 5KLIB 3WU2E 2QJPC 4M0IA 1N7SB 2PEQA 1BE3D 1EDIA 1PEQA 4H44C 1NTZK 1M56D 3GG2A 3RK3C 1IFNA 1R5LA 1JNMA 3L71E 3LW5J 1MZ9A 3M91A 1Z6MA 3B5IA 4BRYB 2JP3A 2MR8A 2K9YA 4H13B 1MV8A 1N2DC 3GW6A 1ZR4A 2P9XA 1KLPA 1VQ4P 3SFEC 2ZYAA 3V5BA 1G2CB 1U7JA 5CCHD 3CWBG 5APYA 3A0BE 2KORA 3DTJA 1A8OA 3HD7D 3AE6C 4NPDA 2KK7A 2WT7B 3B4SA 3HRNA 5HGMA 1SQBK 5AVWB 2GDXA 1BGYD 1URQA 4U0AA 5AVUB 3K5BA 5BS1A 2KZJA 4PD4D 3CCLP 1AUMA 2OARA 1EIAA 2QSIA 3H25A 1KB9E 4N78D 2JBGA 1BCCE 4IFMA 2G3AA 2G8YA 5CCHC 1YTZI 1KILC 1L2PA 4COPA 5EFWB 4GT1A 4DZOA 1KYOH 2PEOA 2KNCA 5HV8A 3H47A 4PXHB 2X2BA 2POHA 1GXHA 2KSEA 2E43A 3H1HG 2FQ2A 1LTJB 2AFEA 2V4HA 2E5YA 2C9NY 4OGQB 4GOEA 1RF1C 1SQQK 3H1HD 2YKPA 1KILA 4U0BA 1URQD 1KV4A 4U7JA 2FAEA 4NPFX 1ZP0C 1GL2A 4ZKUA 2I1JA 3CXCO 4YPCA 2BCCD 3WU2H 4TT3H 2L6EA 1ZOYC 3OA7A 1S3JA 2IZ1A 1E0HA 5KJ7A 1Q90D 4WBAA 4PJ0E 2UWJE 3HD7B 2HODA 3HE5A 3RK2B 1CZQA 2E75B 3O8ZA 2PEJA 4BPFA 5KAFH 5K5GB 1T8ZA 2IFNA 2M8NA 4W7ZA 2P7JA 3M9HA 1VQ7P 5AW1B 2QRXA 2LKMA 2R5DA 1SQBJ 4JBZA 1DH3A 2XZ1C 4IZ6A 1LGHB 1LT9A 1VQOP 2KG9A 4NEOA 2AF8A 1KYOI 1S72P 1W5CE 3PP5A 1Q86Q 2R3SA 1ZRTE 5CBNA 1JMBA 1L4AD 2N1TC 3CCMP 5E79H 2QJKB 2JJLA 1FOSF 5CMZA 2HODB 1SQPK 2KS1B 2WVRA 4PD4H 2NO8A 1RH5B 2L22A 4PD4E 1GW3A 2B87B 3CE7A 3LRYA 4HKZH 3RL0C 2XT1A 1JOCA 1L0LD 1HJ0A 1NTZG 1FZEA 1L0LJ 2C0XA 3W68A 1KQGB 1QGKB 2O3JA 4AYCA 1NJIQ 5EW5E 1SQXG 2W27A 2CQ8A 3IN6A 2Z4EA 3GZLA 2O1KA 2B87A 3L74D 3CPWO 2XKMA 2A45G 1LWUC 1EXIA 1H0TB 2K5XA 2YO2A 3AEEC 3RK3B 1L0HA 2M5AA 3M0DA 1AVYA 4I7ZB 3ABVC 3E1RA 4QMAA 3V4QA 1CI6A 3B8EB 4L73A 2Y9ZA 2P2UA 3CX5D 3H1LE 3TNUB 2QM7A 1PGQA 2OQQA 2AEFA 3L72G 3AE8C 3L71D 1T6AA 1S1CX 2JU2A 1YYCA 5KAIE 2KGCA 4JYBA 2B88A 1TU3F 2KLUA 1M1JA 4U3FE 1VQKP 3H1KG 1SQQJ 3NTEA 2NPSD 2KI7B 2VLOA 1OW7A 2W83C 3USSA 3L72E 1NU1K 4PD4I 1SS1A 4UB6H 1AV1A 2IFMA 2JWDA 1X0TA 4UB8H 1T8KA 1VQNP 7CEIA 1WRGA 5KP8B 3CCVP 4WB4A
chains in the Genus database with same CATH topology
3G4SP 1N8RQ 3H0DA 4XFYA 2M8LA 1PEQA 1PEUA 2JO0A 3CD6P 4IPYA 1K73Q 1M74A 2PY8A 5JPAA 3DS3A 2KODA 3LRYA 2JYGA 1Q82Q 2PENA 1D1DA 1VQPP 1EOQA 2XT1A 2XXMA 3B5IA 3VRLC 2CWOA 2EIAA 3G28A 1VQMP 3HZQA 3H4EA 4PH0A 5F2NA 2BQ1E 4U0BA 3WBHA 1YHQP 2ONTA 1M6NA 2E1MA 4XROA 1NJIQ 3MGEA 3G29A 2P9XA 1VQ4P 2BHVA 2EFJA 1BAJA 4QNBA 3RG6C 2BUOA 4U0EA 3CPWO 3CXCO 2DGYA 3E2DA 2L6EA 3CC7P 1K8AQ 4XRQA 2Z44A 3DTJA 1K9MQ 3I56P 5DCKA 3DS0A 1A8OA 4WYMA 1Q7YQ 3P05A 2LF4A 4U0DA 2XV6A 3HYBA 3DS1A 3G1GA 5HGLA 1JJ2O 3DPHA 1IUQA 5F2OA 3G6EP 2PEJA 3OW2O 1YJWP 3CCRP 1QVGO 5HGMA 4COCA 3CCUP 1M90Q 3CCJP 5BS2A 2Z46A 1YITP 1A43A 2OTJP 3DS2A 2M8NA 3CMAP 2OTLP 1RO0A 3DS4A 1QRJA 2EG5A 4GR6A 5HGOA 4U0AA 2JYLA 3CCQP 1VQ7P 3CC4P 1RNIA 5I4TG 3G26A 5BS1A 3G0VA 4XFXA 3I55P 1PEOA 1KD1Q 4U0FA 5HGNA 5F2KA 1RO2A 1Q81Q 3M1MA 2QA4P 3CCLP 1AUMA 2Z45A 3CCEP 1ZMBA 1KQSO 4PH1A 2OARA 1M6EX 1VQLP 1VQOP 2PEMA 3CCSP 1EIAA 1VQKP 1VQ9P 3NTEA 1K30A 3CC2P 1YIJP 4U0CA 1YJ9P 3CMEP 1S72P 2M8PA 3G71P 4XFZA 1YI2P 1E6JP 1QVFO 1Q86Q 2PEKA 1PEMA 3G1IA 4COPA 1M1KQ 2PEIA 1KC8Q 1VQ6P 3G21A 1VQNP 1VQ8P 2PEOA 3DS5A 4GR2A 3CCMP 1YJNP 1VQ5P 1W2BO 3CCVP 3H47A 4M0IA 3Q20A 2PEQA 2QEXP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G4S P;  1N8R Q;  3OW2 O;  3G6E P;  1YIJ P;  1YJW P;  1QVG O;  3CCR P;  3CC2 P;  3CCU P;  1M90 Q;  3CD6 P;  3CCJ P;  3CPW O;  3CXC O;  1K73 Q;  1VQ9 P;  1YIT P;  1YJ9 P;  2OTJ P;  3CME P;  1S72 P;  3CMA P;  2OTL P;  3G71 P;  3CC7 P;  1YI2 P;  1Q82 Q;  1QVF O;  1K8A Q;  1Q86 Q;  1VQP P;  1VQ7 P;  3CCQ P;  3CC4 P;  1M1K Q;  3I55 P;  1KC8 Q;  1K9M Q;  3I56 P;  1VQM P;  1KD1 Q;  1VQ6 P;  1Q81 Q;  1VQN P;  1Q7Y Q;  2QA4 P;  3CCL P;  1VQ8 P;  3CCE P;  1KQS O;  1YHQ P;  3CCM P;  1YJN P;  1VQL P;  1VQO P;  1VQ5 P;  1W2B O;  3CCS P;  3CCV P;  1NJI Q;  1VQK P;  2QEX P;  1VQ4 P;  1JJ2 O; 
#chains in the Genus database with same CATH topology
 2Q3I A;  2GUS A;  3RBX A;  3DS3 A;  2FQ0 A;  3T97 B;  2BCC G;  2KOD A;  1PPJ G;  1SQX D;  3IR9 A;  2OYI A;  1K05 A;  1DEB A;  5KLV D;  2KIK A;  3RK2 C;  1Y9B A;  1P84 I;  1PL5 A;  5F2N A;  1L4A C;  4DG9 A;  2DW3 A;  3WUT A;  1PZQ A;  2BUO A;  2K0X A;  2PP6 A;  2KSJ A;  4U3F J;  1AFO A;  1NTM K;  3L72 J;  2W6J H;  2Z44 A;  2XNX A;  3LW5 H;  3KYQ A;  1OW8 A;  2V7Q H;  3BRV B;  3DS1 A;  3AE5 C;  3KPE A;  1L0N D;  1GD2 E;  5TJH A;  3CMA P;  2P10 A;  1SQV K;  4EYY Q;  3C8V A;  2QJK C;  1PEO A;  1OIP A;  1RE4 A;  1CI6 B;  3FWN A;  4IFF A;  1N7L A;  1PGO A;  2KGE A;  4ZNC A;  4U0C A;  4EIJ A;  2K0Y A;  1FZC C;  1N7S C;  2Y0D A;  3D6Y A;  1NGM B;  4PV1 D;  1QEX A;  1AYI A;  2MR7 A;  2LPK A;  2ZXE B;  3A5T A;  1RE3 A;  3CX5 E;  1W2E A;  2R5B A;  2GYK A;  2QEX P;  2OGU A;  1P84 D;  4MRT C;  3H0D A;  1QL2 A;  3JSV C;  2GZJ A;  4OH8 B;  1JTH A;  3GF3 A;  1OVV A;  3H1J E;  2FXO A;  2QJP B;  1D1D A;  1N86 A;  2QJY C;  2O01 H;  2Q1K A;  2EIA A;  1DX7 A;  4H13 D;  1DV5 A;  1BSH A;  2RH0 A;  3FXD A;  1UJZ A;  3RGU A;  5KLV E;  1D7M A;  3MGE A;  3TGU E;  3I5C A;  2FYU E;  2IBZ I;  5KLV G;  4H0L D;  1X9V A;  3U43 A;  4PV1 C;  3BCC E;  1BCC J;  1N7S D;  1K8A Q;  2FYU D;  1G2C A;  4WY4 D;  2D2C C;  1LP1 B;  2XU6 A;  1F80 D;  3VTP C;  1M1J B;  4IL6 X;  3BRT B;  2YMY A;  4KT0 J;  2XV5 A;  1NTM D;  1LNQ A;  3RL0 g;  2A06 E;  4I1L A;  1EQ7 A;  2Q6Q A;  3RBZ A;  4C7N B;  2IDB A;  2KOG A;  2WSF H;  3H1J J;  1JTH B;  1RE3 C;  1AJY A;  1PP9 D;  2IBZ D;  4XFX A;  1Y8A A;  1T3J A;  2K9J A;  1GU5 A;  1FZC A;  2MY5 A;  3P8C D;  2GA1 A;  2PEM A;  1L0L E;  1SQX K;  1KQL A;  3HUS B;  2MF4 A;  1GXG A;  1K30 A;  1PP9 E;  1YIJ P;  3AEB C;  1SQV G;  5HVC A;  3FGA D;  3B5N B;  2JO1 A;  1RE4 C;  5TIS H;  3F89 A;  2P67 A;  4WY4 B;  3PLN A;  2V7Q J;  4GOF A;  3PTZ A;  1JY3 P;  2M3E A;  1ZXG A;  3Q5P A;  4Y99 C;  3MUD A;  3L75 J;  4W80 A;  3G4S P;  2XDJ A;  2CPS A;  1SQX E;  5APS A;  3G3Z A;  5AW5 B;  5JPA A;  2PY8 A;  5AW2 B;  1OMI A;  2IBZ E;  4H44 D;  3JCU H;  3HTK A;  1EOQ A;  3JCU E;  4N78 E;  4UB6 E;  2KS1 A;  1YHQ P;  2J5U A;  4XRO A;  1JY2 P;  2GZF A;  4Y28 J;  2KXP B;  4DJG A;  1N73 A;  1OFC X;  2M5R A;  4RO0 A;  2WSF J;  3CXH H;  1LJ2 A;  2M5A B;  2H89 C;  1J2J B;  3ZDM A;  1NAF A;  2A45 I;  1NTZ J;  4W7Y A;  2PFX A;  5BU8 B;  2I8D A;  1NQ4 A;  4U0D A;  1JM0 A;  1GW4 A;  2JGP A;  1JJ2 O;  2IX7 C;  1IK7 A;  1FZC B;  3ITK A;  2PNG A;  4ASV A;  1NHL A;  2JAZ A;  2AFD A;  2OYI B;  1VPC A;  3RK3 E;  1ZV8 A;  2P1J A;  1KYO E;  3T97 A;  3U1A A;  3CC4 P;  1FAV A;  3L73 J;  2FVA A;  3PJS K;  3I55 P;  2Q7C A;  1S9K D;  1VF5 C;  3L73 D;  2OYI C;  1M6E X;  3B5N D;  1HWT C;  1G1J A;  3KXD A;  2FYN C;  3P8C E;  1WT6 A;  1BXI A;  2BEZ F;  1GDT A;  1YQ4 C;  3GKL C;  2EHS A;  1PGJ A;  3G71 P;  3TGU G;  1QVF O;  2PEI A;  4GKG A;  5CCG D;  2OYH C;  1SFC A;  5CJ4 A;  2N98 A;  2VLP A;  4ZMD A;  2B89 A;  4RKU J;  3KZI H;  5AW8 B;  1SQB E;  1EZV D;  2OYH B;  2D2C B;  1T2K C;  1M1J C;  1S9K E;  3BCC J;  1VQP P;  1NOH A;  3O6Q B;  3H1L J;  4D6T E;  1FZA A;  4Z1M H;  1GL2 D;  3TF5 A;  2WSC J;  1OW6 A;  4H0L B;  1NTK G;  3MGN A;  5KTB A;  1GZL A;  3H1L G;  4I7Z C;  3TDK A;  1CW5 A;  3NFQ A;  4HKG A;  3FX0 A;  2FQ1 A;  3L70 G;  4K35 A;  1LWU A;  1NTK J;  4LGD E;  1ACP A;  5CCH A;  2WMM A;  5AW6 B;  1AF8 A;  3KQG A;  1X8Y A;  3M9Q A;  2Z46 A;  2ZFC A;  3DS2 A;  4JYC A;  2OTL P;  1RO0 A;  1BSN A;  1IFI A;  3M06 A;  4Y99 B;  1SQQ D;  2CK3 H;  4BWN A;  2WTY A;  1AQ5 A;  2KGA A;  4MN4 C;  1RO2 A;  1ZMB A;  2CPB A;  4D6T J;  2KW2 A;  3U1C A;  3CC2 P;  1DD3 A;  4OGQ C;  4L75 A;  2XZ0 D;  2LIU A;  1J1E B;  2WPQ A;  2W6B A;  3HE4 A;  5KAI H;  2CGQ A;  1PEM A;  4GIF A;  5APV A;  3E7K A;  2FVF A;  3AEC C;  4PWV B;  2FAC A;  3H1J D;  5AW0 B;  1S5L E;  2N5H A;  4QKO A;  3B4Q A;  2ZVN B;  1PEU A;  4DCK A;  1T2K D;  4IPY A;  3HE4 B;  3TNU A;  3QH9 A;  2KOQ A;  1SQQ E;  2R44 A;  5APQ A;  1SQV E;  1NH4 A;  5AVR B;  1DIP A;  2PEN A;  2J58 A;  3VRL C;  3KHU A;  4HJG H;  5KJ7 C;  3TYY A;  4GOD A;  3G29 A;  3L72 D;  1E79 H;  1HQB A;  4QNB A;  1HBW A;  1UNK A;  1IK9 A;  1HTL C;  1L4A B;  2Z5H A;  3A7O A;  3GHG A;  3A0H E;  2QE7 H;  2ERH A;  3F5H A;  3I56 P;  4H2W C;  3A0H H;  4I2L C;  3DS0 A;  1L0N J;  1NKN A;  2LML A;  1BE3 G;  4L76 A;  3L71 J;  1J1D C;  1YJW P;  3WMM 0;  1M57 D;  2JU1 A;  5BS2 A;  2QG4 A;  1KFN A;  1NU1 J;  3H32 B;  2KOO A;  3L70 J;  2MVV A;  2L5G B;  3FXE A;  1NTM G;  2QNW A;  4AQR D;  1FJK A;  3L74 G;  5HGN A;  3H1I J;  3M1M A;  4DT0 A;  1DEE G;  1KZU B;  5AVQ B;  1H89 A;  3AE2 C;  3KDP B;  1X3O A;  2E75 D;  2ZT9 C;  1NTZ D;  2W90 A;  2FY8 A;  2Z5I A;  2MKV A;  2WPR A;  4WY4 A;  3GZM A;  3VYI A;  2WPT A;  2WIT A;  3CL3 D;  5CHX A;  3UIA A;  3OJA B;  3HTK B;  3NXS A;  3BCC G;  4LC1 A;  2ZYG A;  5KKZ B;  1URQ C;  4H0L C;  3Q2Y A;  3LID A;  1EDK A;  2R3C A;  2K9J B;  3AE1 C;  1N8R Q;  2MJZ A;  4C46 A;  1JY2 O;  1URQ B;  3CXH I;  1R8E A;  1BCC G;  2FYZ A;  2FYN B;  2N1T A;  5AVT B;  2FFD B;  3RK3 D;  1PIX A;  2Y0C A;  4HYT B;  1MKM A;  2C9L Y;  1VL2 A;  2H88 C;  2EFJ A;  4BXL A;  3RG6 C;  3S9O A;  1EXJ A;  4BPG A;  3P8M C;  1LT9 C;  2E76 B;  2M3B A;  1JY3 O;  1FU1 A;  2AXT H;  1OWA A;  1GMJ A;  3B71 A;  5AW3 B;  5HGL A;  1FE6 A;  1ZNV A;  2E74 D;  3TGU J;  2CNR A;  2SPZ A;  3TGU D;  2LXB A;  1KB9 D;  4F37 A;  2AEM A;  2YXQ B;  1KD1 Q;  1SQP E;  3MHV A;  4WY4 C;  1KTM A;  2K1A A;  2Y0E A;  1OZH A;  3L71 G;  3L35 A;  1ZRT D;  1G1I A;  3LMO A;  1FZF A;  1GPJ A;  3P32 A;  1YI2 P;  1NTM E;  1NTK D;  3Q5S A;  3A2A A;  3N4X A;  1RF1 A;  1LTJ C;  1SQB D;  1EZV E;  4CA3 A;  2ZYD A;  1IJD B;  2K3R A;  4I6M C;  1IO4 A;  1VKU A;  4XFY A;  2LL8 A;  4C7R A;  1JCD A;  3E1I A;  3VMA A;  2HG5 D;  4U3F G;  2RN0 A;  4LLH A;  2CWO A;  5AVZ B;  1KB9 I;  5APU A;  1EC5 A;  2BQ1 E;  2BAS A;  2BCC E;  1PV3 A;  3WBH A;  3L74 E;  1BCC D;  5H2F H;  2FYU G;  1PGP A;  3EFF K;  3WUU A;  1YTZ T;  2KR5 A;  3L73 E;  2KOS A;  3BAS A;  4BPH A;  1NU1 E;  1SFC C;  5AVS B;  3CX5 I;  2VLQ A;  2E75 C;  2OYH A;  4H2X C;  1HH0 A;  3H1I G;  1SQQ G;  3QWO C;  4WYM A;  2ZVO B;  1HUC A;  1SQX J;  2NPS C;  3GHG C;  2W6A A;  2IYP A;  2AVA A;  2RKL A;  2L4B A;  1NKZ B;  2PGD A;  4IFD K;  1PPJ D;  1QRJ A;  1XTG B;  2GUV A;  3G26 A;  2K92 A;  1QLE D;  3MIW A;  4U3F D;  1X22 A;  2WT7 A;  5F2K A;  1RF0 C;  1Y47 A;  1OVR A;  1NTZ E;  1VQL P;  2WSS H;  3D6Z A;  1KFM A;  1NYH A;  1SLQ A;  4GDO A;  3PH0 A;  1SVF A;  1YQ3 C;  1LTB C;  1HF9 A;  2YNY A;  1YJ9 P;  3CME P;  2Y9Y A;  1VF5 B;  2QM8 A;  2KOP A;  2L9F A;  1MFZ A;  1IFM A;  2LIW A;  1QX8 A;  2WSC H;  2NZ2 A;  4A7P A;  3IFM A;  1BDC A;  1FDI A;  2YXR B;  3SSU A;  1M8O B;  2WPV B;  3RL0 B;  1KOR A;  2WSE J;  5B5E E;  3CD6 P;  1KB9 H;  2OYO A;  4L74 A;  3SWY A;  2HYN A;  4BRY A;  5B5E H;  3H6P A;  5E79 E;  3GJN A;  3H4E A;  1YBK A;  4IOI H;  2E1M A;  2WQY C;  3TK1 A;  1UIX A;  2BHV A;  2J59 M;  1JY3 N;  3HD7 A;  3V6I A;  1H0T A;  4O9B A;  3MUD C;  1X79 B;  3H1K E;  4H44 B;  2HFE D;  1USD A;  2HPC A;  5KLV J;  2FHS C;  2LF4 A;  2QJY B;  3V2P A;  2O01 J;  1BDD A;  2N9B A;  1PP9 G;  4CPG A;  3OW2 O;  3G6E P;  3B5N C;  2ITA A;  3R2P A;  1M90 Q;  1L0L G;  1YIT P;  2OTJ P;  1JY2 N;  3KZI E;  3AE4 C;  2ZAE B;  3D70 A;  2PAJ A;  2YIU B;  1MUU A;  2Z45 A;  1A02 J;  3IF4 A;  1AVO A;  2YKQ A;  1IMQ A;  5DJU B;  2LTE A;  3AE9 C;  5B66 H;  3NMD A;  2IYO A;  3L4F A;  1VHN A;  2GDY A;  1OVU A;  3H1H J;  2I1K A;  4R4M A;  2PEK A;  3PRJ A;  5APX A;  4ZKP A;  1KC8 Q;  3L73 G;  3VMY A;  2LKI A;  3DS5 A;  1IZN B;  1FC2 C;  2JQ4 A;  1LT1 A;  1NWQ A;  1PFI A;  5GTI H;  5AVY B;  1LTI C;  1BE3 J;  2FVE A;  1FJP A;  3A3Y B;  5AW7 B;  5GTI E;  1R5S A;  5CCG C;  2ONT A;  1NAY A;  2HPC B;  1U7M A;  1FBM A;  2XND H;  3II6 A;  1SP4 A;  3CLQ A;  1ZR2 A;  2GM4 A;  2FYU K;  1KIL D;  1JMM A;  1EZV I;  2K2Q A;  5GTH E;  4XRQ A;  2IBZ G;  2YKO A;  1K9M Q;  1OX3 A;  3VMZ A;  1RF1 B;  4WWI A;  2IZ0 A;  2YO3 A;  3Q3D A;  3IAO A;  3CCJ P;  2KYV A;  2ZJS E;  3C1L A;  1S5L H;  1P84 E;  2HR3 A;  3CCQ P;  1K04 A;  2E74 C;  3HUS A;  2QA4 P;  2AXT E;  3A0B H;  2JB0 A;  2KUB A;  3CCS P;  2A45 H;  1NTK K;  3L75 E;  4HH2 A;  3MP7 B;  2C0W A;  2E74 B;  2D2C D;  4JF7 A;  3W67 A;  1IFP A;  2LXC B;  4YXD C;  4WVZ A;  2M0B A;  2WSE H;  1M1K Q;  1ZLL A;  2Q3E A;  1VQ6 P;  1JCC A;  3FWL A;  1FDM A;  2L91 A;  2QIW A;  1VQ5 P;  4UHP B;  1LWU B;  2M8L A;  5CJ0 A;  4H13 C;  2M8R A;  3H1H E;  5KKZ C;  3V2N A;  2RMZ A;  3S1K A;  4N3Y B;  4DOJ A;  3H1I E;  5KLI C;  3CX5 H;  4JPZ B;  3VOP A;  4YTP C;  1CSB A;  3G28 A;  1L0N K;  3HZQ A;  1PPJ E;  1GTW A;  1M7L A;  3Q1M A;  3L75 D;  3D71 A;  4EDF A;  3VP9 A;  2FFD A;  3R4Y A;  2N1T B;  2K37 A;  2XZR A;  2CG5 B;  2AXC A;  4HB1 A;  2LR2 A;  4KJM A;  2E5T A;  3LIE A;  2A06 G;  5AVV B;  4C7N A;  1BGY G;  2EHT A;  1BE3 E;  1SQP G;  4EOT A;  2JKV A;  2N50 A;  3VP8 A;  1FS0 E;  2XV6 A;  1S4X A;  3SFD C;  1LT9 B;  2E76 C;  3DPH A;  1LTS C;  3H1I D;  4YXW H;  3GMA A;  1A43 A;  1MZ8 A;  1SQV J;  2VRS A;  2MD9 A;  5HGO A;  3Q5R A;  2KLV A;  5BU5 A;  3G0V A;  2WWW A;  1HY8 A;  2KG8 A;  4U0F A;  1L0I A;  2KWL A;  2FXP A;  2ZXX A;  1N7S A;  4TLF A;  4N6J A;  4NPE A;  1KIL B;  3CWB E;  1KIL E;  2FBW C;  3H1J G;  1N73 C;  1RY3 A;  2M8P A;  4PJ0 H;  3HUS C;  3AEG C;  1FR2 A;  1CEI A;  2NRG A;  1L0N E;  5AW4 B;  4GR2 A;  5M1B A;  2YIU C;  3Q20 A;  1VDF A;  2JO0 A;  3V2Q A;  1K73 Q;  1AQT A;  1LTT C;  4D6T D;  2N6Z A;  2QVA A;  2BEQ D;  1J1E C;  1L0N G;  1VQM P;  3EJD A;  4PH0 A;  1OXZ A;  4XE5 B;  1FDO A;  2K93 A;  1FZG A;  1QL1 A;  2FAD A;  1NTM J;  2PRR A;  2Q9I A;  3O6Q A;  2DGY A;  2FXM A;  3TSI A;  1PP9 J;  2GZE A;  2VSQ A;  2HLO A;  1U57 A;  2ZT9 D;  3H32 A;  3CXH D;  3EJE A;  1KMI Z;  5DCK A;  3BCC D;  3H1L D;  1DD4 A;  2E42 A;  3CXH E;  3G1G A;  5AW9 B;  1IUQ A;  2KP8 A;  2KNC B;  4COC A;  1HGZ A;  1JEK A;  3CI9 A;  3BAT A;  1S2E A;  5CCG A;  1JO5 A;  2N5I A;  1L4A A;  2K94 A;  1RQU A;  1ZW0 A;  2GZI A;  2H43 A;  4IL6 E;  1GK4 A;  1BGY E;  1KYO D;  2IPP A;  1VQ9 P;  1S5L X;  3AEF C;  3VMX A;  3GF7 A;  3M0A A;  2FFD C;  3L70 E;  2H8P D;  2K88 A;  2O01 N;  4XFZ A;  2WPS A;  1XTC C;  5H2F E;  3G1I A;  2N9Y B;  1NU1 G;  3L70 D;  1NO4 A;  5KJ7 D;  3H1K D;  3L37 A;  3RK2 D;  1NTK E;  5AVX B;  4PV1 B;  1SQV D;  2FYU J;  3H1K J;  2KZI A;  4IL6 H;  1GL2 C;  1M74 A;  3CWB J;  1RHZ B;  1LP1 A;  3M0D C;  2JYG A;  3RL0 D;  3CWB D;  4M3L A;  3EWK A;  1GU4 A;  2H7H A;  2FKW B;  2MVU A;  1GL2 B;  5GTH H;  1SQP J;  5C39 A;  2DNW A;  4RJT A;  1BGY J;  1ZN5 A;  4R0M A;  1H8A A;  1BAJ A;  2JR8 A;  4U0E A;  2N1T D;  3N7N A;  2B9B A;  5L8R J;  1IMP A;  1EZV G;  3L75 G;  1HGV A;  4XFJ A;  4OGQ D;  4RES B;  3CC7 P;  4UB8 E;  1FZB A;  5APT A;  5DJT B;  1Q7Y Q;  3S4R A;  3P05 A;  2K0D X;  3JC2 2;  2VLN A;  1UII A;  5B66 E;  3EQ2 A;  5KP7 B;  1EDL A;  2KGD A;  4AUW A;  3HYB A;  4H2Y C;  5KLV K;  3C9I A;  1QVG O;  3CCU P;  4JQ0 D;  1T3U A;  2Q5U A;  1MFT A;  3EFG A;  2KG6 A;  3V2R A;  5BVZ A;  2EG5 A;  1RNI A;  5CZD B;  5I4T G;  2P58 A;  4B86 A;  4EI2 A;  1P84 H;  5APW A;  3CCE P;  1RQV A;  3SWF A;  4PH1 A;  1EDJ A;  3P7K A;  5KP6 B;  1NU1 D;  3M9B A;  1A02 F;  2JEE A;  3MD0 A;  1USE A;  1RF0 A;  3U59 A;  2ROQ A;  1Z56 A;  1OR5 A;  1WMK A;  3L36 A;  3G21 A;  4D6T G;  3VN0 A;  1HVV A;  4OWF A;  1W2B O;  3MZW B;  2JDI H;  4R4L A;  3AED C;  3EJB A;  2GZG A;  2OTK E;  1IC2 A;  1FOS E;  3NTN A;  3GLM A;  1LTA C;  1N73 B;  1E5W A;  2A06 D;  1Q82 Q;  2XXM A;  1HJB A;  2NPS B;  2L0Q A;  3PHL A;  5TIS E;  1M6N A;  2WZ7 A;  1JUN A;  3E2D A;  2KB7 P;  2NPS A;  1Q2N A;  1H88 A;  2LOL A;  1J1D B;  5CBO A;  1IFD A;  1KN7 A;  3WUV A;  3OAK A;  1SQB G;  1VF5 D;  1JB0 J;  1L0L K;  1LTG C;  5F2O A;  3CCR P;  3B5N A;  5EJD A;  4XA4 A;  3HE5 B;  2O1J A;  1DNY A;  3DS4 A;  4GR6 A;  3AE7 C;  2JYL A;  1SQP D;  2ZT9 B;  1AA0 A;  1ZME C;  1SFC B;  2YMK A;  3MTU E;  1Q81 Q;  2W8Z A;  4OVN F;  3G9R A;  1KQS O;  4ASW A;  3AE3 C;  5KAF E;  3SWK A;  2E76 D;  2GDW A;  3HD7 C;  2R32 A;  2JWA A;  1SFC D;  3GHG B;  4K3A A;  1NVO A;  1KQF B;  1IFJ A;  2BCC J;  3V4W A;  1E6J P;  3NY7 B;  3L74 J;  1GK6 A;  4KHX A;  1LTJ A;  3AEA C;  3RG2 A;  2N6Y A;  3BVH A;  1VQ8 P;  2AEJ A;  1YJN P;  1EMV A;  5KLI B;  3WU2 E;  2QJP C;  4M0I A;  1N7S B;  2PEQ A;  1BE3 D;  1EDI A;  1PEQ A;  4H44 C;  1NTZ K;  1M56 D;  3GG2 A;  3RK3 C;  1IFN A;  1R5L A;  1JNM A;  3L71 E;  3LW5 J;  1MZ9 A;  3M91 A;  1Z6M A;  3B5I A;  4BRY B;  2JP3 A;  2MR8 A;  2K9Y A;  4H13 B;  1MV8 A;  1N2D C;  3GW6 A;  1ZR4 A;  2P9X A;  1KLP A;  1VQ4 P;  3SFE C;  2ZYA A;  3V5B A;  1G2C B;  1U7J A;  5CCH D;  3CWB G;  5APY A;  3A0B E;  2KOR A;  3DTJ A;  1A8O A;  3HD7 D;  3AE6 C;  4NPD A;  2KK7 A;  2WT7 B;  3B4S A;  3HRN A;  5HGM A;  1SQB K;  5AVW B;  2GDX A;  1BGY D;  1URQ A;  4U0A A;  5AVU B;  3K5B A;  5BS1 A;  2KZJ A;  4PD4 D;  3CCL P;  1AUM A;  2OAR A;  1EIA A;  2QSI A;  3H25 A;  1KB9 E;  4N78 D;  2JBG A;  1BCC E;  4IFM A;  2G3A A;  2G8Y A;  5CCH C;  1YTZ I;  1KIL C;  1L2P A;  4COP A;  5EFW B;  4GT1 A;  4DZO A;  1KYO H;  2PEO A;  2KNC A;  5HV8 A;  3H47 A;  4PXH B;  2X2B A;  2POH A;  1GXH A;  2KSE A;  2E43 A;  3H1H G;  2FQ2 A;  1LTJ B;  2AFE A;  2V4H A;  2E5Y A;  2C9N Y;  4OGQ B;  4GOE A;  1RF1 C;  1SQQ K;  3H1H D;  2YKP A;  1KIL A;  4U0B A;  1URQ D;  1KV4 A;  4U7J A;  2FAE A;  4NPF X;  1ZP0 C;  1GL2 A;  4ZKU A;  2I1J A;  3CXC O;  4YPC A;  2BCC D;  3WU2 H;  4TT3 H;  2L6E A;  1ZOY C;  3OA7 A;  1S3J A;  2IZ1 A;  1E0H A;  5KJ7 A;  1Q90 D;  4WBA A;  4PJ0 E;  2UWJ E;  3HD7 B;  2HOD A;  3HE5 A;  3RK2 B;  1CZQ A;  2E75 B;  3O8Z A;  2PEJ A;  4BPF A;  5KAF H;  5K5G B;  1T8Z A;  2IFN A;  2M8N A;  4W7Z A;  2P7J A;  3M9H A;  1VQ7 P;  5AW1 B;  2QRX A;  2LKM A;  2R5D A;  1SQB J;  4JBZ A;  1DH3 A;  2XZ1 C;  4IZ6 A;  1LGH B;  1LT9 A;  1VQO P;  2KG9 A;  4NEO A;  2AF8 A;  1KYO I;  1S72 P;  1W5C E;  3PP5 A;  1Q86 Q;  2R3S A;  1ZRT E;  5CBN A;  1JMB A;  1L4A D;  2N1T C;  3CCM P;  5E79 H;  2QJK B;  2JJL A;  1FOS F;  5CMZ A;  2HOD B;  1SQP K;  2KS1 B;  2WVR A;  4PD4 H;  2NO8 A;  1RH5 B;  2L22 A;  4PD4 E;  1GW3 A;  2B87 B;  3CE7 A;  3LRY A;  4HKZ H;  3RL0 C;  2XT1 A;  1JOC A;  1L0L D;  1HJ0 A;  1NTZ G;  1FZE A;  1L0L J;  2C0X A;  3W68 A;  1KQG B;  1QGK B;  2O3J A;  4AYC A;  1NJI Q;  5EW5 E;  1SQX G;  2W27 A;  2CQ8 A;  3IN6 A;  2Z4E A;  3GZL A;  2O1K A;  2B87 A;  3L74 D;  3CPW O;  2XKM A;  2A45 G;  1LWU C;  1EXI A;  1H0T B;  2K5X A;  2YO2 A;  3AEE C;  3RK3 B;  1L0H A;  2M5A A;  3M0D A;  1AVY A;  4I7Z B;  3ABV C;  3E1R A;  4QMA A;  3V4Q A;  1CI6 A;  3B8E B;  4L73 A;  2Y9Z A;  2P2U A;  3CX5 D;  3H1L E;  3TNU B;  2QM7 A;  1PGQ A;  2OQQ A;  2AEF A;  3L72 G;  3AE8 C;  3L71 D;  1T6A A;  1S1C X;  2JU2 A;  1YYC A;  5KAI E;  2KGC A;  4JYB A;  2B88 A;  1TU3 F;  2KLU A;  1M1J A;  4U3F E;  1VQK P;  3H1K G;  1SQQ J;  3NTE A;  2NPS D;  2KI7 B;  2VLO A;  1OW7 A;  2W83 C;  3USS A;  3L72 E;  1NU1 K;  4PD4 I;  1SS1 A;  4UB6 H;  1AV1 A;  2IFM A;  2JWD A;  1X0T A;  4UB8 H;  1T8K A;  1VQN P;  7CEI A;  1WRG A;  5KP8 B;  3CCV P;  4WB4 A; 
#chains in the Genus database with same CATH homology
 3G4S P;  1N8R Q;  3H0D A;  4XFY A;  2M8L A;  1PEQ A;  1PEU A;  2JO0 A;  3CD6 P;  4IPY A;  1K73 Q;  1M74 A;  2PY8 A;  5JPA A;  3DS3 A;  2KOD A;  3LRY A;  2JYG A;  1Q82 Q;  2PEN A;  1D1D A;  1VQP P;  1EOQ A;  2XT1 A;  2XXM A;  3B5I A;  3VRL C;  2CWO A;  2EIA A;  3G28 A;  1VQM P;  3HZQ A;  3H4E A;  4PH0 A;  5F2N A;  2BQ1 E;  4U0B A;  3WBH A;  1YHQ P;  2ONT A;  1M6N A;  2E1M A;  4XRO A;  1NJI Q;  3MGE A;  3G29 A;  2P9X A;  1VQ4 P;  2BHV A;  2EFJ A;  1BAJ A;  4QNB A;  3RG6 C;  2BUO A;  4U0E A;  3CPW O;  3CXC O;  2DGY A;  3E2D A;  2L6E A;  3CC7 P;  1K8A Q;  4XRQ A;  2Z44 A;  3DTJ A;  1K9M Q;  3I56 P;  5DCK A;  3DS0 A;  1A8O A;  4WYM A;  1Q7Y Q;  3P05 A;  2LF4 A;  4U0D A;  2XV6 A;  3HYB A;  3DS1 A;  3G1G A;  5HGL A;  1JJ2 O;  3DPH A;  1IUQ A;  5F2O A;  3G6E P;  2PEJ A;  3OW2 O;  1YJW P;  3CCR P;  1QVG O;  5HGM A;  4COC A;  3CCU P;  1M90 Q;  3CCJ P;  5BS2 A;  2Z46 A;  1YIT P;  1A43 A;  2OTJ P;  3DS2 A;  2M8N A;  3CMA P;  2OTL P;  1RO0 A;  3DS4 A;  1QRJ A;  2EG5 A;  4GR6 A;  5HGO A;  4U0A A;  2JYL A;  3CCQ P;  1VQ7 P;  3CC4 P;  1RNI A;  5I4T G;  3G26 A;  5BS1 A;  3G0V A;  4XFX A;  3I55 P;  1PEO A;  1KD1 Q;  4U0F A;  5HGN A;  5F2K A;  1RO2 A;  1Q81 Q;  3M1M A;  2QA4 P;  3CCL P;  1AUM A;  2Z45 A;  3CCE P;  1ZMB A;  1KQS O;  4PH1 A;  2OAR A;  1M6E X;  1VQL P;  1VQO P;  2PEM A;  3CCS P;  1EIA A;  1VQK P;  1VQ9 P;  3NTE A;  1K30 A;  3CC2 P;  1YIJ P;  4U0C A;  1YJ9 P;  3CME P;  1S72 P;  2M8P A;  3G71 P;  4XFZ A;  1YI2 P;  1E6J P;  1QVF O;  1Q86 Q;  2PEK A;  1PEM A;  3G1I A;  4COP A;  1M1K Q;  2PEI A;  1KC8 Q;  1VQ6 P;  3G21 A;  1VQN P;  1VQ8 P;  2PEO A;  3DS5 A;  4GR2 A;  3CCM P;  1YJN P;  1VQ5 P;  1W2B O;  3CCV P;  3H47 A;  4M0I A;  3Q20 A;  2PEQ A;  2QEX P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...