3CC2P

The refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution with rrna sequence for the 23s rrna and genome-derived sequences for r-proteins
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
143
structure length
143
Chain Sequence
b'TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 48
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2008-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3cc2P03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 3cc2P01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 3cc2P02
3CCJP 3CCVP 1S72P 1K8AQ 3CC7P 3CMAP 1W2BO 1VQ7P 1VQ5P 1QVGO 3CCLP 1VQOP 1M90Q 1VQ8P 3OW2O 1VQMP 3G4SP 3CCEP 2QEXP 1YJNP 1VQPP 1K73Q 1JJ2O 1N8RQ 1YJWP 2OTJP 3CCUP 1Q7YQ 1Q81Q 3G6EP 1VQ9P 1QVFO 1KD1Q 1NJIQ 3I55P 1K9MQ 1Q82Q 1VQKP 3CC2P 3CMEP 3CXCO 3G71P 2QA4P 1VQ6P 3I56P 1YI2P 3CCMP 1VQ4P 3CC4P 3CCRP 1YIJP 1Q86Q 1YHQP 1KQSO 1M1KQ 1KC8Q 1YJ9P 3CCQP 1YITP 1VQLP 3CPWO 2OTLP 3CD6P 3CCSP 1VQNP
chains in the Genus database with same CATH superfamily
1L0NE 2KG9A 1IC2A 2B89A 5KKZC 1FDIA 2A06G 3P05A 2L6EA 2MR8A 1FOSF 4WY4C 4D6TE 3H1IJ 3MGEA 1NTZD 4MN4C 1RE3C 1FBMA 3CX5H 2N1TC 2WSFJ 2QM7A 2KNCA 3VMAA 2P58A 1VQPP 5KJ7C 3B5IA 1OWAA 5HV8A 2KG8A 3B5NA 4UB6H 3H25A 1FAVA 1VF5C 2FQ0A 2MKVA 2MY5A 1H89A 2KOSA 3C8VA 3H32B 2M8PA 1DIPA 3SWFA 5F2KA 3AE2C 2GDWA 1NYHA 3P8CD 2VLNA 2AEFA 2WWWA 4C46A 1NTKD 4OH8B 1H0TA 1U57A 3HD7B 2ZT9C 1KD1Q 1BSNA 4JF7A 3SFEC 1KYOH 4A7PA 3D70A 2Z44A 1OVVA 2PEJA 2WZ7A 3A7OA 5CMZA 4PH1A 3L36A 1AUMA 4U3FJ 1NOHA 2KK7A 1KQLA 3CXHH 2FQ2A 3O6QA 5AVTB 4BRYA 4K35A 1ZN5A 1RF0A 3DTJA 2FVEA 2Q3EA 2Z5IA 1BGYE 1SQPK 4XFYA 3FXDA 1IMPA 1ZW0A 1YHQP 2YKQA 1N86A 2XV5A 2H7HA 2XXMA 4AUWA 3MZWB 3CCVP 3I5CA 5AVSB 1OX3A 1Z56A 3GZMA 2Q6QA 2E75D 3L75J 4XFJA 1NTME 2JO0A 3G71P 1KILC 5KP8B 1GW3A 3G1GA 1MKMA 2O1JA 4DCKA 3MIWA 5HGLA 1NHLA 2ONTA 2L91A 1T2KD 1JY3O 2GM4A 3TGUJ 1L0ND 4YXDC 2KGDA 2MJZA 1GU5A 2HPCB 1YTZI 1RO0A 3LW5H 1RF1A 3L72J 1T8KA 1OVUA 2K94A 1IZNB 3RL0D 2E76C 1VQNP 1QGKB 1RQUA 3Q3DA 3CC7P 1W2BO 2V7QH 1LTBC 3VN0A 3MUDA 5AVXB 1YJWP 5CCHC 5AW9B 2EHSA 2R3SA 1PGOA 2YMKA 1IFPA 2M8RA 3II6A 1U7MA 2RKLA 2XKMA 2P2UA 2EG5A 1KV4A 5APQA 2W27A 3O8ZA 2I1KA 5AVVB 3F89A 1GZLA 3Q2YA 4OGQB 1EDJA 1K04A 2B87B 4BPHA 2JWAA 2KGEA 1YBKA 3NTNA 2K92A 4F37A 3WMM0 2WMMA 5KAFH 2KLVA 1X3OA 3CXCO 5TISE 4Y99C 5CCGA 3AE5C 1HQBA 4D6TG 3DS4A 2N9YB 1E6JP 2HYNA 2VRSA 2JQ4A 1LJ2A 1KORA 1FE6A 1S5LE 5GTIH 1K8AQ 2Z4EA 4PV1C 1SQXE 2FACA 3A0HE 5CCGD 1A43A 3RK3C 1EMVA 1U7JA 2ZYGA 4IFFA 1NTMD 4CPGA 4EOTA 4W7ZA 1KC8Q 1A02J 5AW8B 2VLPA 3L73J 2KOQA 4LGDE 4U7JA 2OGUA 3PHLA 2GZIA 5GTHE 1URQD 2P67A 1HJ0A 2KNCB 3OA7A 2PP6A 1NWQA 5HGOA 2M3EA 3M0DC 3RK2D 1M6NA 2Q5UA 1VQ9P 1Q90D 2OYHA 1LP1B 4XA4A 4I7ZB 1BGYG 2R5DA 2YXRB 2JU1A 4WB4A 3WUUA 4UB8H 1H0TB 2N5HA 2PEKA 1MUUA 3RL0g 4PD4I 2DNWA 1JTHB 3U59A 2J5UA 1DNYA 1NTMG 2HODA 1PP9J 3L70J 7CEIA 3MHVA 2ERHA 3AECC 2AFEA 3ZDMA 4BRYB 2WT7A 3TSIA 2G3AA 3PH0A 5B66E 3B4QA 1FDOA 2WSFH 1S9KE 1VL2A 2E75B 3H1LJ 4N6JA 2J59M 1EXIA 4AQRD 2OTJP 3VP8A 3H1JJ 3WUTA 3RG2A 3V4WA 2K0XA 2ZJSE 1LT9C 2O01H 1PL5A 4RKUJ 1JMBA 2GYKA 1L0IA 2KZIA 3A0BE 1S2EA 1QL1A 4IL6X 1BDCA 2KGCA 3H1KG 2N5IA 3IF4A 1JEKA 5AVRB 1LWUB 1SQXD 2RMZA 3MP7B 4I2LC 2YXQB 1KQGB 2LKMA 2K0DX 3RL0B 3T97A 2H43A 3LW5J 3GW6A 1PPJE 2QNWA 1ZMBA 4IFMA 1NKNA 5L8RJ 1RE4C 4RESB 4EIJA 4H0LD 4UHPB 2V7QJ 5H2FH 3CX5E 1PEOA 1HGVA 1L0LJ 2X2BA 2EFJA 4ZKPA 2I1JA 1NH4A 1IJDB 4WY4A 3TGUD 3ITKA 1P84E 1NVOA 3HTKB 1GW4A 2M5RA 3L72D 3S9OA 2K9JA 2K3RA 5AW1B 5BU5A 1FZGA 1J1EB 1SFCA 1R8EA 1EC5A 3L37A 2QJKC 3IR9A 5AW0B 3AE1C 1A8OA 3V2PA 2A45I 1HF9A 3GHGC 1SFCD 3WU2E 3RG6C 4WWIA 1SQXG 2OYIA 2P9XA 4GOEA 1OW6A 1PZQA 1Q82Q 1NU1J 2FVAA 1HY8A 1KB9I 3DS5A 1SQVJ 3B4SA 3MD0A 3LRYA 2PEQA 3E1IA 3G21A 4U0DA 3CWBG 1RQVA 5KLVJ 1IFMA 1NTKE 1IMQA 1LTJC 2WSCJ 3CCEP 2YO3A 4GR6A 4PXHB 2FYUJ 2K9YA 2KS1A 1S9KD 1ZP0C 1RY3A 3EJDA 1DH3A 1NTMK 3FXEA 2MD9A 3HYBA 1GU4A 4EI2A 1CI6A 2NPSD 3CX5I 2JGPA 1SQQE 2W8ZA 4H44D 5APVA 4ZNCA 5AVUB 1Q81Q 3OAKA 1NJIQ 1URQB 3M1MA 1VQKP 2R32A 1L4AB 3U1CA 2WQYC 4WVZA 3AE3C 2DGYA 4U0FA 5M1BA 2BCCE 3Q5PA 3CD6P 3KDPB 3RK2B 5DCKA 1H8AA 2KSEA 5KAIE 4KT0J 5HGNA 1W2EA 3QWOC 2K88A 3HD7C 1KYOI 3CX5D 4IL6H 5F2OA 2OYHB 3JCUE 2Z45A 2OTKE 3CXHI 5EW5E 1P84D 2YMYA 5BU8B 2O1KA 2J58A 5E79H 1SQBJ 1R5SA 2E76D 3H1HJ 2Y9YA 4GKGA 2PAJA 4BPGA 2HODB 1IK9A 3W67A 2JWDA 3VMXA 3GF3A 2WT7B 1G1JA 5KP6B 2H89C 1KYOD 5B5EE 2FFDB 2H88C 4AYCA 5JPAA 2CPBA 2O01J 3AE9C 3KHUA 1BDDA 4Y28J 1PPJG 1WMKA 1PP9D 2HFED 3S1KA 3B5ND 1VQ8P 3OJAB 1W5CE 3EFFK 2W6BA 2WPSA 2W6AA 5GTIE 1J1DB 3AEBC 1KTMA 1KFMA 3KZIH 2UWJE 2D2CD 1KLPA 2FAEA 2AXTH 3CPWO 1M56D 3H1JD 1GL2A 4H0LB 1EDKA 2ITAA 3T97B 4YTPC 1ZLLA 4NEOA 1A02F 1N73A 3BATA 1SQQD 1NTZG 3EJEA 1GL2D 3NTEA 2JB0A 4C7NA 4PWVB 3TYYA 1VQMP 2BCCD 2Q3IA 5I4TG 3P7KA 1YYCA 1IFIA 2OARA 4YXWH 2N9BA 2KI7B 2P7JA 3AEFC 2K9JB 2GZEA 4LLHA 1LT1A 1VQLP 4HKZH 5F2NA 1SFCB 4TT3H 3L71J 2O01N 2XZ0D 1NTKG 3CLQA 4U0AA 1L0LD 2JKVA 1EOQA 3EWKA 3L74J 3M0DA 2W6JH 2Q7CA 4L73A 3IN6A 3HE5A 2QIWA 2OQQA 2L5GB 1SQPJ 3H1IE 1BE3J 1NAFA 2FYZA 3IAOA 3JSVC 2P10A 4XFXA 1SQQG 3WBHA 4JBZA 3TDKA 1IK7A 2GZJA 4HB1A 4JPZB 2L4BA 2R5BA 2ROQA 5HGMA 1FZCA 5APSA 1VDFA 1ACPA 1R5LA 2FADA 2KS1B 2K1AA 4H13D 2NPSB 3HRNA 2BCCG 4XE5B 1KFNA 4H44B 3AE4C 1BCCJ 1N7SA 1EDIA 1CI6B 3EJBA 3RGUA 2LMLA 2PEMA 2HR3A 2MVUA 2GDYA 2KZJA 3AE8C 4COPA 3GZLA 1N7SD 4U3FE 1L0NG 4BWNA 1BXIA 1PIXA 1EIAA 4PD4E 1PEMA 2LTEA 3BCCJ 1M1KQ 1X79B 3AEDC 4I7ZC 3IFMA 1E79H 1ZR4A 1G2CB 1QL2A 2WSCH 3RBXA 3MTUE 2KXPB 4H2WC 3HUSA 1L0HA 3SFDC 3CMEP 4HYTB 3L75E 3L4FA 3I56P 4H2XC 2K0YA 1GD2E 1S5LX 2PY8A 1HVVA 1NTZK 3AE7C 2EHTA 4BPFA 2LIUA 1M1JA 1DEBA 2M8NA 2C0WA 3H6PA 2QJPC 1QLED 2Y0CA 3G29A 2PENA 2QRXA 1SVFA 2E75C 3L74E 1M74A 3TGUE 3CL3D 4HJGH 1JY2N 4O9BA 3VTPC 3B71A 3L72E 1JCCA 5C39A 2E74D 1KZUB 1S4XA 3B5NB 1X8YA 3M91A 2XZ1C 1YQ4C 1M90Q 1LTTC 4QNBA 1D7MA 3R2PA 3H1ID 3SWKA 1NTKK 1T2KC 2BQ1E 2IZ0A 2D2CB 3GJNA 1Q86Q 1NKZB 1LWUC 2R3CA 3PTZA 1K05A 1VPCA 1T8ZA 2KG6A 5EJDA 2FHSC 3RL0C 3U43A 1D1DA 1E5WA 5APWA 3OW2O 2QJYB 5CJ4A 1ZR2A 3F5HA 2IX7C 4W7YA 1FC2C 1RF1C 4PH0A 2CWOA 2WSEJ 1F80D 3CC2P 1SQQK 3BASA 2Z5HA 1X0TA 2PFXA 3O6QB 1DX7A 4XRQA 1DEEG 3QH9A 2QJPB 2HLOA 1N73B 1FDMA 4DT0A 5BS2A 4OGQD 1RH5B 1VQ5P 1HUCA 2JDIH 2KP8A 3MUDC 1PEUA 1JY2P 2IBZE 2FVFA 3KXDA 4U3FD 4C7NB 3V5BA 2JEEA 1SLQA 1J1EC 1KQSO 2JU2A 1QX8A 4PD4D 2CK3H 5AVYB 3BCCE 1YITP 4R4MA 1KB9E 3H1IG 2LKIA 1T6AA 2KUBA 2GZGA 3TF5A 1AA0A 2L9FA 4IL6E 3N4XA 3H32A 2CPSA 1L0NK 3D6YA 5CJ0A 3C9IA 2RH0A 1IO4A 1OXZA 2NRGA 2LL8A 1AVOA 3AEEC 5CBOA 3HD7A 2AEJA 3DS1A 4R4LA 3R4YA 3L75D 1AF8A 1RHZB 5TJHA 2YKPA 5E79E 1RF1B 2VLOA 2IPPA 3HE5B 3FWNA 3L73E 4LC1A 2FBWC 2HG5D 5CCGC 2ZXXA 2YIUB 3LIEA 2Q9IA 3CCRP 3DS0A 4H13B 3L74D 3BVHA 4N3YB 1OFCX 4UB6E 1ZOYC 1RE3A 4PJ0H 1VQOP 4U3FG 2QSIA 5BVZA 2N1TA 1FZCB 4I6MC 4WY4D 2WPVB 5KJ7A 1S5LH 3Q20A 3JC22 2JP3A 3A0HH 1URQC 1OVRA 1L4AC 2N1TD 3G9RA 1N7SB 3CCJP 2RN0A 3Q5RA 3AEAC 2IBZI 1KYOE 2XNDH 5KJ7D 3KZIE 2N98A 1Z6MA 5APUA 2AXTE 4WBAA 4D6TJ 1CSBA 1LTIC 3RK2C 1LGHB 1VF5D 2C9LY 1IFJA 3CXHE 1KMIZ 4NPDA 4QMAA 3L75G 1VQ4P 5APXA 2MR7A 1PP9E 3L70E 2E42A 3TNUA 2DW3A 2B9BA 4HH2A 3LMOA 3G28A 4IFDK 5GTHH 4XROA 1S3JA 2YKOA 3GMAA 2PGDA 2AXCA 2ZT9D 2OYHC 1NQ4A 3A5TA 1Q7YQ 3SSUA 5APYA 3H1LE 1AJYA 3EFGA 5AW4B 1JMMA 3TGUG 3NY7B 3H1JE 2IBZD 2BASA 1GK6A 5HVCA 2JAZA 1PV3A 3L72G 3HUSB 3E2DA 1AYIA 3S4RA 3CMAP 3L35A 1J2JB 2KR5A 3BCCD 4N78D 1PFIA 1KN7A 1KB9D 1PGJA 4DZOA 1M1JB 2GZFA 2KLUA 4HKGA 1JY3N 4Z1MH 1HJBA 1KILA 1AV1A 1EZVE 1FS0E 3WUVA 2E74B 2FFDC 3RK3E 4DOJA 1S72P 3MGNA 3HZQA 3AE6C 3P8MC 2LOLA 5AVQB 1XTGB 1BGYJ 1AFOA 3SWYA 5B66H 1KILD 2B87A 3I55P 1K9MQ 1K30A 1PGPA 1JB0J 3CI9A 3L73D 2E5TA 2IYPA 4IOIH 1J1DC 2EIAA 1L0LE 2IDBA 2ZXEB 1WT6A 4OWFA 1GDTA 1NTMJ 1AQTA 4ASVA 3PJSK 1OMIA 2JO1A 5K5GB 2A45G 2IBZG 4L76A 4H0LC 5CBNA 3A0BH 5CCHA 3RBZA 2O3JA 1BSHA 4B86A 4WYMA 2KGAA 1VQ7P 1QVGO 2YO2A 1IUQA 5CCHD 1JY3P 3B8EB 2XT1A 2QE7H 2QVAA 3V6IA 1M7LA 1OIPA 3LIDA 1NU1E 4ASWA 3CXHD 1ZMEC 3M9BA 5KAFE 2OTLP 1SQVE 3H1KJ 4W80A 5KLIB 2BEZF 3L70D 1DV5A 3G3ZA 5KLVE 2QEXP 1SFCC 3EQ2A 1KQFB 3GKLC 3L73G 1P84H 1EZVI 1SQXK 1X9VA 2FYUE 1VQ6P 1OR5A 1VHNA 2Z46A 3D71A 2JBGA 3H1LD 1GTWA 1LP1A 2MF4A 5BS1A 2OYIC 1PEQA 3VP9A 1CW5A 1OW7A 2M8LA 2AVAA 2WSEH 1ZXGA 4DJGA 2N50A 2K2QA 3WU2H 4ZKUA 4EYYQ 1JTHA 1USDA 4YPCA 5KTBA 2N6ZA 1Y9BA 3USSA 2VLQA 5KKZB 4PV1D 3AEGC 1VKUA 1EZVD 1HH0A 2C0XA 2KYVA 3M06A 2C9NY 2IFMA 3RK3D 2NPSC 4WY4B 2LR2A 1QRJA 4H44C 5CHXA 2Y0EA 2N1TB 1PP9G 3L70G 1XTCC 1SQXJ 1FZAA 2PNGA 2ZFCA 3DS3A 1HGZA 1FJPA 3TK1A 2FXOA 2BHVA 2K5XA 1VF5B 4UB8E 2GUSA 4M3LA 1USEA 1HWTC 3GG2A 3H1LG 2IYOA 3CWBJ 3VOPA 3H1JG 3E1RA 2OYIB 2KOGA 1LWUA 1SQBE 3G26A 1NO4A 2KWLA 3NMDA 3H1HE 2BEQD 2ZT9B 3U1AA 3TNUB 5AW3B 4K3AA 3CE7A 1RO2A 2CGQA 2CQ8A 1GXGA 1UJZA 1EZVG 1H88A 3NXSA 4D6TD 4IPYA 5KAIH 4EDFA 1TU3F 1GXHA 1NU1D 3H1KE 3H4EA 2K37A 1OW8A 4KJMA 1SQVD 1FU1A 1LTGC 1N8RQ 3HTKA 3KQGA 2XU6A 5KLVD 3JCUH 4H2YC 2H8PD 1YIJP 5AW6B 5AVWB 1LT9A 2IFNA 1L0LG 2FYUD 3V4QA 2WVRA 1IFNA 1JM0A 3NFQA 5EFWB 1CEIA 2WITA 1KILB 1MFTA 3B5NC 3ABVC 1JO5A 4L75A 4NPFX 3VYIA 1ZRTE 2KORA 4U0BA 2MVVA 2L0QA 5H2FE 5B5EH 2LXBA 1FJKA 2D2CC 3M0AA 3CCSP 2FXPA 4QKOA 3VMYA 2E43A 1N2DC 1RE4A 1JCDA 2W83C 2AEMA 1FR2A 1EDLA 3FX0A 2WPTA 2QJYC 1GK4A 5AVZB 4PJ0E 2E76B 4GIFA 4RJTA 1BGYD 1GL2C 1NU1G 1QEXA 1S1CX 1FZEA 1SQVG 1RF0C 3A3YB 1N73C 3L71E 5KLVG 1HBWA 2M0BA 3CCUP 1T3JA 4GOFA 3PRJA 2Q1KA 4JYBA 1GPJA 2FYUG 2GUVA 4XFZA 5AW2B 1URQA 1DD4A 2KSJA 3CWBE 3FWLA 1PGQA 2FKWB 1L4AA 3G4SP 1SQBD 3GHGA 1SQPE 1JJ2O 1M6EX 1BE3E 3H1HD 1NAYA 3HE4A 1E0HA 3GLMA 1L4AD 1GMJA 1M57D 3UIAA 2K93A 5CZDB 4COCA 1UIIA 4TLFA 4U0CA 1NTZJ 4Y99B 1YJNP 2QG4A 1LTJA 1CZQA 3KYQA 4KHXA 1BAJA 2M5AA 2B88A 2P1JA 1MFZA 3H1KD 1GL2B 1BCCE 1OZHA 2YIUC 4PV1B 3CCQP 2IZ1A 2VSQA 2L22A 3RK3B 4H13C 1FOSE 1FZFA 2PEIA 3C1LA 1JUNA 1RNIA 1AQ5A 1FZCC 2YNYA 5KP7B 2W90A 1DD3A 2N6YA 1NTKJ 1ZRTD 2FYNC 1SQBG 3M9QA 4N78E 2FFDA 3H1HG 2Y9ZA 1L0LK 2CG5B 2A06E 1N7SC 3H0DA 1K73Q 1JOCA 2JR8A 3G6EP 3BRVB 4OVNF 2GDXA 2AF8A 3K5BA 2QA4P 2E5YA 3CC4P 2POHA 3G0VA 2KODA 4DG9A 4MRTC 1SQQJ 3D6ZA 1KILE 1ZNVA 2JYGA 1WRGA 1QVFO 5AW7B 3HD7D 3GF7A 2Y0DA 1YI2P 3L71D 2ZYDA 2BCCJ 4R0MA 2FXMA 1AVYA 2WPQA 3V2RA 4PD4H 2NO8A 5APTA 2ZYAA 2WSSH 1NU1K 4I1LA 5TISH 1Y47A 3CWBD 3HUSC 2WTYA 1EQ7A 1SQVK 2OYOA 3BRTB 1L2PA 2G8YA 2KOPA 1LTAC 5KLVK 2FYNB 1SQPD 1BE3D 1IFDA 3A2AA 1M1JC 3DPHA 3H47A 1L0NJ 2AFDA 3PLNA 2FYUK 2PRRA 2XZRA 1HTLC 3N7NA 3W68A 2E74C 1X22A 2LIWA 3PP5A 1LT9B 1NTZE 3V2QA 1YQ3C 1UNKA 3CCMP 1N7LA 5AW5B 2LPKA 2SPZA 1YTZT 3E7KA 2WPRA 1JNMA 1UIXA 2BUOA 2E1MA 1LNQA 2HPCA 1BCCD 2PEOA 2ZAEB 3VMZA 1JY2O 3L71G 1SP4A 1MV8A 3L74G 4NPEA 2ZVOB 2KB7P 2KIKA 4L74A 3P8CE 1MZ9A 1EXJA 2ZVNB 2JYLA 4CA3A 5DJUB 1Q2NA 4OGQC 1SQPG 1BE3G 2NPSA 3G1IA 4RO0A 2A06D 2LXCB 3P32A 1MZ8A 4IZ6A 1M8OB 1LTSC 3KPEA 4GODA 4JYCA 2KW2A 3FGAD 3V2NA 2FY8A 2M3BA 2CNRA 2XDJA 1FZBA 2GA1A 4JQ0D 3CCLP 2R44A 1SQBK 5KLIC 3DS2A 4U0EA 2QJKB 4GT1A 1P84I 1BCCG 2FQ1A 1T3UA 3GHGB 2KOOA 2QM8A 1YJ9P 2LF4A 1Y8AA 2A45H 1ZV8A 3Q5SA 3HE4B 4M0IA 1SS1A 1G1IA 4GR2A 3VRLC 2JJLA 1PPJD 1NGMB 2XNXA 3M9HA 1G2CA 2I8DA 5DJTB 4GDOA 1KB9H 2V4HA 4ZMDA 2NZ2A 4BXLA 3Q1MA 2XV6A 1LTJB 4C7RA 3BCCG 2M5AB
chains in the Genus database with same CATH topology
2PEOA 3CCVP 3CMAP 1M90Q 4QNBA 2QEXP 3H0DA 1K73Q 3P05A 2L6EA 3CCUP 3G6EP 5DCKA 2JO0A 2BQ1E 3CXCO 3G71P 2QA4P 1RO2A 5HGNA 1VQ6P 3CC4P 3CCRP 1Q86Q 2PEMA 4XFZA 3DS4A 3MGEA 3DS0A 3G0VA 3NTEA 1E6JP 2KODA 2Z46A 3G1GA 5F2OA 1A8OA 5BS1A 4COPA 4IPYA 1S72P 5HGLA 1K8AQ 1D1DA 1PEQA 2ONTA 2Z45A 2JYLA 1VQOP 3RG6C 3HZQA 3H4EA 3OW2O 3G4SP 1VQMP 2M8LA 2JYGA 1A43A 2P9XA 1VQPP 1M6EX 1EIAA 1N8RQ 5I4TG 1JJ2O 3B5IA 2OTJP 1QVFO 4PH0A 3G1IA 3I55P 1K9MQ 1Q82Q 2CWOA 2OARA 1K30A 3CC2P 3Q20A 1PEMA 1RO0A 1YI2P 3DS5A 1YIJP 4XRQA 3LRYA 2PEQA 1M1KQ 1KC8Q 2EIAA 1VQLP 5F2NA 2M8PA 3G21A 4U0DA 1VQNP 3CCJP 3CC7P 5F2KA 5BS2A 1W2BO 4COCA 1VQ5P 3CCLP 4U0AA 3CCEP 4GR6A 4U0CA 1EOQA 1YJNP 1QRJA 1YJWP 1PEUA 3DS2A 4U0EA 1BAJA 1KD1Q 3CMEP 5JPAA 3I56P 1VQ4P 2Z44A 2PEJA 1KQSO 4U0BA 3DPHA 2PY8A 4PH1A 3H47A 1YJ9P 1AUMA 2LF4A 3HYBA 3CCQP 5HGOA 1YITP 3G28A 3DS3A 4WYMA 3CCSP 4M0IA 2M8NA 4XROA 1VQ7P 1ZMBA 2BHVA 1QVGO 4GR2A 3VRLC 1VQ8P 2PEIA 1IUQA 3G29A 4XFXA 2EG5A 3WBHA 1M6NA 3DTJA 2PENA 1Q7YQ 1Q81Q 1VQ9P 1NJIQ 1RNIA 2XT1A 3M1MA 1VQKP 1PEOA 1M74A 4XFYA 2EFJA 3CCMP 1YHQP 5HGMA 2DGYA 2BUOA 2E1MA 2XV6A 3DS1A 4U0FA 3G26A 3CPWO 2PEKA 2OTLP 3E2DA 3CD6P 2XXMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCJ P;  3CCV P;  1S72 P;  1K8A Q;  3CC7 P;  3CMA P;  1W2B O;  1VQ7 P;  1VQ5 P;  1QVG O;  3CCL P;  1VQO P;  1M90 Q;  1VQ8 P;  3OW2 O;  1VQM P;  3G4S P;  3CCE P;  2QEX P;  1YJN P;  1VQP P;  1K73 Q;  1JJ2 O;  1N8R Q;  1YJW P;  2OTJ P;  3CCU P;  1Q7Y Q;  1Q81 Q;  3G6E P;  1VQ9 P;  1QVF O;  1KD1 Q;  1NJI Q;  3I55 P;  1K9M Q;  1Q82 Q;  1VQK P;  3CC2 P;  3CME P;  3CXC O;  3G71 P;  2QA4 P;  1VQ6 P;  3I56 P;  1YI2 P;  3CCM P;  1VQ4 P;  3CC4 P;  3CCR P;  1YIJ P;  1Q86 Q;  1YHQ P;  1KQS O;  1M1K Q;  1KC8 Q;  1YJ9 P;  3CCQ P;  1YIT P;  1VQL P;  3CPW O;  2OTL P;  3CD6 P;  3CCS P;  1VQN P; 
#chains in the Genus database with same CATH topology
 1L0N E;  2KG9 A;  1IC2 A;  2B89 A;  5KKZ C;  1FDI A;  2A06 G;  3P05 A;  2L6E A;  2MR8 A;  1FOS F;  4WY4 C;  4D6T E;  3H1I J;  3MGE A;  1NTZ D;  4MN4 C;  1RE3 C;  1FBM A;  3CX5 H;  2N1T C;  2WSF J;  2QM7 A;  2KNC A;  3VMA A;  2P58 A;  1VQP P;  5KJ7 C;  3B5I A;  1OWA A;  5HV8 A;  2KG8 A;  3B5N A;  4UB6 H;  3H25 A;  1FAV A;  1VF5 C;  2FQ0 A;  2MKV A;  2MY5 A;  1H89 A;  2KOS A;  3C8V A;  3H32 B;  2M8P A;  1DIP A;  3SWF A;  5F2K A;  3AE2 C;  2GDW A;  1NYH A;  3P8C D;  2VLN A;  2AEF A;  2WWW A;  4C46 A;  1NTK D;  4OH8 B;  1H0T A;  1U57 A;  3HD7 B;  2ZT9 C;  1KD1 Q;  1BSN A;  4JF7 A;  3SFE C;  1KYO H;  4A7P A;  3D70 A;  2Z44 A;  1OVV A;  2PEJ A;  2WZ7 A;  3A7O A;  5CMZ A;  4PH1 A;  3L36 A;  1AUM A;  4U3F J;  1NOH A;  2KK7 A;  1KQL A;  3CXH H;  2FQ2 A;  3O6Q A;  5AVT B;  4BRY A;  4K35 A;  1ZN5 A;  1RF0 A;  3DTJ A;  2FVE A;  2Q3E A;  2Z5I A;  1BGY E;  1SQP K;  4XFY A;  3FXD A;  1IMP A;  1ZW0 A;  1YHQ P;  2YKQ A;  1N86 A;  2XV5 A;  2H7H A;  2XXM A;  4AUW A;  3MZW B;  3CCV P;  3I5C A;  5AVS B;  1OX3 A;  1Z56 A;  3GZM A;  2Q6Q A;  2E75 D;  3L75 J;  4XFJ A;  1NTM E;  2JO0 A;  3G71 P;  1KIL C;  5KP8 B;  1GW3 A;  3G1G A;  1MKM A;  2O1J A;  4DCK A;  3MIW A;  5HGL A;  1NHL A;  2ONT A;  2L91 A;  1T2K D;  1JY3 O;  2GM4 A;  3TGU J;  1L0N D;  4YXD C;  2KGD A;  2MJZ A;  1GU5 A;  2HPC B;  1YTZ I;  1RO0 A;  3LW5 H;  1RF1 A;  3L72 J;  1T8K A;  1OVU A;  2K94 A;  1IZN B;  3RL0 D;  2E76 C;  1VQN P;  1QGK B;  1RQU A;  3Q3D A;  3CC7 P;  1W2B O;  2V7Q H;  1LTB C;  3VN0 A;  3MUD A;  5AVX B;  1YJW P;  5CCH C;  5AW9 B;  2EHS A;  2R3S A;  1PGO A;  2YMK A;  1IFP A;  2M8R A;  3II6 A;  1U7M A;  2RKL A;  2XKM A;  2P2U A;  2EG5 A;  1KV4 A;  5APQ A;  2W27 A;  3O8Z A;  2I1K A;  5AVV B;  3F89 A;  1GZL A;  3Q2Y A;  4OGQ B;  1EDJ A;  1K04 A;  2B87 B;  4BPH A;  2JWA A;  2KGE A;  1YBK A;  3NTN A;  2K92 A;  4F37 A;  3WMM 0;  2WMM A;  5KAF H;  2KLV A;  1X3O A;  3CXC O;  5TIS E;  4Y99 C;  5CCG A;  3AE5 C;  1HQB A;  4D6T G;  3DS4 A;  2N9Y B;  1E6J P;  2HYN A;  2VRS A;  2JQ4 A;  1LJ2 A;  1KOR A;  1FE6 A;  1S5L E;  5GTI H;  1K8A Q;  2Z4E A;  4PV1 C;  1SQX E;  2FAC A;  3A0H E;  5CCG D;  1A43 A;  3RK3 C;  1EMV A;  1U7J A;  2ZYG A;  4IFF A;  1NTM D;  4CPG A;  4EOT A;  4W7Z A;  1KC8 Q;  1A02 J;  5AW8 B;  2VLP A;  3L73 J;  2KOQ A;  4LGD E;  4U7J A;  2OGU A;  3PHL A;  2GZI A;  5GTH E;  1URQ D;  2P67 A;  1HJ0 A;  2KNC B;  3OA7 A;  2PP6 A;  1NWQ A;  5HGO A;  2M3E A;  3M0D C;  3RK2 D;  1M6N A;  2Q5U A;  1VQ9 P;  1Q90 D;  2OYH A;  1LP1 B;  4XA4 A;  4I7Z B;  1BGY G;  2R5D A;  2YXR B;  2JU1 A;  4WB4 A;  3WUU A;  4UB8 H;  1H0T B;  2N5H A;  2PEK A;  1MUU A;  3RL0 g;  4PD4 I;  2DNW A;  1JTH B;  3U59 A;  2J5U A;  1DNY A;  1NTM G;  2HOD A;  1PP9 J;  3L70 J;  7CEI A;  3MHV A;  2ERH A;  3AEC C;  2AFE A;  3ZDM A;  4BRY B;  2WT7 A;  3TSI A;  2G3A A;  3PH0 A;  5B66 E;  3B4Q A;  1FDO A;  2WSF H;  1S9K E;  1VL2 A;  2E75 B;  3H1L J;  4N6J A;  2J59 M;  1EXI A;  4AQR D;  2OTJ P;  3VP8 A;  3H1J J;  3WUT A;  3RG2 A;  3V4W A;  2K0X A;  2ZJS E;  1LT9 C;  2O01 H;  1PL5 A;  4RKU J;  1JMB A;  2GYK A;  1L0I A;  2KZI A;  3A0B E;  1S2E A;  1QL1 A;  4IL6 X;  1BDC A;  2KGC A;  3H1K G;  2N5I A;  3IF4 A;  1JEK A;  5AVR B;  1LWU B;  1SQX D;  2RMZ A;  3MP7 B;  4I2L C;  2YXQ B;  1KQG B;  2LKM A;  2K0D X;  3RL0 B;  3T97 A;  2H43 A;  3LW5 J;  3GW6 A;  1PPJ E;  2QNW A;  1ZMB A;  4IFM A;  1NKN A;  5L8R J;  1RE4 C;  4RES B;  4EIJ A;  4H0L D;  4UHP B;  2V7Q J;  5H2F H;  3CX5 E;  1PEO A;  1HGV A;  1L0L J;  2X2B A;  2EFJ A;  4ZKP A;  2I1J A;  1NH4 A;  1IJD B;  4WY4 A;  3TGU D;  3ITK A;  1P84 E;  1NVO A;  3HTK B;  1GW4 A;  2M5R A;  3L72 D;  3S9O A;  2K9J A;  2K3R A;  5AW1 B;  5BU5 A;  1FZG A;  1J1E B;  1SFC A;  1R8E A;  1EC5 A;  3L37 A;  2QJK C;  3IR9 A;  5AW0 B;  3AE1 C;  1A8O A;  3V2P A;  2A45 I;  1HF9 A;  3GHG C;  1SFC D;  3WU2 E;  3RG6 C;  4WWI A;  1SQX G;  2OYI A;  2P9X A;  4GOE A;  1OW6 A;  1PZQ A;  1Q82 Q;  1NU1 J;  2FVA A;  1HY8 A;  1KB9 I;  3DS5 A;  1SQV J;  3B4S A;  3MD0 A;  3LRY A;  2PEQ A;  3E1I A;  3G21 A;  4U0D A;  3CWB G;  1RQV A;  5KLV J;  1IFM A;  1NTK E;  1IMQ A;  1LTJ C;  2WSC J;  3CCE P;  2YO3 A;  4GR6 A;  4PXH B;  2FYU J;  2K9Y A;  2KS1 A;  1S9K D;  1ZP0 C;  1RY3 A;  3EJD A;  1DH3 A;  1NTM K;  3FXE A;  2MD9 A;  3HYB A;  1GU4 A;  4EI2 A;  1CI6 A;  2NPS D;  3CX5 I;  2JGP A;  1SQQ E;  2W8Z A;  4H44 D;  5APV A;  4ZNC A;  5AVU B;  1Q81 Q;  3OAK A;  1NJI Q;  1URQ B;  3M1M A;  1VQK P;  2R32 A;  1L4A B;  3U1C A;  2WQY C;  4WVZ A;  3AE3 C;  2DGY A;  4U0F A;  5M1B A;  2BCC E;  3Q5P A;  3CD6 P;  3KDP B;  3RK2 B;  5DCK A;  1H8A A;  2KSE A;  5KAI E;  4KT0 J;  5HGN A;  1W2E A;  3QWO C;  2K88 A;  3HD7 C;  1KYO I;  3CX5 D;  4IL6 H;  5F2O A;  2OYH B;  3JCU E;  2Z45 A;  2OTK E;  3CXH I;  5EW5 E;  1P84 D;  2YMY A;  5BU8 B;  2O1K A;  2J58 A;  5E79 H;  1SQB J;  1R5S A;  2E76 D;  3H1H J;  2Y9Y A;  4GKG A;  2PAJ A;  4BPG A;  2HOD B;  1IK9 A;  3W67 A;  2JWD A;  3VMX A;  3GF3 A;  2WT7 B;  1G1J A;  5KP6 B;  2H89 C;  1KYO D;  5B5E E;  2FFD B;  2H88 C;  4AYC A;  5JPA A;  2CPB A;  2O01 J;  3AE9 C;  3KHU A;  1BDD A;  4Y28 J;  1PPJ G;  1WMK A;  1PP9 D;  2HFE D;  3S1K A;  3B5N D;  1VQ8 P;  3OJA B;  1W5C E;  3EFF K;  2W6B A;  2WPS A;  2W6A A;  5GTI E;  1J1D B;  3AEB C;  1KTM A;  1KFM A;  3KZI H;  2UWJ E;  2D2C D;  1KLP A;  2FAE A;  2AXT H;  3CPW O;  1M56 D;  3H1J D;  1GL2 A;  4H0L B;  1EDK A;  2ITA A;  3T97 B;  4YTP C;  1ZLL A;  4NEO A;  1A02 F;  1N73 A;  3BAT A;  1SQQ D;  1NTZ G;  3EJE A;  1GL2 D;  3NTE A;  2JB0 A;  4C7N A;  4PWV B;  3TYY A;  1VQM P;  2BCC D;  2Q3I A;  5I4T G;  3P7K A;  1YYC A;  1IFI A;  2OAR A;  4YXW H;  2N9B A;  2KI7 B;  2P7J A;  3AEF C;  2K9J B;  2GZE A;  4LLH A;  1LT1 A;  1VQL P;  4HKZ H;  5F2N A;  1SFC B;  4TT3 H;  3L71 J;  2O01 N;  2XZ0 D;  1NTK G;  3CLQ A;  4U0A A;  1L0L D;  2JKV A;  1EOQ A;  3EWK A;  3L74 J;  3M0D A;  2W6J H;  2Q7C A;  4L73 A;  3IN6 A;  3HE5 A;  2QIW A;  2OQQ A;  2L5G B;  1SQP J;  3H1I E;  1BE3 J;  1NAF A;  2FYZ A;  3IAO A;  3JSV C;  2P10 A;  4XFX A;  1SQQ G;  3WBH A;  4JBZ A;  3TDK A;  1IK7 A;  2GZJ A;  4HB1 A;  4JPZ B;  2L4B A;  2R5B A;  2ROQ A;  5HGM A;  1FZC A;  5APS A;  1VDF A;  1ACP A;  1R5L A;  2FAD A;  2KS1 B;  2K1A A;  4H13 D;  2NPS B;  3HRN A;  2BCC G;  4XE5 B;  1KFN A;  4H44 B;  3AE4 C;  1BCC J;  1N7S A;  1EDI A;  1CI6 B;  3EJB A;  3RGU A;  2LML A;  2PEM A;  2HR3 A;  2MVU A;  2GDY A;  2KZJ A;  3AE8 C;  4COP A;  3GZL A;  1N7S D;  4U3F E;  1L0N G;  4BWN A;  1BXI A;  1PIX A;  1EIA A;  4PD4 E;  1PEM A;  2LTE A;  3BCC J;  1M1K Q;  1X79 B;  3AED C;  4I7Z C;  3IFM A;  1E79 H;  1ZR4 A;  1G2C B;  1QL2 A;  2WSC H;  3RBX A;  3MTU E;  2KXP B;  4H2W C;  3HUS A;  1L0H A;  3SFD C;  3CME P;  4HYT B;  3L75 E;  3L4F A;  3I56 P;  4H2X C;  2K0Y A;  1GD2 E;  1S5L X;  2PY8 A;  1HVV A;  1NTZ K;  3AE7 C;  2EHT A;  4BPF A;  2LIU A;  1M1J A;  1DEB A;  2M8N A;  2C0W A;  3H6P A;  2QJP C;  1QLE D;  2Y0C A;  3G29 A;  2PEN A;  2QRX A;  1SVF A;  2E75 C;  3L74 E;  1M74 A;  3TGU E;  3CL3 D;  4HJG H;  1JY2 N;  4O9B A;  3VTP C;  3B71 A;  3L72 E;  1JCC A;  5C39 A;  2E74 D;  1KZU B;  1S4X A;  3B5N B;  1X8Y A;  3M91 A;  2XZ1 C;  1YQ4 C;  1M90 Q;  1LTT C;  4QNB A;  1D7M A;  3R2P A;  3H1I D;  3SWK A;  1NTK K;  1T2K C;  2BQ1 E;  2IZ0 A;  2D2C B;  3GJN A;  1Q86 Q;  1NKZ B;  1LWU C;  2R3C A;  3PTZ A;  1K05 A;  1VPC A;  1T8Z A;  2KG6 A;  5EJD A;  2FHS C;  3RL0 C;  3U43 A;  1D1D A;  1E5W A;  5APW A;  3OW2 O;  2QJY B;  5CJ4 A;  1ZR2 A;  3F5H A;  2IX7 C;  4W7Y A;  1FC2 C;  1RF1 C;  4PH0 A;  2CWO A;  2WSE J;  1F80 D;  3CC2 P;  1SQQ K;  3BAS A;  2Z5H A;  1X0T A;  2PFX A;  3O6Q B;  1DX7 A;  4XRQ A;  1DEE G;  3QH9 A;  2QJP B;  2HLO A;  1N73 B;  1FDM A;  4DT0 A;  5BS2 A;  4OGQ D;  1RH5 B;  1VQ5 P;  1HUC A;  2JDI H;  2KP8 A;  3MUD C;  1PEU A;  1JY2 P;  2IBZ E;  2FVF A;  3KXD A;  4U3F D;  4C7N B;  3V5B A;  2JEE A;  1SLQ A;  1J1E C;  1KQS O;  2JU2 A;  1QX8 A;  4PD4 D;  2CK3 H;  5AVY B;  3BCC E;  1YIT P;  4R4M A;  1KB9 E;  3H1I G;  2LKI A;  1T6A A;  2KUB A;  2GZG A;  3TF5 A;  1AA0 A;  2L9F A;  4IL6 E;  3N4X A;  3H32 A;  2CPS A;  1L0N K;  3D6Y A;  5CJ0 A;  3C9I A;  2RH0 A;  1IO4 A;  1OXZ A;  2NRG A;  2LL8 A;  1AVO A;  3AEE C;  5CBO A;  3HD7 A;  2AEJ A;  3DS1 A;  4R4L A;  3R4Y A;  3L75 D;  1AF8 A;  1RHZ B;  5TJH A;  2YKP A;  5E79 E;  1RF1 B;  2VLO A;  2IPP A;  3HE5 B;  3FWN A;  3L73 E;  4LC1 A;  2FBW C;  2HG5 D;  5CCG C;  2ZXX A;  2YIU B;  3LIE A;  2Q9I A;  3CCR P;  3DS0 A;  4H13 B;  3L74 D;  3BVH A;  4N3Y B;  1OFC X;  4UB6 E;  1ZOY C;  1RE3 A;  4PJ0 H;  1VQO P;  4U3F G;  2QSI A;  5BVZ A;  2N1T A;  1FZC B;  4I6M C;  4WY4 D;  2WPV B;  5KJ7 A;  1S5L H;  3Q20 A;  3JC2 2;  2JP3 A;  3A0H H;  1URQ C;  1OVR A;  1L4A C;  2N1T D;  3G9R A;  1N7S B;  3CCJ P;  2RN0 A;  3Q5R A;  3AEA C;  2IBZ I;  1KYO E;  2XND H;  5KJ7 D;  3KZI E;  2N98 A;  1Z6M A;  5APU A;  2AXT E;  4WBA A;  4D6T J;  1CSB A;  1LTI C;  3RK2 C;  1LGH B;  1VF5 D;  2C9L Y;  1IFJ A;  3CXH E;  1KMI Z;  4NPD A;  4QMA A;  3L75 G;  1VQ4 P;  5APX A;  2MR7 A;  1PP9 E;  3L70 E;  2E42 A;  3TNU A;  2DW3 A;  2B9B A;  4HH2 A;  3LMO A;  3G28 A;  4IFD K;  5GTH H;  4XRO A;  1S3J A;  2YKO A;  3GMA A;  2PGD A;  2AXC A;  2ZT9 D;  2OYH C;  1NQ4 A;  3A5T A;  1Q7Y Q;  3SSU A;  5APY A;  3H1L E;  1AJY A;  3EFG A;  5AW4 B;  1JMM A;  3TGU G;  3NY7 B;  3H1J E;  2IBZ D;  2BAS A;  1GK6 A;  5HVC A;  2JAZ A;  1PV3 A;  3L72 G;  3HUS B;  3E2D A;  1AYI A;  3S4R A;  3CMA P;  3L35 A;  1J2J B;  2KR5 A;  3BCC D;  4N78 D;  1PFI A;  1KN7 A;  1KB9 D;  1PGJ A;  4DZO A;  1M1J B;  2GZF A;  2KLU A;  4HKG A;  1JY3 N;  4Z1M H;  1HJB A;  1KIL A;  1AV1 A;  1EZV E;  1FS0 E;  3WUV A;  2E74 B;  2FFD C;  3RK3 E;  4DOJ A;  1S72 P;  3MGN A;  3HZQ A;  3AE6 C;  3P8M C;  2LOL A;  5AVQ B;  1XTG B;  1BGY J;  1AFO A;  3SWY A;  5B66 H;  1KIL D;  2B87 A;  3I55 P;  1K9M Q;  1K30 A;  1PGP A;  1JB0 J;  3CI9 A;  3L73 D;  2E5T A;  2IYP A;  4IOI H;  1J1D C;  2EIA A;  1L0L E;  2IDB A;  2ZXE B;  1WT6 A;  4OWF A;  1GDT A;  1NTM J;  1AQT A;  4ASV A;  3PJS K;  1OMI A;  2JO1 A;  5K5G B;  2A45 G;  2IBZ G;  4L76 A;  4H0L C;  5CBN A;  3A0B H;  5CCH A;  3RBZ A;  2O3J A;  1BSH A;  4B86 A;  4WYM A;  2KGA A;  1VQ7 P;  1QVG O;  2YO2 A;  1IUQ A;  5CCH D;  1JY3 P;  3B8E B;  2XT1 A;  2QE7 H;  2QVA A;  3V6I A;  1M7L A;  1OIP A;  3LID A;  1NU1 E;  4ASW A;  3CXH D;  1ZME C;  3M9B A;  5KAF E;  2OTL P;  1SQV E;  3H1K J;  4W80 A;  5KLI B;  2BEZ F;  3L70 D;  1DV5 A;  3G3Z A;  5KLV E;  2QEX P;  1SFC C;  3EQ2 A;  1KQF B;  3GKL C;  3L73 G;  1P84 H;  1EZV I;  1SQX K;  1X9V A;  2FYU E;  1VQ6 P;  1OR5 A;  1VHN A;  2Z46 A;  3D71 A;  2JBG A;  3H1L D;  1GTW A;  1LP1 A;  2MF4 A;  5BS1 A;  2OYI C;  1PEQ A;  3VP9 A;  1CW5 A;  1OW7 A;  2M8L A;  2AVA A;  2WSE H;  1ZXG A;  4DJG A;  2N50 A;  2K2Q A;  3WU2 H;  4ZKU A;  4EYY Q;  1JTH A;  1USD A;  4YPC A;  5KTB A;  2N6Z A;  1Y9B A;  3USS A;  2VLQ A;  5KKZ B;  4PV1 D;  3AEG C;  1VKU A;  1EZV D;  1HH0 A;  2C0X A;  2KYV A;  3M06 A;  2C9N Y;  2IFM A;  3RK3 D;  2NPS C;  4WY4 B;  2LR2 A;  1QRJ A;  4H44 C;  5CHX A;  2Y0E A;  2N1T B;  1PP9 G;  3L70 G;  1XTC C;  1SQX J;  1FZA A;  2PNG A;  2ZFC A;  3DS3 A;  1HGZ A;  1FJP A;  3TK1 A;  2FXO A;  2BHV A;  2K5X A;  1VF5 B;  4UB8 E;  2GUS A;  4M3L A;  1USE A;  1HWT C;  3GG2 A;  3H1L G;  2IYO A;  3CWB J;  3VOP A;  3H1J G;  3E1R A;  2OYI B;  2KOG A;  1LWU A;  1SQB E;  3G26 A;  1NO4 A;  2KWL A;  3NMD A;  3H1H E;  2BEQ D;  2ZT9 B;  3U1A A;  3TNU B;  5AW3 B;  4K3A A;  3CE7 A;  1RO2 A;  2CGQ A;  2CQ8 A;  1GXG A;  1UJZ A;  1EZV G;  1H88 A;  3NXS A;  4D6T D;  4IPY A;  5KAI H;  4EDF A;  1TU3 F;  1GXH A;  1NU1 D;  3H1K E;  3H4E A;  2K37 A;  1OW8 A;  4KJM A;  1SQV D;  1FU1 A;  1LTG C;  1N8R Q;  3HTK A;  3KQG A;  2XU6 A;  5KLV D;  3JCU H;  4H2Y C;  2H8P D;  1YIJ P;  5AW6 B;  5AVW B;  1LT9 A;  2IFN A;  1L0L G;  2FYU D;  3V4Q A;  2WVR A;  1IFN A;  1JM0 A;  3NFQ A;  5EFW B;  1CEI A;  2WIT A;  1KIL B;  1MFT A;  3B5N C;  3ABV C;  1JO5 A;  4L75 A;  4NPF X;  3VYI A;  1ZRT E;  2KOR A;  4U0B A;  2MVV A;  2L0Q A;  5H2F E;  5B5E H;  2LXB A;  1FJK A;  2D2C C;  3M0A A;  3CCS P;  2FXP A;  4QKO A;  3VMY A;  2E43 A;  1N2D C;  1RE4 A;  1JCD A;  2W83 C;  2AEM A;  1FR2 A;  1EDL A;  3FX0 A;  2WPT A;  2QJY C;  1GK4 A;  5AVZ B;  4PJ0 E;  2E76 B;  4GIF A;  4RJT A;  1BGY D;  1GL2 C;  1NU1 G;  1QEX A;  1S1C X;  1FZE A;  1SQV G;  1RF0 C;  3A3Y B;  1N73 C;  3L71 E;  5KLV G;  1HBW A;  2M0B A;  3CCU P;  1T3J A;  4GOF A;  3PRJ A;  2Q1K A;  4JYB A;  1GPJ A;  2FYU G;  2GUV A;  4XFZ A;  5AW2 B;  1URQ A;  1DD4 A;  2KSJ A;  3CWB E;  3FWL A;  1PGQ A;  2FKW B;  1L4A A;  3G4S P;  1SQB D;  3GHG A;  1SQP E;  1JJ2 O;  1M6E X;  1BE3 E;  3H1H D;  1NAY A;  3HE4 A;  1E0H A;  3GLM A;  1L4A D;  1GMJ A;  1M57 D;  3UIA A;  2K93 A;  5CZD B;  4COC A;  1UII A;  4TLF A;  4U0C A;  1NTZ J;  4Y99 B;  1YJN P;  2QG4 A;  1LTJ A;  1CZQ A;  3KYQ A;  4KHX A;  1BAJ A;  2M5A A;  2B88 A;  2P1J A;  1MFZ A;  3H1K D;  1GL2 B;  1BCC E;  1OZH A;  2YIU C;  4PV1 B;  3CCQ P;  2IZ1 A;  2VSQ A;  2L22 A;  3RK3 B;  4H13 C;  1FOS E;  1FZF A;  2PEI A;  3C1L A;  1JUN A;  1RNI A;  1AQ5 A;  1FZC C;  2YNY A;  5KP7 B;  2W90 A;  1DD3 A;  2N6Y A;  1NTK J;  1ZRT D;  2FYN C;  1SQB G;  3M9Q A;  4N78 E;  2FFD A;  3H1H G;  2Y9Z A;  1L0L K;  2CG5 B;  2A06 E;  1N7S C;  3H0D A;  1K73 Q;  1JOC A;  2JR8 A;  3G6E P;  3BRV B;  4OVN F;  2GDX A;  2AF8 A;  3K5B A;  2QA4 P;  2E5Y A;  3CC4 P;  2POH A;  3G0V A;  2KOD A;  4DG9 A;  4MRT C;  1SQQ J;  3D6Z A;  1KIL E;  1ZNV A;  2JYG A;  1WRG A;  1QVF O;  5AW7 B;  3HD7 D;  3GF7 A;  2Y0D A;  1YI2 P;  3L71 D;  2ZYD A;  2BCC J;  4R0M A;  2FXM A;  1AVY A;  2WPQ A;  3V2R A;  4PD4 H;  2NO8 A;  5APT A;  2ZYA A;  2WSS H;  1NU1 K;  4I1L A;  5TIS H;  1Y47 A;  3CWB D;  3HUS C;  2WTY A;  1EQ7 A;  1SQV K;  2OYO A;  3BRT B;  1L2P A;  2G8Y A;  2KOP A;  1LTA C;  5KLV K;  2FYN B;  1SQP D;  1BE3 D;  1IFD A;  3A2A A;  1M1J C;  3DPH A;  3H47 A;  1L0N J;  2AFD A;  3PLN A;  2FYU K;  2PRR A;  2XZR A;  1HTL C;  3N7N A;  3W68 A;  2E74 C;  1X22 A;  2LIW A;  3PP5 A;  1LT9 B;  1NTZ E;  3V2Q A;  1YQ3 C;  1UNK A;  3CCM P;  1N7L A;  5AW5 B;  2LPK A;  2SPZ A;  1YTZ T;  3E7K A;  2WPR A;  1JNM A;  1UIX A;  2BUO A;  2E1M A;  1LNQ A;  2HPC A;  1BCC D;  2PEO A;  2ZAE B;  3VMZ A;  1JY2 O;  3L71 G;  1SP4 A;  1MV8 A;  3L74 G;  4NPE A;  2ZVO B;  2KB7 P;  2KIK A;  4L74 A;  3P8C E;  1MZ9 A;  1EXJ A;  2ZVN B;  2JYL A;  4CA3 A;  5DJU B;  1Q2N A;  4OGQ C;  1SQP G;  1BE3 G;  2NPS A;  3G1I A;  4RO0 A;  2A06 D;  2LXC B;  3P32 A;  1MZ8 A;  4IZ6 A;  1M8O B;  1LTS C;  3KPE A;  4GOD A;  4JYC A;  2KW2 A;  3FGA D;  3V2N A;  2FY8 A;  2M3B A;  2CNR A;  2XDJ A;  1FZB A;  2GA1 A;  4JQ0 D;  3CCL P;  2R44 A;  1SQB K;  5KLI C;  3DS2 A;  4U0E A;  2QJK B;  4GT1 A;  1P84 I;  1BCC G;  2FQ1 A;  1T3U A;  3GHG B;  2KOO A;  2QM8 A;  1YJ9 P;  2LF4 A;  1Y8A A;  2A45 H;  1ZV8 A;  3Q5S A;  3HE4 B;  4M0I A;  1SS1 A;  1G1I A;  4GR2 A;  3VRL C;  2JJL A;  1PPJ D;  1NGM B;  2XNX A;  3M9H A;  1G2C A;  2I8D A;  5DJT B;  4GDO A;  1KB9 H;  2V4H A;  4ZMD A;  2NZ2 A;  4BXL A;  3Q1M A;  2XV6 A;  1LTJ B;  4C7R A;  3BCC G;  2M5A B; 
#chains in the Genus database with same CATH homology
 2PEO A;  3CCV P;  3CMA P;  1M90 Q;  4QNB A;  2QEX P;  3H0D A;  1K73 Q;  3P05 A;  2L6E A;  3CCU P;  3G6E P;  5DCK A;  2JO0 A;  2BQ1 E;  3CXC O;  3G71 P;  2QA4 P;  1RO2 A;  5HGN A;  1VQ6 P;  3CC4 P;  3CCR P;  1Q86 Q;  2PEM A;  4XFZ A;  3DS4 A;  3MGE A;  3DS0 A;  3G0V A;  3NTE A;  1E6J P;  2KOD A;  2Z46 A;  3G1G A;  5F2O A;  1A8O A;  5BS1 A;  4COP A;  4IPY A;  1S72 P;  5HGL A;  1K8A Q;  1D1D A;  1PEQ A;  2ONT A;  2Z45 A;  2JYL A;  1VQO P;  3RG6 C;  3HZQ A;  3H4E A;  3OW2 O;  3G4S P;  1VQM P;  2M8L A;  2JYG A;  1A43 A;  2P9X A;  1VQP P;  1M6E X;  1EIA A;  1N8R Q;  5I4T G;  1JJ2 O;  3B5I A;  2OTJ P;  1QVF O;  4PH0 A;  3G1I A;  3I55 P;  1K9M Q;  1Q82 Q;  2CWO A;  2OAR A;  1K30 A;  3CC2 P;  3Q20 A;  1PEM A;  1RO0 A;  1YI2 P;  3DS5 A;  1YIJ P;  4XRQ A;  3LRY A;  2PEQ A;  1M1K Q;  1KC8 Q;  2EIA A;  1VQL P;  5F2N A;  2M8P A;  3G21 A;  4U0D A;  1VQN P;  3CCJ P;  3CC7 P;  5F2K A;  5BS2 A;  1W2B O;  4COC A;  1VQ5 P;  3CCL P;  4U0A A;  3CCE P;  4GR6 A;  4U0C A;  1EOQ A;  1YJN P;  1QRJ A;  1YJW P;  1PEU A;  3DS2 A;  4U0E A;  1BAJ A;  1KD1 Q;  3CME P;  5JPA A;  3I56 P;  1VQ4 P;  2Z44 A;  2PEJ A;  1KQS O;  4U0B A;  3DPH A;  2PY8 A;  4PH1 A;  3H47 A;  1YJ9 P;  1AUM A;  2LF4 A;  3HYB A;  3CCQ P;  5HGO A;  1YIT P;  3G28 A;  3DS3 A;  4WYM A;  3CCS P;  4M0I A;  2M8N A;  4XRO A;  1VQ7 P;  1ZMB A;  2BHV A;  1QVG O;  4GR2 A;  3VRL C;  1VQ8 P;  2PEI A;  1IUQ A;  3G29 A;  4XFX A;  2EG5 A;  3WBH A;  1M6N A;  3DTJ A;  2PEN A;  1Q7Y Q;  1Q81 Q;  1VQ9 P;  1NJI Q;  1RNI A;  2XT1 A;  3M1M A;  1VQK P;  1PEO A;  1M74 A;  4XFY A;  2EFJ A;  3CCM P;  1YHQ P;  5HGM A;  2DGY A;  2BUO A;  2E1M A;  2XV6 A;  3DS1 A;  4U0F A;  3G26 A;  3CPW O;  2PEK A;  2OTL P;  3E2D A;  3CD6 P;  2XXM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...