3CC2P

The refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution with rrna sequence for the 23s rrna and genome-derived sequences for r-proteins
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
total genus 48
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2008-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3cc2P03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 3cc2P01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 3cc2P02
3G6EP 1Q86Q 1NJIQ 1M1KQ 3CCQP 3CD6P 3I55P 1QVGO 1YJWP 1KQSO 1VQ7P 1VQLP 1YIJP 1S72P 3CPWO 1VQ9P 3I56P 3CCMP 1KC8Q 2QA4P 1YJNP 1Q7YQ 3CMAP 3OW2O 1Q81Q 1VQ5P 1K9MQ 1YHQP 1VQKP 3CCLP 1Q82Q 3CCUP 2OTLP 1QVFO 1YITP 2OTJP 1VQMP 3CC4P 3CCRP 1VQ8P 1VQ4P 1K8AQ 1N8RQ 1W2BO 3CC2P 1K73Q 3CCVP 3CCSP 1VQOP 1M90Q 3CCJP 1VQPP 1KD1Q 3G71P 1YI2P 3CXCO 3G4SP 1VQNP 3CMEP 2QEXP 1JJ2O 1YJ9P 3CCEP 3CC7P 1VQ6P
chains in the Genus database with same CATH superfamily
2AF8A 2KIKA 1UJZA 1Q86Q 2R5BA 1PP9G 1EZVD 1NU1K 1RF1A 4RKUJ 2MKVA 4GOEA 1NTKE 1M1JA 5B5EE 3M0DC 3NMDA 1KB9D 5CCHC 2L6EA 1BXIA 5APQA 2XZ1C 1J1EC 4Y99C 1JJ2O 1KN7A 1JTHA 1RF1B 1GXHA 3E1IA 1NTKK 3RK2C 5KLIC 5APWA 2KSEA 1DEEG 1FDOA 3GG2A 5KKZB 4OGQC 4F37A 3B5NA 3H47A 3LIEA 1RE4C 4H44C 1CI6A 3L74J 2N6YA 2JWDA 2JBGA 1LT9C 4R4MA 3RL0B 4DG9A 5I4TG 2K9JA 1S9KD 5AW1B 2M8LA 1CI6B 1IC2A 1QVFO 1RNIA 2HG5D 4C46A 4XRQA 2K93A 3G26A 1D7MA 2L4BA 2M0BA 1LTJA 3NTNA 1S1CX 3M0AA 3L36A 2K9JB 3W67A 3CXHH 1T3JA 1HGVA 3RK3C 2WSCH 1J2JB 2MVUA 1X0TA 5AW2B 2E74D 2OYHC 5DJTB 1OVUA 3F89A 4H0LC 4PV1B 2N6ZA 1Q90D 3D70A 1X8YA 1VKUA 1USEA 5KP7B 4U0EA 3AE2C 2XZRA 1CW5A 1FZEA 3V6IA 5KLVD 3H1HE 1SQXE 3Q2YA 1L0LE 1SQVD 1WT6A 2WSEJ 2FYUD 3CCUP 1S5LH 1LT1A 1UNKA 4GDOA 4R0MA 3FWNA 2Q7CA 1KD1Q 5HGOA 2LXCB 2UWJE 2JQ4A 3CLQA 1RF0C 1SQXK 2WZ7A 3L35A 2NPSD 2AXTE 3VP8A 1GW4A 2B87A 3V2PA 4IL6E 3SFEC 5KLVJ 1VQMP 5HV8A 1SQVJ 3HD7D 3VTPC 5KLVG 3A7OA 1N7SC 1SQVG 3AEFC 1L0NJ 3PTZA 2E75B 2B87B 3PJSK 1OW6A 1L0NG 1FBMA 2WSEH 3TDKA 2JKVA 3PLNA 1JMMA 3L72E 2XV6A 2AFDA 2JGPA 2K0YA 1NKNA 3A2AA 3VMYA 2E76B 1LNQA 3JSVC 4XE5B 2YKPA 1QL2A 1VF5B 1EZVE 4L75A 2WITA 3H32A 2QRXA 3EFGA 3R2PA 3B71A 2E1MA 5BVZA 2H89C 2LKIA 5KAIH 2OQQA 1E6JP 2XKMA 4U0AA 4O9BA 1FC2C 3H32B 2KNCA 2ONTA 2PEQA 1SP4A 3CC7P 4XFXA 2IZ0A 2PEKA 2DW3A 5EW5E 2R44A 1URQD 2IBZE 4GT1A 2QSIA 1FJPA 4N6JA 4WB4A 1SQQD 2C0WA 1MKMA 1SFCA 3H25A 1BE3J 1GMJA 3EJDA 1NJIQ 1PGPA 2BASA 5GTHE 3S4RA 2OYIB 1F80D 1BGYD 1BE3G 5BS2A 2KP8A 2N1TB 1AVOA 2A45I 3WUUA 2NPSC 2BHVA 1SFCB 2G8YA 3WUTA 1HGZA 2Q3IA 1M1KQ 1KILA 2ITAA 3RBZA 2M3BA 1N86A 1YJWP 1LGHB 2WSFJ 3H1LJ 2LR2A 1BGYJ 3MD0A 3H1LG 1BCCE 3LMOA 3MGNA 3TK1A 1KILB 1BGYG 4YXDC 2E5TA 2GUSA 3U1AA 2KZJA 5AVTB 2Z45A 2GZEA 2KGDA 1IMQA 3B4SA 2EFJA 1P84H 1HF9A 2FQ1A 1LTTC 2XU6A 1S2EA 4DCKA 2ERHA 2KSJA 4WYMA 2P7JA 5GTIH 5AW6B 1M74A 4EDFA 1J1DB 2MY5A 2CGQA 1W2BO 2JP3A 3L71E 2Y9ZA 5KLVK 1QGKB 1YI2P 1SQVK 2FYUK 3QH9A 1NOHA 2WSFH 2K2QA 3SSUA 4D6TE 3TGUE 5M1BA 1JCCA 1SQBD 1ZV8A 2BCCD 4TT3H 2KZIA 2K5XA 2JAZA 1FZCA 2L91A 1NHLA 2Z5HA 3U1CA 4PWVB 1VHNA 3U59A 4QNBA 1AVYA 3CXHI 3WUVA 3JCUE 5CHXA 5APSA 4PJ0E 1IMPA 2HYNA 2KLUA 2GZFA 1EDKA 1FZCB 2I8DA 4U0CA 1KQSO 5CBNA 2R3SA 4KHXA 1YQ3C 1EC5A 2HFED 1E5WA 1SQBJ 3SFDC 5EFWB 4ASVA 1KQGB 3FX0A 1SQBG 2XNXA 3KQGA 5F2OA 5APVA 2JJLA 2BCCG 1IFMA 1OR5A 1FR2A 2FXOA 3L70E 1FZGA 3Q3DA 1T3UA 2FAEA 4NPFX 2E42A 4Y28J 3VMAA 1OW7A 2GDWA 3H1ID 5APTA 1K04A 1NU1J 1X79B 2B89A 2H43A 1NU1G 3P32A 3SWFA 1KFMA 2WTYA 1W5CE 1IFIA 2ZT9D 1AUMA 2J5UA 1IO4A 4HB1A 4AUWA 1ZP0C 2K9YA 2P2UA 2PFXA 4BPHA 2RH0A 3Q1MA 4YXWH 1NTKJ 1AYIA 3WMM0 1E0HA 1NTKG 1SQQK 4XA4A 1PEMA 2QA4P 3QWOC 3VOPA 3HRNA 3KZIH 5HGLA 3M0DA 5CCHA 4COCA 3WU2E 3EJEA 1QX8A 4EIJA 3VMZA 3MTUE 3G28A 1YYCA 2N5HA 1A02F 3H0DA 3GW6A 2WPRA 1ZLLA 1LTAC 5L8RJ 2WQYC 5CZDB 3U43A 2MF4A 1K9MQ 1J1EB 4BRYA 4NPDA 1H89A 1RE4A 1RY3A 3RK2B 5KLIB 3CX5E 2P10A 1FDIA 3V4WA 1LT9A 2WT7A 3USSA 4BRYB 2P58A 2QG4A 4H44B 1JCDA 3HE4A 1HJ0A 5AVUB 2PEOA 2ZYDA 2OGUA 3DS0A 3H1HD 1LT9B 1L0LD 2WT7B 1KILE 4U0FA 2LPKA 3L73E 4PD4H 2QEXP 1NTZE 3L75E 3HE4B 2O01H 1SQPD 3HE5A 1GK6A 2WSSH 1YIJP 2KUBA 5CCGC 2OYHA 3BVHA 5APXA 2VSQA 3CCVP 1SQBK 1HVVA 1DX7A 2KG8A 1SQXJ 1L0LJ 1M6EX 2KOPA 2PP6A 3CMEP 1AJYA 1CZQA 1NAYA 3H1HG 2OYHB 1MFTA 1SQXG 1L0LG 4M3LA 1NQ4A 1IK9A 4H0LB 4EYYQ 2C0XA 2CPBA 3DS4A 3VYIA 5TISE 3M9HA 2KW2A 3N4XA 3L72D 2KR5A 3H1JE 2A45H 1RF0A 1T2KD 2IFNA 5HGMA 2AFEA 4WY4D 4HH2A 3MP7B 3EWKA 2K92A 2KODA 2AEFA 1GL2D 3G21A 4BXLA 3TSIA 1NTME 1L4AD 2XXMA 1GU5A 4K3AA 3H1IE 1S3JA 4H13B 1H8AA 2MJZA 1N7SA 2SPZA 1X22A 1KTMA 4HYTB 3G1GA 3DPHA 4DZOA 4Z1MH 1M1JB 1PPJE 3L72G 1DD3A 2PNGA 2IBZD 5DJUB 3FXDA 3V2NA 2JDIH 2XDJA 4YPCA 1BSHA 1JTHB 1EZVG 4IL6H 5KAFE 4OH8B 4W7ZA 1U57A 2K0DX 3HUSA 1ZXGA 4IZ6A 3B5NB 1HUCA 4XROA 1DEBA 4UB6E 1E79H 2FVFA 1YJNP 4JPZB 1N73C 4OVNF 1IUQA 2EHTA 2QJPC 1N7LA 2N50A 4ASWA 1KYOE 3AE1C 3HUSB 2IBZG 3BRVB 1XTGB 2WMMA 1FZBA 2R5DA 2B88A 5TJHA 3CCMP 3RL0D 2LF4A 2QJKC 5KJ7C 1LTJB 2YMKA 1CSBA 4QKOA 3P7KA 2VLNA 1MZ8A 3LW5J 1KB9H 2WWWA 1ZW0A 1AF8A 1BCCD 2MVVA 2KWLA 3M91A 3I55P 1T2KC 1VPCA 2W27A 3G3ZA 2EIAA 2LOLA 4PV1D 1GL2C 2MD9A 2Z44A 5AVVB 4XFZA 1SQPE 3DTJA 3L71D 1L0LK 2HPCA 1BCCJ 4ZMDA 3BASA 1KC8Q 3CMAP 4UB8H 4D6TD 3TGUD 1BCCG 3O8ZA 1SQPK 3AE3C 4CA3A 3A0HH 2HPCB 2FYUJ 2LIUA 3AE8C 3Q5PA 1UIIA 1PGQA 2FYUG 3MHVA 1VDFA 3L71J 3C1LA 1PP9E 3AE6C 3L71G 3RG2A 1IJDB 4QMAA 2Z46A 3TGUJ 4D6TJ 2DGYA 1NYHA 3K5BA 1VQOP 3CCJP 5APUA 3KDPB 3MIWA 5KKZC 2L0QA 1FAVA 3TGUG 4D6TG 2KK7A 1Y8AA 2RN0A 2GZJA 2E75D 4EI2A 2KG6A 2J59M 3VRLC 1YTZI 4IFDK 3L70D 2V4HA 2CG5B 1ZRTE 4PD4I 4PH1A 1RO2A 2YXQB 4LGDE 2GDXA 1LP1A 2E76D 1AV1A 2E74C 2KGEA 1VF5D 2IPPA 2R3CA 2KOGA 4U7JA 1Y9BA 3L74E 1LP1B 1YHQP 2FHSC 2KNCB 4JQ0D 4LC1A 3L70J 1R5LA 2MR7A 1JY2N 3IFMA 4L73A 3L70G 4MRTC 4PV1C 2KB7P 4GIFA 1DH3A 3JCUH 3MGEA 1S5LE 2BEZF 2K1AA 1LTBC 2OYOA 1EDIA 2QVAA 5C39A 1EQ7A 1IZNB 1HTLC 1ZOYC 2FYZA 3CC2P 2RMZA 2J58A 1OW8A 1PEQA 1SQQJ 3E1RA 3HD7C 2ROQA 2KORA 3A3YB 1EXIA 1MUUA 1GDTA 1SQQG 2Q3EA 1Q81Q 2N1TD 2JYLA 1VQKP 1IK7A 1JEKA 5E79E 1KMIZ 4JBZA 1SFCD 4DT0A 3B4QA 2KG9A 3M06A 3OJAB 2YKOA 2FQ0A 3CX5D 1JB0J 2QNWA 1N2DC 2VLQA 3O6QA 1K30A 4RJTA 2FYNC 1ZNVA 3C8VA 3ABVC 2AEJA 2W90A 3AE4C 1SLQA 3CI9A 5BU5A 1ZR4A 2VRSA 3RBXA 2K0XA 2Y0CA 1KILD 3O6QB 3CXCO 1QL1A 1KLPA 1LJ2A 3AEBC 3LRYA 1JMBA 3L73D 1OIPA 1NTZD 4L74A 4IPYA 3L75D 5KAIE 5K5GB 1NO4A 2M8PA 1KZUB 1HY8A 3H4EA 3BATA 1URQC 3GHGC 4U3FE 1VQ8P 7CEIA 2GYKA 3DS2A 3GZMA 2V7QJ 2P9XA 3WU2H 2W83C 1EZVI 1WMKA 1JM0A 2ZVOB 4RO0A 2JB0A 2ZYAA 3AEGC 3G29A 2KGCA 1KB9I 3L73J 2WPTA 1NTZJ 3L75J 1AFOA 4H2YC 2FBWC 1XTCC 4I6MC 4N78E 1FU1A 4RESB 1BDCA 2BCCJ 3L73G 2JYGA 3DS5A 1NTZG 2D2CB 3L75G 1K73Q 4HJGH 2FADA 2N98A 2YMYA 3H1JD 2IBZI 1EXJA 4B86A 1PIXA 2HLOA 4NEOA 5CCGA 3GF3A 2Q5UA 3TNUA 2JU2A 2W6JH 2JEEA 3E7KA 4GODA 2OTJP 2OYIC 1K05A 2D2CD 2N1TC 1M6NA 1QLED 2PEJA 1NTMD 2IDBA 5CJ4A 3D71A 2ZXXA 3TNUB 4N3YB 2AEMA 1S72P 2E43A 3E2DA 1PPJD 1OVRA 3GF7A 1BE3E 4C7NA 3H1JG 2FFDC 1NWQA 1LTSC 3NY7B 2QJYC 2MR8A 1P84E 1R8EA 1JO5A 2ZYGA 1PFIA 3MUDC 2FXPA 5GTIE 1PGJA 3F5HA 3H1IJ 3CPWO 4C7NB 3S9OA 1NTMG 1OMIA 3H1IG 2YKQA 1RO0A 1JNMA 5TISH 5H2FH 3CCSP 1KFNA 1HWTC 1KYOD 2XZ0D 1BSNA 2LXBA 1G1IA 2N9BA 2LTEA 1KORA 3HYBA 3H1KE 2GZGA 4U0BA 2CNRA 4DJGA 4Y99B 2GUVA 1JUNA 2H7HA 2KI7B 3SWYA 4IFMA 5B5EH 5KP8B 4OGQB 2VLOA 4AYCA 1MFZA 1N73A 1VQ5P 2ZVNB 1GW3A 2YO2A 3A0BE 1PEOA 1PEUA 1L0HA 2L22A 3IN6A 1PGOA 2KXPB 2LIWA 3CCRP 2K88A 3C9IA 3RK2D 4GOFA 3BCCE 1N73B 2YO3A 3G6EP 3L4FA 2QJPB 4OGQD 3AE7C 1X9VA 1FE6A 2M5AA 2NRGA 3RGUA 5AW9B 2FQ2A 4H44D 5AVSB 5AVXB 5KJ7A 1LWUC 4UB6H 4W80A 2PENA 1Q2NA 2XV5A 1NTZK 5AVZB 2K37A 4I1LA 1JOCA 1EIAA 3H1HJ 3HE5B 3RK3B 2ZT9C 2M5AB 3V2RA 3ZDMA 1RE3C 1A8OA 3KHUA 3HTKA 1TU3F 3R4YA 3AE9C 1NAFA 1SQPJ 2M5RA 4GR6A 2HODA 1HJBA 3CCLP 3GZLA 1R5SA 1EOQA 1GL2A 1PP9D 1AQ5A 1SQPG 1IFPA 5AW7B 1MZ9A 3HTKB 1FDMA 3M9QA 2GA1A 4KJMA 2LMLA 2HODB 3KZIE 5AVYB 3IR9A 4H0LD 1YTZT 1VQ9P 1X3OA 1Z56A 1D1DA 2FXMA 2KLVA 1VL2A 2WVRA 1Q82Q 2XNDH 2Q1KA 2DNWA 1ZRTD 1UIXA 3OA7A 1A02J 1M57D 3FXEA 1VQNP 2CPSA 1VQ6P 3CXHD 3L72J 1KQLA 5APYA 1ZMEC 5F2KA 2PGDA 1NTMK 1S5LX 3ITKA 1PZQA 3L74D 1N7SB 5BU8B 2ZJSE 2AXTH 2QM7A 1OXZA 4DOJA 1GD2E 1ACPA 2C9NY 1DIPA 1DNYA 4H13D 5JPAA 1HQBA 5CJ0A 3V5BA 2O1JA 3NTEA 2IZ1A 4JYBA 2JR8A 2M8NA 1IFNA 4H2WC 5B66E 1DD4A 2WSCJ 3I5CA 1G2CA 1RQVA 2I1KA 1N7SD 4PD4E 1USDA 3RG6C 2O3JA 3CX5I 3KPEA 3CWBE 1T8KA 2GM4A 2CQ8A 1AQTA 1G2CB 3L74G 2A06E 2N9YB 2QM8A 1MV8A 1VQ7P 3V2QA 3B5ND 4ZKUA 2E74B 3IF4A 4W7YA 4GR2A 3RL0g 3PP5A 2JWAA 2ZXEB 3W68A 2O1KA 1JY3P 4IOIH 1FOSF 3GJNA 3D6YA 2K94A 4WY4C 2NPSA 5AW4B 2RKLA 1Y47A 3LIDA 1BDDA 3HD7A 1L4AC 1U7JA 2EG5A 5AW0B 1JY3O 2BQ1E 1FZFA 2NPSB 3EFFK 2W8ZA 1L0IA 2YIUC 1GPJA 2JO1A 5GTHH 4I7ZC 3MZWB 3LW5H 3L37A 2AXCA 2YXRB 4UHPB 3HD7B 1L0ND 2AVAA 3AE5C 1OWAA 3GMAA 4U3FD 2FACA 1PV3A 3CCEP 1JY2P 2QE7H 1ZMBA 4H13C 5CBOA 1Q7YQ 1LTGC 1RF1C 3TYYA 2LL8A 1M1JC 3BRTB 4MN4C 4NPEA 1QEXA 1K8AQ 3RK3E 4N78D 3OAKA 1JY2O 3PHLA 5E79H 3B8EB 4ZKPA 2FYNB 1YJ9P 4U3FJ 1H88A 1JY3N 1OVVA 2FY8A 4U3FG 4EOTA 1OFCX 3P8CE 1URQA 1SVFA 3GHGA 1PL5A 2ZFCA 3B5NC 4U0DA 2IX7C 3RL0C 3P8MC 3M9BA 1VQPP 3CXHE 2FKWB 5HGNA 2WPVB 5AW8B 1URQB 3GHGB 3PRJA 3HUSC 4WWIA 3AECC 1KB9E 1M8OB 2NZ2A 4I2LC 3P05A 3PH0A 1RQUA 1KYOI 1N8RQ 1BE3D 2Y0DA 4YTPC 1LTJC 2FVEA 1GK4A 2K3RA 2KGAA 1P84D 2CK3H 1VQLP 1NVOA 2IYOA 4PJ0H 3Q5SA 2L9FA 3H6PA 4KT0J 1OZHA 2OYIA 2N1TA 1M56D 3D6ZA 4UB8E 3H1LD 1KQFB 2KS1A 1NH4A 4PXHB 1S9KE 2OARA 3A0HE 2G3AA 1FZAA 2M8RA 3H1KD 2FFDA 2PY8A 3CC4P 1VQ4P 2KS1B 3CE7A 1BAJA 3M1MA 2Z4EA 1DV5A 1HH0A 3MUDA 4GKGA 3KXDA 2FFDB 5DCKA 3DS1A 3DS3A 1OX3A 1FS0E 2E5YA 2E75C 5KTBA 2QJYB 3H1KJ 3VN0A 2HR3A 1SS1A 1G1JA 3T97A 3H1KG 3BCCD 3CL3D 1GZLA 5KLVE 2E76C 1SQVE 2FYUE 1EDJA 2GDYA 1VF5C 1IFDA 1L0NE 3T97B 5AW5B 3NFQA 2N5IA 2PRRA 4A7PA 2H8PD 3G9RA 1L0NK 1U7MA 2EHSA 3BCCJ 3SWKA 3A5TA 1YBKA 1EMVA 2IYPA 3N7NA 2B9BA 4LLHA 4M0IA 3BCCG 2OTKE 3NXSA 1Z6MA 3KYQA 2L5GB 4WVZA 4XFYA 4C7RA 3G4SP 4H2XC 1ZR2A 1A43A 3CX5H 2PAJA 2PEMA 3OW2O 1LWUA 4WBAA 1GTWA 2H88C 5AVQB 2V7QH 1FOSE 2KOSA 2BEQD 1NU1D 3A0BH 2BUOA 3IAOA 5EJDA 1HBWA 3JC22 1RE3A 1SFCC 2P67A 1LWUB 4XFJA 1RH5B 2WPQA 3H1JJ 2ZT9B 3AEEC 3TF5A 1WRGA 1NTKD 2W6AA 1M90Q 3AEDC 1GXGA 2C9LY 1IFJA 2OTLP 4OWFA 3B5IA 2M3EA 5CCGD 1NTMJ 2W6BA 1KILC 2XT1A 4K35A 2IFMA 4TLFA 2KOOA 1S4XA 1SQQE 1NKZB 1LTIC 5AVRB 4IFFA 4JYCA 4PD4D 2LKMA 2KYVA 3H1LE 4JF7A 1J1DC 1PPJG 2R32A 3CWBD 1AA0A 1BGYE 1GU4A 2CWOA 4R4LA 2A06D 2ZAEB 2KOQA 3S1KA 1L2PA 1RHZB 5CMZA 2PEIA 2Y9YA 3V4QA 3AEAC 3G71P 2Q9IA 2JU1A 1NGMB 4AQRD 3CD6P 5AVWB 2O01J 3I56P 3CWBJ 5CCHD 1KV4A 4PH0A 5HVCA 3G0VA 3CWBG 1FZCC 1YITP 2O01N 1YQ4C 2A06G 3EJBA 2D2CC 2X2BA 5BS1A 1ZN5A 5KAFH 1QRJA 2JO0A 1M7LA 1SQXD 1FJKA 4ZNCA 5B66H 4IL6X 1T6AA 3VP9A 3II6A 3FWLA 2P1JA 3Q5RA 5KP6B 1SQBE 1T8ZA 4HKGA 2BCCE 1KYOH 1EDLA 3CCQP 2QJKB 1QVGO 1W2EA 3GLMA 2A45G 3Q20A 3FGAD 1CEIA 2Q6QA 3GKLC 2WPSA 4WY4A 2QIWA 2NO8A 4HKZH 3G1IA 2Y0EA 2VLPA 4BWNA 2YNYA 3UIAA 3RK3D 1L4AA 2I1JA 3EQ2A 4L76A 4BPFA 4CPGA 4WY4B 5KJ7D 3VMXA 1H0TA 1GL2B 4BPGA 5H2FE 3WBHA 2POHA 2GZIA 1NU1E 1L4AB 2Z5IA 3P8CD 4COPA 2FVAA 1P84I 5F2NA 5AW3B 2YIUB 1PP9J 1H0TB 3HZQA 4I7ZB
chains in the Genus database with same CATH topology
3G6EP 1A43A 1Q86Q 3NTEA 1ZMBA 3CD6P 2M8NA 2PEMA 3DS4A 3VRLC 1K30A 1S72P 3I56P 1PEMA 3CCMP 2QA4P 1Q7YQ 3E2DA 2OARA 3OW2O 2LF4A 5HGLA 3CCUP 4PH0A 3G0VA 2PENA 1YITP 4COCA 2L6EA 2PY8A 3CC4P 3RG6C 1VQ4P 1K8AQ 4QNBA 4PH1A 1RO2A 1BAJA 3M1MA 2BUOA 1EIAA 1KD1Q 5HGOA 3CXCO 1JJ2O 3G28A 1YJ9P 3LRYA 3H0DA 5BS1A 1A8OA 1NJIQ 4U0CA 4IPYA 5HGMA 3I55P 1KQSO 1VQ7P 3CPWO 2M8PA 5DCKA 3DS1A 1QRJA 2KODA 5BS2A 3DS3A 1K9MQ 2JO0A 1YHQP 2EIAA 4GR6A 3G21A 3CCLP 3H4EA 1EOQA 3H47A 1RO0A 4GR2A 4U0DA 1VQMP 2BHVA 1VQ8P 2XXMA 3DS2A 3CCSP 2Z44A 1M90Q 5F2OA 1VQPP 2P9XA 4XFZA 3DTJA 2OTLP 3B5IA 5HGNA 3G1GA 3DPHA 1M1KQ 3CCQP 3MGEA 1QVGO 3G29A 1YJWP 2XT1A 1VQ9P 3HYBA 1KC8Q 5I4TG 1D1DA 4U0BA 3Q20A 3CMAP 2PEOA 2M8LA 3DS0A 1Q82Q 1QVFO 1RNIA 2XV6A 3P05A 4XRQA 2JYGA 3G1IA 4U0FA 3DS5A 3G26A 1N8RQ 3CC2P 1K73Q 1PEQA 1VQNP 2QEXP 1VQ6P 2Z45A 2CWOA 2EG5A 5F2KA 1VQLP 2BQ1E 1YIJP 2EFJA 4XROA 1YJNP 1Q81Q 1VQ5P 1IUQA 2E1MA 2JYLA 3WBHA 4WYMA 1VQKP 1PEOA 1PEUA 1M74A 4M0IA 1AUMA 1E6JP 4U0AA 2OTJP 2Z46A 3CCRP 2DGYA 2PEIA 1W2BO 4COPA 3CCVP 1VQOP 1M6NA 4XFYA 2PEJA 3CCJP 2ONTA 2PEQA 3G71P 1YI2P 1M6EX 5F2NA 5JPAA 3G4SP 3CMEP 3CCEP 3CC7P 4XFXA 3HZQA 4U0EA 2PEKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G6E P;  1Q86 Q;  1NJI Q;  1M1K Q;  3CCQ P;  3CD6 P;  3I55 P;  1QVG O;  1YJW P;  1KQS O;  1VQ7 P;  1VQL P;  1YIJ P;  1S72 P;  3CPW O;  1VQ9 P;  3I56 P;  3CCM P;  1KC8 Q;  2QA4 P;  1YJN P;  1Q7Y Q;  3CMA P;  3OW2 O;  1Q81 Q;  1VQ5 P;  1K9M Q;  1YHQ P;  1VQK P;  3CCL P;  1Q82 Q;  3CCU P;  2OTL P;  1QVF O;  1YIT P;  2OTJ P;  1VQM P;  3CC4 P;  3CCR P;  1VQ8 P;  1VQ4 P;  1K8A Q;  1N8R Q;  1W2B O;  3CC2 P;  1K73 Q;  3CCV P;  3CCS P;  1VQO P;  1M90 Q;  3CCJ P;  1VQP P;  1KD1 Q;  3G71 P;  1YI2 P;  3CXC O;  3G4S P;  1VQN P;  3CME P;  2QEX P;  1JJ2 O;  1YJ9 P;  3CCE P;  3CC7 P;  1VQ6 P; 
#chains in the Genus database with same CATH topology
 2AF8 A;  2KIK A;  1UJZ A;  1Q86 Q;  2R5B A;  1PP9 G;  1EZV D;  1NU1 K;  1RF1 A;  4RKU J;  2MKV A;  4GOE A;  1NTK E;  1M1J A;  5B5E E;  3M0D C;  3NMD A;  1KB9 D;  5CCH C;  2L6E A;  1BXI A;  5APQ A;  2XZ1 C;  1J1E C;  4Y99 C;  1JJ2 O;  1KN7 A;  1JTH A;  1RF1 B;  1GXH A;  3E1I A;  1NTK K;  3RK2 C;  5KLI C;  5APW A;  2KSE A;  1DEE G;  1FDO A;  3GG2 A;  5KKZ B;  4OGQ C;  4F37 A;  3B5N A;  3H47 A;  3LIE A;  1RE4 C;  4H44 C;  1CI6 A;  3L74 J;  2N6Y A;  2JWD A;  2JBG A;  1LT9 C;  4R4M A;  3RL0 B;  4DG9 A;  5I4T G;  2K9J A;  1S9K D;  5AW1 B;  2M8L A;  1CI6 B;  1IC2 A;  1QVF O;  1RNI A;  2HG5 D;  4C46 A;  4XRQ A;  2K93 A;  3G26 A;  1D7M A;  2L4B A;  2M0B A;  1LTJ A;  3NTN A;  1S1C X;  3M0A A;  3L36 A;  2K9J B;  3W67 A;  3CXH H;  1T3J A;  1HGV A;  3RK3 C;  2WSC H;  1J2J B;  2MVU A;  1X0T A;  5AW2 B;  2E74 D;  2OYH C;  5DJT B;  1OVU A;  3F89 A;  4H0L C;  4PV1 B;  2N6Z A;  1Q90 D;  3D70 A;  1X8Y A;  1VKU A;  1USE A;  5KP7 B;  4U0E A;  3AE2 C;  2XZR A;  1CW5 A;  1FZE A;  3V6I A;  5KLV D;  3H1H E;  1SQX E;  3Q2Y A;  1L0L E;  1SQV D;  1WT6 A;  2WSE J;  2FYU D;  3CCU P;  1S5L H;  1LT1 A;  1UNK A;  4GDO A;  4R0M A;  3FWN A;  2Q7C A;  1KD1 Q;  5HGO A;  2LXC B;  2UWJ E;  2JQ4 A;  3CLQ A;  1RF0 C;  1SQX K;  2WZ7 A;  3L35 A;  2NPS D;  2AXT E;  3VP8 A;  1GW4 A;  2B87 A;  3V2P A;  4IL6 E;  3SFE C;  5KLV J;  1VQM P;  5HV8 A;  1SQV J;  3HD7 D;  3VTP C;  5KLV G;  3A7O A;  1N7S C;  1SQV G;  3AEF C;  1L0N J;  3PTZ A;  2E75 B;  2B87 B;  3PJS K;  1OW6 A;  1L0N G;  1FBM A;  2WSE H;  3TDK A;  2JKV A;  3PLN A;  1JMM A;  3L72 E;  2XV6 A;  2AFD A;  2JGP A;  2K0Y A;  1NKN A;  3A2A A;  3VMY A;  2E76 B;  1LNQ A;  3JSV C;  4XE5 B;  2YKP A;  1QL2 A;  1VF5 B;  1EZV E;  4L75 A;  2WIT A;  3H32 A;  2QRX A;  3EFG A;  3R2P A;  3B71 A;  2E1M A;  5BVZ A;  2H89 C;  2LKI A;  5KAI H;  2OQQ A;  1E6J P;  2XKM A;  4U0A A;  4O9B A;  1FC2 C;  3H32 B;  2KNC A;  2ONT A;  2PEQ A;  1SP4 A;  3CC7 P;  4XFX A;  2IZ0 A;  2PEK A;  2DW3 A;  5EW5 E;  2R44 A;  1URQ D;  2IBZ E;  4GT1 A;  2QSI A;  1FJP A;  4N6J A;  4WB4 A;  1SQQ D;  2C0W A;  1MKM A;  1SFC A;  3H25 A;  1BE3 J;  1GMJ A;  3EJD A;  1NJI Q;  1PGP A;  2BAS A;  5GTH E;  3S4R A;  2OYI B;  1F80 D;  1BGY D;  1BE3 G;  5BS2 A;  2KP8 A;  2N1T B;  1AVO A;  2A45 I;  3WUU A;  2NPS C;  2BHV A;  1SFC B;  2G8Y A;  3WUT A;  1HGZ A;  2Q3I A;  1M1K Q;  1KIL A;  2ITA A;  3RBZ A;  2M3B A;  1N86 A;  1YJW P;  1LGH B;  2WSF J;  3H1L J;  2LR2 A;  1BGY J;  3MD0 A;  3H1L G;  1BCC E;  3LMO A;  3MGN A;  3TK1 A;  1KIL B;  1BGY G;  4YXD C;  2E5T A;  2GUS A;  3U1A A;  2KZJ A;  5AVT B;  2Z45 A;  2GZE A;  2KGD A;  1IMQ A;  3B4S A;  2EFJ A;  1P84 H;  1HF9 A;  2FQ1 A;  1LTT C;  2XU6 A;  1S2E A;  4DCK A;  2ERH A;  2KSJ A;  4WYM A;  2P7J A;  5GTI H;  5AW6 B;  1M74 A;  4EDF A;  1J1D B;  2MY5 A;  2CGQ A;  1W2B O;  2JP3 A;  3L71 E;  2Y9Z A;  5KLV K;  1QGK B;  1YI2 P;  1SQV K;  2FYU K;  3QH9 A;  1NOH A;  2WSF H;  2K2Q A;  3SSU A;  4D6T E;  3TGU E;  5M1B A;  1JCC A;  1SQB D;  1ZV8 A;  2BCC D;  4TT3 H;  2KZI A;  2K5X A;  2JAZ A;  1FZC A;  2L91 A;  1NHL A;  2Z5H A;  3U1C A;  4PWV B;  1VHN A;  3U59 A;  4QNB A;  1AVY A;  3CXH I;  3WUV A;  3JCU E;  5CHX A;  5APS A;  4PJ0 E;  1IMP A;  2HYN A;  2KLU A;  2GZF A;  1EDK A;  1FZC B;  2I8D A;  4U0C A;  1KQS O;  5CBN A;  2R3S A;  4KHX A;  1YQ3 C;  1EC5 A;  2HFE D;  1E5W A;  1SQB J;  3SFD C;  5EFW B;  4ASV A;  1KQG B;  3FX0 A;  1SQB G;  2XNX A;  3KQG A;  5F2O A;  5APV A;  2JJL A;  2BCC G;  1IFM A;  1OR5 A;  1FR2 A;  2FXO A;  3L70 E;  1FZG A;  3Q3D A;  1T3U A;  2FAE A;  4NPF X;  2E42 A;  4Y28 J;  3VMA A;  1OW7 A;  2GDW A;  3H1I D;  5APT A;  1K04 A;  1NU1 J;  1X79 B;  2B89 A;  2H43 A;  1NU1 G;  3P32 A;  3SWF A;  1KFM A;  2WTY A;  1W5C E;  1IFI A;  2ZT9 D;  1AUM A;  2J5U A;  1IO4 A;  4HB1 A;  4AUW A;  1ZP0 C;  2K9Y A;  2P2U A;  2PFX A;  4BPH A;  2RH0 A;  3Q1M A;  4YXW H;  1NTK J;  1AYI A;  3WMM 0;  1E0H A;  1NTK G;  1SQQ K;  4XA4 A;  1PEM A;  2QA4 P;  3QWO C;  3VOP A;  3HRN A;  3KZI H;  5HGL A;  3M0D A;  5CCH A;  4COC A;  3WU2 E;  3EJE A;  1QX8 A;  4EIJ A;  3VMZ A;  3MTU E;  3G28 A;  1YYC A;  2N5H A;  1A02 F;  3H0D A;  3GW6 A;  2WPR A;  1ZLL A;  1LTA C;  5L8R J;  2WQY C;  5CZD B;  3U43 A;  2MF4 A;  1K9M Q;  1J1E B;  4BRY A;  4NPD A;  1H89 A;  1RE4 A;  1RY3 A;  3RK2 B;  5KLI B;  3CX5 E;  2P10 A;  1FDI A;  3V4W A;  1LT9 A;  2WT7 A;  3USS A;  4BRY B;  2P58 A;  2QG4 A;  4H44 B;  1JCD A;  3HE4 A;  1HJ0 A;  5AVU B;  2PEO A;  2ZYD A;  2OGU A;  3DS0 A;  3H1H D;  1LT9 B;  1L0L D;  2WT7 B;  1KIL E;  4U0F A;  2LPK A;  3L73 E;  4PD4 H;  2QEX P;  1NTZ E;  3L75 E;  3HE4 B;  2O01 H;  1SQP D;  3HE5 A;  1GK6 A;  2WSS H;  1YIJ P;  2KUB A;  5CCG C;  2OYH A;  3BVH A;  5APX A;  2VSQ A;  3CCV P;  1SQB K;  1HVV A;  1DX7 A;  2KG8 A;  1SQX J;  1L0L J;  1M6E X;  2KOP A;  2PP6 A;  3CME P;  1AJY A;  1CZQ A;  1NAY A;  3H1H G;  2OYH B;  1MFT A;  1SQX G;  1L0L G;  4M3L A;  1NQ4 A;  1IK9 A;  4H0L B;  4EYY Q;  2C0X A;  2CPB A;  3DS4 A;  3VYI A;  5TIS E;  3M9H A;  2KW2 A;  3N4X A;  3L72 D;  2KR5 A;  3H1J E;  2A45 H;  1RF0 A;  1T2K D;  2IFN A;  5HGM A;  2AFE A;  4WY4 D;  4HH2 A;  3MP7 B;  3EWK A;  2K92 A;  2KOD A;  2AEF A;  1GL2 D;  3G21 A;  4BXL A;  3TSI A;  1NTM E;  1L4A D;  2XXM A;  1GU5 A;  4K3A A;  3H1I E;  1S3J A;  4H13 B;  1H8A A;  2MJZ A;  1N7S A;  2SPZ A;  1X22 A;  1KTM A;  4HYT B;  3G1G A;  3DPH A;  4DZO A;  4Z1M H;  1M1J B;  1PPJ E;  3L72 G;  1DD3 A;  2PNG A;  2IBZ D;  5DJU B;  3FXD A;  3V2N A;  2JDI H;  2XDJ A;  4YPC A;  1BSH A;  1JTH B;  1EZV G;  4IL6 H;  5KAF E;  4OH8 B;  4W7Z A;  1U57 A;  2K0D X;  3HUS A;  1ZXG A;  4IZ6 A;  3B5N B;  1HUC A;  4XRO A;  1DEB A;  4UB6 E;  1E79 H;  2FVF A;  1YJN P;  4JPZ B;  1N73 C;  4OVN F;  1IUQ A;  2EHT A;  2QJP C;  1N7L A;  2N50 A;  4ASW A;  1KYO E;  3AE1 C;  3HUS B;  2IBZ G;  3BRV B;  1XTG B;  2WMM A;  1FZB A;  2R5D A;  2B88 A;  5TJH A;  3CCM P;  3RL0 D;  2LF4 A;  2QJK C;  5KJ7 C;  1LTJ B;  2YMK A;  1CSB A;  4QKO A;  3P7K A;  2VLN A;  1MZ8 A;  3LW5 J;  1KB9 H;  2WWW A;  1ZW0 A;  1AF8 A;  1BCC D;  2MVV A;  2KWL A;  3M91 A;  3I55 P;  1T2K C;  1VPC A;  2W27 A;  3G3Z A;  2EIA A;  2LOL A;  4PV1 D;  1GL2 C;  2MD9 A;  2Z44 A;  5AVV B;  4XFZ A;  1SQP E;  3DTJ A;  3L71 D;  1L0L K;  2HPC A;  1BCC J;  4ZMD A;  3BAS A;  1KC8 Q;  3CMA P;  4UB8 H;  4D6T D;  3TGU D;  1BCC G;  3O8Z A;  1SQP K;  3AE3 C;  4CA3 A;  3A0H H;  2HPC B;  2FYU J;  2LIU A;  3AE8 C;  3Q5P A;  1UII A;  1PGQ A;  2FYU G;  3MHV A;  1VDF A;  3L71 J;  3C1L A;  1PP9 E;  3AE6 C;  3L71 G;  3RG2 A;  1IJD B;  4QMA A;  2Z46 A;  3TGU J;  4D6T J;  2DGY A;  1NYH A;  3K5B A;  1VQO P;  3CCJ P;  5APU A;  3KDP B;  3MIW A;  5KKZ C;  2L0Q A;  1FAV A;  3TGU G;  4D6T G;  2KK7 A;  1Y8A A;  2RN0 A;  2GZJ A;  2E75 D;  4EI2 A;  2KG6 A;  2J59 M;  3VRL C;  1YTZ I;  4IFD K;  3L70 D;  2V4H A;  2CG5 B;  1ZRT E;  4PD4 I;  4PH1 A;  1RO2 A;  2YXQ B;  4LGD E;  2GDX A;  1LP1 A;  2E76 D;  1AV1 A;  2E74 C;  2KGE A;  1VF5 D;  2IPP A;  2R3C A;  2KOG A;  4U7J A;  1Y9B A;  3L74 E;  1LP1 B;  1YHQ P;  2FHS C;  2KNC B;  4JQ0 D;  4LC1 A;  3L70 J;  1R5L A;  2MR7 A;  1JY2 N;  3IFM A;  4L73 A;  3L70 G;  4MRT C;  4PV1 C;  2KB7 P;  4GIF A;  1DH3 A;  3JCU H;  3MGE A;  1S5L E;  2BEZ F;  2K1A A;  1LTB C;  2OYO A;  1EDI A;  2QVA A;  5C39 A;  1EQ7 A;  1IZN B;  1HTL C;  1ZOY C;  2FYZ A;  3CC2 P;  2RMZ A;  2J58 A;  1OW8 A;  1PEQ A;  1SQQ J;  3E1R A;  3HD7 C;  2ROQ A;  2KOR A;  3A3Y B;  1EXI A;  1MUU A;  1GDT A;  1SQQ G;  2Q3E A;  1Q81 Q;  2N1T D;  2JYL A;  1VQK P;  1IK7 A;  1JEK A;  5E79 E;  1KMI Z;  4JBZ A;  1SFC D;  4DT0 A;  3B4Q A;  2KG9 A;  3M06 A;  3OJA B;  2YKO A;  2FQ0 A;  3CX5 D;  1JB0 J;  2QNW A;  1N2D C;  2VLQ A;  3O6Q A;  1K30 A;  4RJT A;  2FYN C;  1ZNV A;  3C8V A;  3ABV C;  2AEJ A;  2W90 A;  3AE4 C;  1SLQ A;  3CI9 A;  5BU5 A;  1ZR4 A;  2VRS A;  3RBX A;  2K0X A;  2Y0C A;  1KIL D;  3O6Q B;  3CXC O;  1QL1 A;  1KLP A;  1LJ2 A;  3AEB C;  3LRY A;  1JMB A;  3L73 D;  1OIP A;  1NTZ D;  4L74 A;  4IPY A;  3L75 D;  5KAI E;  5K5G B;  1NO4 A;  2M8P A;  1KZU B;  1HY8 A;  3H4E A;  3BAT A;  1URQ C;  3GHG C;  4U3F E;  1VQ8 P;  7CEI A;  2GYK A;  3DS2 A;  3GZM A;  2V7Q J;  2P9X A;  3WU2 H;  2W83 C;  1EZV I;  1WMK A;  1JM0 A;  2ZVO B;  4RO0 A;  2JB0 A;  2ZYA A;  3AEG C;  3G29 A;  2KGC A;  1KB9 I;  3L73 J;  2WPT A;  1NTZ J;  3L75 J;  1AFO A;  4H2Y C;  2FBW C;  1XTC C;  4I6M C;  4N78 E;  1FU1 A;  4RES B;  1BDC A;  2BCC J;  3L73 G;  2JYG A;  3DS5 A;  1NTZ G;  2D2C B;  3L75 G;  1K73 Q;  4HJG H;  2FAD A;  2N98 A;  2YMY A;  3H1J D;  2IBZ I;  1EXJ A;  4B86 A;  1PIX A;  2HLO A;  4NEO A;  5CCG A;  3GF3 A;  2Q5U A;  3TNU A;  2JU2 A;  2W6J H;  2JEE A;  3E7K A;  4GOD A;  2OTJ P;  2OYI C;  1K05 A;  2D2C D;  2N1T C;  1M6N A;  1QLE D;  2PEJ A;  1NTM D;  2IDB A;  5CJ4 A;  3D71 A;  2ZXX A;  3TNU B;  4N3Y B;  2AEM A;  1S72 P;  2E43 A;  3E2D A;  1PPJ D;  1OVR A;  3GF7 A;  1BE3 E;  4C7N A;  3H1J G;  2FFD C;  1NWQ A;  1LTS C;  3NY7 B;  2QJY C;  2MR8 A;  1P84 E;  1R8E A;  1JO5 A;  2ZYG A;  1PFI A;  3MUD C;  2FXP A;  5GTI E;  1PGJ A;  3F5H A;  3H1I J;  3CPW O;  4C7N B;  3S9O A;  1NTM G;  1OMI A;  3H1I G;  2YKQ A;  1RO0 A;  1JNM A;  5TIS H;  5H2F H;  3CCS P;  1KFN A;  1HWT C;  1KYO D;  2XZ0 D;  1BSN A;  2LXB A;  1G1I A;  2N9B A;  2LTE A;  1KOR A;  3HYB A;  3H1K E;  2GZG A;  4U0B A;  2CNR A;  4DJG A;  4Y99 B;  2GUV A;  1JUN A;  2H7H A;  2KI7 B;  3SWY A;  4IFM A;  5B5E H;  5KP8 B;  4OGQ B;  2VLO A;  4AYC A;  1MFZ A;  1N73 A;  1VQ5 P;  2ZVN B;  1GW3 A;  2YO2 A;  3A0B E;  1PEO A;  1PEU A;  1L0H A;  2L22 A;  3IN6 A;  1PGO A;  2KXP B;  2LIW A;  3CCR P;  2K88 A;  3C9I A;  3RK2 D;  4GOF A;  3BCC E;  1N73 B;  2YO3 A;  3G6E P;  3L4F A;  2QJP B;  4OGQ D;  3AE7 C;  1X9V A;  1FE6 A;  2M5A A;  2NRG A;  3RGU A;  5AW9 B;  2FQ2 A;  4H44 D;  5AVS B;  5AVX B;  5KJ7 A;  1LWU C;  4UB6 H;  4W80 A;  2PEN A;  1Q2N A;  2XV5 A;  1NTZ K;  5AVZ B;  2K37 A;  4I1L A;  1JOC A;  1EIA A;  3H1H J;  3HE5 B;  3RK3 B;  2ZT9 C;  2M5A B;  3V2R A;  3ZDM A;  1RE3 C;  1A8O A;  3KHU A;  3HTK A;  1TU3 F;  3R4Y A;  3AE9 C;  1NAF A;  1SQP J;  2M5R A;  4GR6 A;  2HOD A;  1HJB A;  3CCL P;  3GZL A;  1R5S A;  1EOQ A;  1GL2 A;  1PP9 D;  1AQ5 A;  1SQP G;  1IFP A;  5AW7 B;  1MZ9 A;  3HTK B;  1FDM A;  3M9Q A;  2GA1 A;  4KJM A;  2LML A;  2HOD B;  3KZI E;  5AVY B;  3IR9 A;  4H0L D;  1YTZ T;  1VQ9 P;  1X3O A;  1Z56 A;  1D1D A;  2FXM A;  2KLV A;  1VL2 A;  2WVR A;  1Q82 Q;  2XND H;  2Q1K A;  2DNW A;  1ZRT D;  1UIX A;  3OA7 A;  1A02 J;  1M57 D;  3FXE A;  1VQN P;  2CPS A;  1VQ6 P;  3CXH D;  3L72 J;  1KQL A;  5APY A;  1ZME C;  5F2K A;  2PGD A;  1NTM K;  1S5L X;  3ITK A;  1PZQ A;  3L74 D;  1N7S B;  5BU8 B;  2ZJS E;  2AXT H;  2QM7 A;  1OXZ A;  4DOJ A;  1GD2 E;  1ACP A;  2C9N Y;  1DIP A;  1DNY A;  4H13 D;  5JPA A;  1HQB A;  5CJ0 A;  3V5B A;  2O1J A;  3NTE A;  2IZ1 A;  4JYB A;  2JR8 A;  2M8N A;  1IFN A;  4H2W C;  5B66 E;  1DD4 A;  2WSC J;  3I5C A;  1G2C A;  1RQV A;  2I1K A;  1N7S D;  4PD4 E;  1USD A;  3RG6 C;  2O3J A;  3CX5 I;  3KPE A;  3CWB E;  1T8K A;  2GM4 A;  2CQ8 A;  1AQT A;  1G2C B;  3L74 G;  2A06 E;  2N9Y B;  2QM8 A;  1MV8 A;  1VQ7 P;  3V2Q A;  3B5N D;  4ZKU A;  2E74 B;  3IF4 A;  4W7Y A;  4GR2 A;  3RL0 g;  3PP5 A;  2JWA A;  2ZXE B;  3W68 A;  2O1K A;  1JY3 P;  4IOI H;  1FOS F;  3GJN A;  3D6Y A;  2K94 A;  4WY4 C;  2NPS A;  5AW4 B;  2RKL A;  1Y47 A;  3LID A;  1BDD A;  3HD7 A;  1L4A C;  1U7J A;  2EG5 A;  5AW0 B;  1JY3 O;  2BQ1 E;  1FZF A;  2NPS B;  3EFF K;  2W8Z A;  1L0I A;  2YIU C;  1GPJ A;  2JO1 A;  5GTH H;  4I7Z C;  3MZW B;  3LW5 H;  3L37 A;  2AXC A;  2YXR B;  4UHP B;  3HD7 B;  1L0N D;  2AVA A;  3AE5 C;  1OWA A;  3GMA A;  4U3F D;  2FAC A;  1PV3 A;  3CCE P;  1JY2 P;  2QE7 H;  1ZMB A;  4H13 C;  5CBO A;  1Q7Y Q;  1LTG C;  1RF1 C;  3TYY A;  2LL8 A;  1M1J C;  3BRT B;  4MN4 C;  4NPE A;  1QEX A;  1K8A Q;  3RK3 E;  4N78 D;  3OAK A;  1JY2 O;  3PHL A;  5E79 H;  3B8E B;  4ZKP A;  2FYN B;  1YJ9 P;  4U3F J;  1H88 A;  1JY3 N;  1OVV A;  2FY8 A;  4U3F G;  4EOT A;  1OFC X;  3P8C E;  1URQ A;  1SVF A;  3GHG A;  1PL5 A;  2ZFC A;  3B5N C;  4U0D A;  2IX7 C;  3RL0 C;  3P8M C;  3M9B A;  1VQP P;  3CXH E;  2FKW B;  5HGN A;  2WPV B;  5AW8 B;  1URQ B;  3GHG B;  3PRJ A;  3HUS C;  4WWI A;  3AEC C;  1KB9 E;  1M8O B;  2NZ2 A;  4I2L C;  3P05 A;  3PH0 A;  1RQU A;  1KYO I;  1N8R Q;  1BE3 D;  2Y0D A;  4YTP C;  1LTJ C;  2FVE A;  1GK4 A;  2K3R A;  2KGA A;  1P84 D;  2CK3 H;  1VQL P;  1NVO A;  2IYO A;  4PJ0 H;  3Q5S A;  2L9F A;  3H6P A;  4KT0 J;  1OZH A;  2OYI A;  2N1T A;  1M56 D;  3D6Z A;  4UB8 E;  3H1L D;  1KQF B;  2KS1 A;  1NH4 A;  4PXH B;  1S9K E;  2OAR A;  3A0H E;  2G3A A;  1FZA A;  2M8R A;  3H1K D;  2FFD A;  2PY8 A;  3CC4 P;  1VQ4 P;  2KS1 B;  3CE7 A;  1BAJ A;  3M1M A;  2Z4E A;  1DV5 A;  1HH0 A;  3MUD A;  4GKG A;  3KXD A;  2FFD B;  5DCK A;  3DS1 A;  3DS3 A;  1OX3 A;  1FS0 E;  2E5Y A;  2E75 C;  5KTB A;  2QJY B;  3H1K J;  3VN0 A;  2HR3 A;  1SS1 A;  1G1J A;  3T97 A;  3H1K G;  3BCC D;  3CL3 D;  1GZL A;  5KLV E;  2E76 C;  1SQV E;  2FYU E;  1EDJ A;  2GDY A;  1VF5 C;  1IFD A;  1L0N E;  3T97 B;  5AW5 B;  3NFQ A;  2N5I A;  2PRR A;  4A7P A;  2H8P D;  3G9R A;  1L0N K;  1U7M A;  2EHS A;  3BCC J;  3SWK A;  3A5T A;  1YBK A;  1EMV A;  2IYP A;  3N7N A;  2B9B A;  4LLH A;  4M0I A;  3BCC G;  2OTK E;  3NXS A;  1Z6M A;  3KYQ A;  2L5G B;  4WVZ A;  4XFY A;  4C7R A;  3G4S P;  4H2X C;  1ZR2 A;  1A43 A;  3CX5 H;  2PAJ A;  2PEM A;  3OW2 O;  1LWU A;  4WBA A;  1GTW A;  2H88 C;  5AVQ B;  2V7Q H;  1FOS E;  2KOS A;  2BEQ D;  1NU1 D;  3A0B H;  2BUO A;  3IAO A;  5EJD A;  1HBW A;  3JC2 2;  1RE3 A;  1SFC C;  2P67 A;  1LWU B;  4XFJ A;  1RH5 B;  2WPQ A;  3H1J J;  2ZT9 B;  3AEE C;  3TF5 A;  1WRG A;  1NTK D;  2W6A A;  1M90 Q;  3AED C;  1GXG A;  2C9L Y;  1IFJ A;  2OTL P;  4OWF A;  3B5I A;  2M3E A;  5CCG D;  1NTM J;  2W6B A;  1KIL C;  2XT1 A;  4K35 A;  2IFM A;  4TLF A;  2KOO A;  1S4X A;  1SQQ E;  1NKZ B;  1LTI C;  5AVR B;  4IFF A;  4JYC A;  4PD4 D;  2LKM A;  2KYV A;  3H1L E;  4JF7 A;  1J1D C;  1PPJ G;  2R32 A;  3CWB D;  1AA0 A;  1BGY E;  1GU4 A;  2CWO A;  4R4L A;  2A06 D;  2ZAE B;  2KOQ A;  3S1K A;  1L2P A;  1RHZ B;  5CMZ A;  2PEI A;  2Y9Y A;  3V4Q A;  3AEA C;  3G71 P;  2Q9I A;  2JU1 A;  1NGM B;  4AQR D;  3CD6 P;  5AVW B;  2O01 J;  3I56 P;  3CWB J;  5CCH D;  1KV4 A;  4PH0 A;  5HVC A;  3G0V A;  3CWB G;  1FZC C;  1YIT P;  2O01 N;  1YQ4 C;  2A06 G;  3EJB A;  2D2C C;  2X2B A;  5BS1 A;  1ZN5 A;  5KAF H;  1QRJ A;  2JO0 A;  1M7L A;  1SQX D;  1FJK A;  4ZNC A;  5B66 H;  4IL6 X;  1T6A A;  3VP9 A;  3II6 A;  3FWL A;  2P1J A;  3Q5R A;  5KP6 B;  1SQB E;  1T8Z A;  4HKG A;  2BCC E;  1KYO H;  1EDL A;  3CCQ P;  2QJK B;  1QVG O;  1W2E A;  3GLM A;  2A45 G;  3Q20 A;  3FGA D;  1CEI A;  2Q6Q A;  3GKL C;  2WPS A;  4WY4 A;  2QIW A;  2NO8 A;  4HKZ H;  3G1I A;  2Y0E A;  2VLP A;  4BWN A;  2YNY A;  3UIA A;  3RK3 D;  1L4A A;  2I1J A;  3EQ2 A;  4L76 A;  4BPF A;  4CPG A;  4WY4 B;  5KJ7 D;  3VMX A;  1H0T A;  1GL2 B;  4BPG A;  5H2F E;  3WBH A;  2POH A;  2GZI A;  1NU1 E;  1L4A B;  2Z5I A;  3P8C D;  4COP A;  2FVA A;  1P84 I;  5F2N A;  5AW3 B;  2YIU B;  1PP9 J;  1H0T B;  3HZQ A;  4I7Z B; 
#chains in the Genus database with same CATH homology
 3G6E P;  1A43 A;  1Q86 Q;  3NTE A;  1ZMB A;  3CD6 P;  2M8N A;  2PEM A;  3DS4 A;  3VRL C;  1K30 A;  1S72 P;  3I56 P;  1PEM A;  3CCM P;  2QA4 P;  1Q7Y Q;  3E2D A;  2OAR A;  3OW2 O;  2LF4 A;  5HGL A;  3CCU P;  4PH0 A;  3G0V A;  2PEN A;  1YIT P;  4COC A;  2L6E A;  2PY8 A;  3CC4 P;  3RG6 C;  1VQ4 P;  1K8A Q;  4QNB A;  4PH1 A;  1RO2 A;  1BAJ A;  3M1M A;  2BUO A;  1EIA A;  1KD1 Q;  5HGO A;  3CXC O;  1JJ2 O;  3G28 A;  1YJ9 P;  3LRY A;  3H0D A;  5BS1 A;  1A8O A;  1NJI Q;  4U0C A;  4IPY A;  5HGM A;  3I55 P;  1KQS O;  1VQ7 P;  3CPW O;  2M8P A;  5DCK A;  3DS1 A;  1QRJ A;  2KOD A;  5BS2 A;  3DS3 A;  1K9M Q;  2JO0 A;  1YHQ P;  2EIA A;  4GR6 A;  3G21 A;  3CCL P;  3H4E A;  1EOQ A;  3H47 A;  1RO0 A;  4GR2 A;  4U0D A;  1VQM P;  2BHV A;  1VQ8 P;  2XXM A;  3DS2 A;  3CCS P;  2Z44 A;  1M90 Q;  5F2O A;  1VQP P;  2P9X A;  4XFZ A;  3DTJ A;  2OTL P;  3B5I A;  5HGN A;  3G1G A;  3DPH A;  1M1K Q;  3CCQ P;  3MGE A;  1QVG O;  3G29 A;  1YJW P;  2XT1 A;  1VQ9 P;  3HYB A;  1KC8 Q;  5I4T G;  1D1D A;  4U0B A;  3Q20 A;  3CMA P;  2PEO A;  2M8L A;  3DS0 A;  1Q82 Q;  1QVF O;  1RNI A;  2XV6 A;  3P05 A;  4XRQ A;  2JYG A;  3G1I A;  4U0F A;  3DS5 A;  3G26 A;  1N8R Q;  3CC2 P;  1K73 Q;  1PEQ A;  1VQN P;  2QEX P;  1VQ6 P;  2Z45 A;  2CWO A;  2EG5 A;  5F2K A;  1VQL P;  2BQ1 E;  1YIJ P;  2EFJ A;  4XRO A;  1YJN P;  1Q81 Q;  1VQ5 P;  1IUQ A;  2E1M A;  2JYL A;  3WBH A;  4WYM A;  1VQK P;  1PEO A;  1PEU A;  1M74 A;  4M0I A;  1AUM A;  1E6J P;  4U0A A;  2OTJ P;  2Z46 A;  3CCR P;  2DGY A;  2PEI A;  1W2B O;  4COP A;  3CCV P;  1VQO P;  1M6N A;  4XFY A;  2PEJ A;  3CCJ P;  2ONT A;  2PEQ A;  3G71 P;  1YI2 P;  1M6E X;  5F2N A;  5JPA A;  3G4S P;  3CME P;  3CCE P;  3CC7 P;  4XFX A;  3HZQ A;  4U0E A;  2PEK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...