3CC2P

The refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution with rrna sequence for the 23s rrna and genome-derived sequences for r-proteins
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 48
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2008-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3cc2P03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 3cc2P01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 3cc2P02
1YI2P 1VQMP 1KD1Q 1M1KQ 1VQ7P 1NJIQ 3CCEP 3CCQP 3CXCO 3I56P 1YITP 1K73Q 2OTJP 1W2BO 1K8AQ 1VQKP 1Q86Q 1VQ8P 1VQ5P 3G4SP 1VQLP 2QEXP 3CC7P 3CCRP 3CCMP 1JJ2O 3CCSP 1VQ6P 1S72P 1YHQP 3CC4P 3OW2O 3G6EP 1K9MQ 3CMAP 1KC8Q 2OTLP 1Q7YQ 3CPWO 1VQNP 1VQOP 1YJNP 1VQPP 1YJ9P 1YIJP 1VQ9P 3CCUP 1VQ4P 3CCLP 3CD6P 1QVFO 3G71P 3I55P 2QA4P 1Q81Q 1QVGO 1M90Q 1YJWP 1KQSO 3CMEP 3CCVP 1N8RQ 3CC2P 1Q82Q 3CCJP
chains in the Genus database with same CATH superfamily
2M3BA 3W68A 2Y0EA 2OTJP 2UWJE 4H44B 5AW8B 1BGYE 2PEMA 2P10A 1L2PA 3GHGA 4KJMA 3RL0g 3TSIA 3A0BE 1ZRTD 1M6EX 2RMZA 2B9BA 2GZGA 2BHVA 1G2CB 2KG6A 1M90Q 1YJWP 3V2RA 2IPPA 2IZ0A 1NQ4A 2FKWB 1FZEA 2WTYA 3G3ZA 4UB6H 1NU1E 3WUUA 3AEAC 3LW5H 4I1LA 2LOLA 1T3UA 1SQBG 3M91A 4N6JA 3H1HE 3L71J 1T2KD 1YJ9P 3FWLA 5CCHA 1GK6A 3L71D 5APYA 2VRSA 1BE3J 2N6YA 2BASA 1CZQA 3C8VA 2OYOA 1U57A 4ZNCA 3AE5C 2EHSA 4XFZA 2P58A 1RO2A 2XT1A 4CPGA 2H88C 3H1LG 4WY4D 2PEOA 1URQB 4WB4A 2E74B 1JY2O 2A45H 2FFDB 2X2BA 1XTGB 1LGHB 4RO0A 1M1KQ 1TU3F 2OTKE 1GU4A 3ABVC 2LPKA 2YNYA 1URQC 1SQVE 4H2XC 3L70D 2E74C 1KYOH 4R0MA 2ROQA 2H7HA 2FVFA 2E5YA 1IMPA 1BCCG 4UB6E 1RE3C 2J5UA 3HD7B 2WT7B 1NU1K 1NTME 3H32A 2CNRA 1ZR2A 2CPSA 4U3FE 1ZV8A 3V4QA 2XNDH 2KOQA 2OYIB 5AVSB 1JB0J 2QEXP 3EJEA 4NPDA 1KILB 3GF7A 3TGUJ 4N78E 4HJGH 1OW6A 1BDCA 1IFIA 4JF7A 2FYUG 3MD0A 2O01N 4RESB 1AQTA 5HVCA 3GJNA 1NHLA 1KILC 4H0LC 2XKMA 1VDFA 1LP1B 2Q6QA 1NTZE 1JY2P 2O01H 4BRYB 3B8EB 1NKNA 3T97B 1KLPA 3HE5A 4LGDE 2PEQA 4GODA 3SFDC 1Q90D 2FXPA 3GMAA 3G26A 2K0XA 2NZ2A 1SQVK 3M0DC 1KYOE 1QL1A 1VF5D 3MGEA 2N5IA 3E1RA 3G4SP 1USEA 2WZ7A 5AVWB 1NTMK 3TK1A 4ASWA 5F2OA 1SQVD 4YXWH 1LT1A 2QNWA 1RE4A 1Q81Q 1GZLA 1KD1Q 5AVYB 1YYCA 1NTMD 3F5HA 2BCCJ 3H1JJ 1SQXD 2QVAA 4XFYA 2WVRA 1L0LJ 1OXZA 1NTZK 1G2CA 2KSEA 1T2KC 5EW5E 3H1LE 3RGUA 2LMLA 1HTLC 4I6MC 3SWFA 3L74D 1KFNA 2WPQA 1KN7A 2WITA 3H1KJ 3VRLC 4QNBA 1NTKG 2D2CD 3CMAP 3CPWO 3SWYA 2YO3A 3PP5A 2XXMA 1VQ9P 1BSHA 1QX8A 5B5EH 3RK2B 4KT0J 4D6TD 1BCCE 1USDA 1AFOA 2JYGA 2K93A 2R3CA 2KS1B 4JBZA 1SQBK 2YKPA 2KGEA 1RF1B 2FFDA 4C7RA 1FZFA 2KZIA 2FYUE 2CG5B 5KLVD 1SQBD 1OMIA 3L72J 4C7NB 1RF1C 3BASA 4YTPC 2KORA 4F37A 3PTZA 1HJBA 2YKOA 4GDOA 3D71A 2E42A 3BRTB 2KGAA 3HD7A 2WT7A 2W6AA 2KGDA 2KLUA 1IK9A 3B5ND 4GR2A 2LR2A 2OYIA 1HJ0A 2Q1KA 3CI9A 4PWVB 4GT1A 5B5EE 1KILA 4I7ZC 3L73G 2GM4A 3CCUP 1FAVA 1NWQA 1Q82Q 1PV3A 1NGMB 2KG9A 2NPSD 2FACA 3HE4A 1JTHB 1LP1A 1SQQJ 2DNWA 4PV1D 3D6YA 2KP8A 1RH5B 2ERHA 3M0DA 1BXIA 1SQQD 2KIKA 2XU6A 3T97A 2POHA 1FZBA 2WPVB 1JY2N 1BAJA 1VQOP 1BSNA 1PIXA 2FYNB 2PFXA 2FYUK 3NTNA 1OZHA 5BU5A 3GZMA 1FS0E 3G21A 3AE7C 2PEJA 1N86A 1GU5A 1PL5A 2QM8A 3ZDMA 5KKZB 1DIPA 2L6EA 3M1MA 3P32A 2JWAA 1L0NJ 4XE5B 2Z46A 5AVVB 2R32A 3AE1C 3LIEA 1PPJG 1L0ND 3EFFK 1S5LH 1PP9J 5KKZC 5KJ7D 1NTKE 4U0AA 3AE6C 3K5BA 2CGQA 1IFDA 1K73Q 2KSJA 1SS1A 4YXDC 1IFPA 1SQPJ 1L4AB 1OVVA 3PLNA 2BQ1E 3JC22 1S2EA 3IR9A 3U1AA 2D2CC 3CXHE 2EHTA 1EXJA 2AVAA 4BPHA 1RQVA 1GTWA 3WUTA 4EIJA 2B89A 5CHXA 2KOOA 1BE3G 1FZCB 1KMIZ 1S9KE 2RN0A 1FJKA 3BCCG 4KHXA 1OIPA 4IFDK 2LL8A 1FZCC 1LTAC 4GOEA 3CX5E 4ZKPA 5GTHH 5AW5B 2WPRA 1UIIA 1IZNB 3H6PA 1S5LE 1EQ7A 3A3YB 3PH0A 5B66H 1AQ5A 3RK3D 1NTKK 2KS1A 1JMMA 4XRQA 3H47A 4HKZH 3E1IA 2IDBA 2I8DA 3C1LA 2ONTA 2C9NY 1QEXA 1A43A 3CCVP 4U7JA 1GDTA 1JOCA 1H0TA 3L73E 3JCUH 3H1IG 5KP6B 4C7NA 3B5NC 3QWOC 1YQ3C 1N7SD 1WMKA 2ZFCA 3CCLP 2KODA 1NYHA 4OWFA 3CCJP 1FDOA 4PV1B 2QJPB 3MIWA 5CCGC 3CXHD 2J58A 2EG5A 1KYOI 2NPSC 3L37A 4JPZB 5GTHE 2K88A 2AXCA 3CLQA 2HR3A 2A06D 1EZVG 4PV1C 2KOPA 1MV8A 2JQ4A 2HFED 1FDIA 3GG2A 3R2PA 5AW4B 5EJDA 5KP7B 1M57D 1PPJE 3O6QB 3CX5D 1LT9C 5TJHA 2AEJA 3A5TA 1X3OA 4PH1A 3JCUE 4W80A 1VQPP 1KB9E 3AE2C 2QJYC 1L0IA 2FAEA 2JU2A 4MRTC 1P84H 3Q5RA 2QG4A 2AFDA 2H89C 2Z5IA 1UJZA 1ZR4A 2ZJSE 1ACPA 1JCDA 4M0IA 1BE3E 3NY7B 1LTJB 1JM0A 4WWIA 4L74A 3LRYA 4XROA 2A45G 1A02F 3BCCE 2GDYA 1L0LG 2WSEJ 1NJIQ 4PH0A 2C0WA 3I56P 1R5SA 2Q5UA 3MUDC 1FC2C 1K04A 1LTJC 2BEQD 4LC1A 4NPFX 1AJYA 4NPEA 1L4AA 3A0HH 3F89A 3WBHA 1DNYA 4EYYQ 1YIJP 2BEZF 2IBZG 2KGCA 3CMEP 4HB1A 2J59M 3ITKA 2NRGA 2KOSA 1FZCA 1X22A 3HZQA 3FWNA 1SFCB 1P84E 4DT0A 2Z4EA 1U7JA 2VLNA 3H1IE 1LNQA 3RK3C 2R3SA 1A02J 2BUOA 1SFCC 1KB9D 2JDIH 1VQKP 2FBWC 3AE8C 5DJUB 1LWUB 3TGUE 4DJGA 3MGNA 1GL2A 2K0DX 3WMM0 3I5CA 5CJ0A 3L72G 4DCKA 2W6BA 1DD4A 3KPEA 1AYIA 1LWUC 2N1TD 1N7SC 1HWTC 3GKLC 3Q5SA 3L70J 1EZVE 3S9OA 5L8RJ 1LTBC 3BCCD 1JJ2O 2L5GB 1S72P 1E79H 3DS1A 3CWBG 1ZOYC 1BGYD 2KR5A 5CCGA 1VQ4P 3VTPC 4UHPB 3OA7A 5AW6B 2YIUC 3L75G 5AVXB 3KQGA 1VQ8P 1Y9BA 2PRRA 3NFQA 1NU1J 1M6NA 4H0LB 4COCA 2RH0A 2K5XA 1NU1D 3WU2H 3IN6A 3MZWB 4IFMA 3H1HD 2ZYGA 2KWLA 1NKZB 4QKOA 2HG5D 2GZFA 2W6JH 3O6QA 4IZ6A 1FZAA 3N7NA 3S4RA 1Y47A 2JWDA 1L0LE 2KOGA 1QRJA 5KTBA 2K1AA 3GW6A 4HH2A 3U43A 2JEEA 3QH9A 1PP9G 1IUQA 2IBZE 2L4BA 3L4FA 1T8KA 2K9JB 3CXHI 1J1EB 1ZN5A 2MD9A 2QE7H 1SQVJ 2L0QA 1LTSC 1EZVD 2WSFJ 2IYOA 2ZXXA 3U1CA 3CD6P 3RBZA 3FX0A 1LTJA 2E43A 1J1EC 1NTMJ 2FYZA 2N5HA 5DJTB 3TNUB 1SQXJ 2Y9YA 4AQRD 3WU2E 3CX5I 4U3FD 2WSSH 2EIAA 2MVUA 3V2PA 2XZ1C 2XNXA 2CWOA 2WPTA 2Y0CA 3RL0D 1VPCA 4U0DA 4U0CA 2K2QA 4N78D 3L74J 4DOJA 1L0LK 3L72E 2PP6A 2MVVA 4CA3A 1Q2NA 2EFJA 4WY4B 1SFCA 3H0DA 4U0BA 2JB0A 1NTZD 3VOPA 1D7MA 3VMZA 2ZXEB 2B87B 3II6A 4D6TJ 1U7MA 2K92A 4WY4C 3CWBE 3EJDA 1X79B 3OJAB 3G1IA 3NTEA 1LWUA 2KW2A 1KYOD 4HKGA 1YHQP 2KXPB 2OYHC 1IFNA 3L75E 2IBZD 5BS1A 2E1MA 2VLOA 3LMOA 1JO5A 1URQA 1JY3O 1QL2A 1AA0A 5KAFH 1SQBJ 4C46A 5KLVJ 2PAJA 1GXHA 2DW3A 4AUWA 2E75D 2ZVOB 1Y8AA 2Q9IA 4QMAA 4RKUJ 1RE3A 2HLOA 1ZMEC 1AUMA 3GZLA 2GUSA 3AECC 1H88A 1PFIA 3B4SA 2Q7CA 3SSUA 5CCHD 3DS2A 2M8LA 4I7ZB 5KLIC 3D70A 2L9FA 3VMYA 1KB9I 2YO2A 3U59A 3P8MC 3A2AA 4PD4H 1N73B 3B5IA 3H1LD 3G6EP 1PP9E 3S1KA 2ZVNB 1OW7A 4L76A 1VF5B 4O9BA 1XTCC 1M74A 1N73C 4Y99B 2ZT9D 1M1JB 3B71A 1RQUA 1BCCJ 3HUSB 1AF8A 2HODB 1J2JB 1NAYA 1VF5C 2C0XA 3CWBD 1JY3P 4BRYA 1BCCD 5KAFE 2HYNA 4Y99C 1M1JC 1HVVA 3Q20A 5M1BA 2M5AB 3HUSC 3L75D 4H2WC 3KXDA 1FOSF 2R44A 3H4EA 2JO1A 2JAZA 4PXHB 3AEDC 3RL0B 1EDIA 1NVOA 5H2FH 2K9JA 2Y0DA 2FYUD 1MZ8A 2JR8A 1YJNP 3KZIH 1VKUA 1LJ2A 2YMKA 5KP8B 1OVRA 2VSQA 3RL0C 4PD4E 5AW7B 3EJBA 1DH3A 1VQLP 2D2CB 4BPGA 4Z1MH 2K9YA 1OVUA 1NOHA 2GZIA 2YMYA 2B88A 1JUNA 2YKQA 2XV6A 2E76D 5CMZA 3L71G 2LXBA 3CC2P 1SVFA 1PEMA 1YITP 1T6AA 3JSVC 1K8AQ 3GHGB 1CSBA 5APQA 1DD3A 3FGAD 4WY4A 1SP4A 1EZVI 4AYCA 3M06A 3GHGC 2B87A 5H2FE 5GTIH 2G3AA 2FHSC 2ZYAA 1G1JA 2WSEH 4H44D 2GDXA 3N4XA 3CC4P 3Q2YA 2E75C 1MUUA 3LIDA 4NEOA 5JPAA 2L91A 3I55P 2AF8A 3B5NB 1RF1A 1S4XA 1ZXGA 5AVTB 1VHNA 1DEEG 1R5LA 1KILE 1NTKD 2KNCB 5AVUB 1AVOA 2MR7A 2M5RA 3M0AA 3TF5A 2RKLA 3V5BA 3DS3A 3TGUG 2A45I 2NPSB 4B86A 1JMBA 2ZT9C 5GTIE 2FVEA 3OW2O 1R8EA 1X9VA 1PGPA 1MFZA 2IFNA 2IBZI 1LT9B 3SWKA 2LKMA 4K35A 4OVNF 3H32B 1S9KD 3C9IA 5B66E 2YXRB 1W2BO 1M1JA 5AW1B 2QJYB 5HGLA 1ZRTE 1JTHA 1RHZB 1IC2A 2HODA 2SPZA 2KZJA 2XZ0D 1VQNP 3EWKA 4W7ZA 1JY3N 4K3AA 4W7YA 1H89A 2JJLA 3A7OA 3L35A 5TISH 2M5AA 2IFMA 4Y28J 1DV5A 2MKVA 3HD7D 5AVQB 1GD2E 4ZMDA 5KJ7C 3L71E 1SQXG 3AE9C 5EFWB 1J1DB 3L73D 1RNIA 1KC8Q 2WQYC 2E76B 2L22A 2BCCG 3H1JG 5F2NA 3M9QA 3HTKB 2XZRA 2R5DA 3MP7B 1J1DC 1MFTA 5AW3B 2E76C 5CZDB 1KZUB 3DTJA 3L74G 3VMXA 3DS0A 2R5BA 1ZNVA 1OWAA 5HGNA 2AXTH 1M56D 3H1KG 1QVGO 2GA1A 1BDDA 3HRNA 3V4WA 1FJPA 1OFCX 1RE4C 3IAOA 4D6TG 2KI7B 3RK3B 2AEMA 1EOQA 7CEIA 1ZLLA 1PEOA 2JU1A 5TISE 1PPJD 1PEQA 2K3RA 4H44C 3VP9A 2WSFH 1FE6A 4IPYA 5AW9B 1N7LA 4R4LA 3M9HA 3CCEP 2KB7P 3RG6C 1Q86Q 1X0TA 5HGOA 1FU1A 5KLVG 2MJZA 2VLPA 2LIUA 1N7SB 5APSA 1KQGB 2LIWA 1IJDB 2P9XA 2JKVA 5APVA 5AVRB 2V4HA 2E5TA 3B4QA 3B5NA 3KDPB 1E5WA 1BE3D 2AXTE 3BCCJ 3A0HE 3H25A 3CCMP 2KNCA 3VP8A 1BGYJ 2YIUB 2I1KA 4M3LA 2O1JA 1IMQA 3FXDA 2Z5HA 4TT3H 4HYTB 2MR8A 1HY8A 1KFMA 1ZMBA 1MZ9A 2NPSA 4XA4A 3AEBC 1YI2P 1VQMP 2GUVA 1JNMA 3VMAA 1QLED 3RK2D 2P2UA 1S1CX 1RF0C 2FFDC 2G8YA 2M3EA 1OX3A 1SQQG 3H1HJ 4N3YB 2V7QJ 1LT9A 2WSCJ 1P84D 3H1IJ 1SQXE 2HPCB 1SLQA 2H43A 3H1ID 2BCCE 3H1JE 2Y9ZA 3V2QA 1CI6B 3HD7C 5E79H 4PD4I 1NH4A 2KLVA 2KYVA 2OYIC 2N9BA 3TGUD 5KJ7A 5I4TG 1L0NG 1W2EA 3L74E 1VL2A 2W90A 2ZAEB 3PJSK 3HE4B 3H1KE 4RJTA 3V2NA 3O8ZA 1IO4A 3G1GA 1LTTC 1Z6MA 2K37A 2FADA 4D6TE 1KORA 3MUDA 4GOFA 2W8ZA 5APUA 3BATA 4WBAA 1SQPG 2QSIA 3HTKA 3UIAA 1VQ7P 3LW5J 3G28A 3CCQP 2C9LY 4U3FJ 2FY8A 2MF4A 4WVZA 3CCSP 1N2DC 5CBNA 2YXQB 1SQXK 4BPFA 2MY5A 2JP3A 3GLMA 1DX7A 2P1JA 4TLFA 2OARA 2Z44A 1SQBE 1WRGA 1FBMA 5E79E 5KLVE 3W67A 3DS5A 2IYPA 4BXLA 1EDKA 5BS2A 1T8ZA 1EC5A 1NTZJ 4EI2A 2BCCD 3H1JD 3RG2A 1K30A 3P8CE 2N1TB 1HGVA 1HGZA 2ITAA 1L0LD 2OYHB 2WPSA 5KAIH 1HQBA 4ZKUA 4R4MA 4XFXA 4I2LC 4DG9A 2N1TC 5AW2B 3GF3A 3H1KD 1N7SA 1AVYA 2OTLP 3EQ2A 3TYYA 1ZW0A 4JQ0D 1L4AD 5K5GB 1ZP0C 3P05A 1SQQE 1L0HA 4H13D 1LTIC 1W5CE 4JYCA 5KLVK 5KLIB 1KV4A 2Z45A 3RK2C 1FZGA 2A06G 1RF0A 3AE4C 1H0TB 1EIAA 2O01J 3KHUA 2VLQA 3Q3DA 1L0NE 3H1LJ 2P67A 2PENA 2P7JA 2N98A 1KQLA 4OGQD 3L72D 5HGMA 5KAIE 1Q7YQ 1GL2D 3IF4A 3AEFC 1WT6A 1OR5A 2OGUA 4GIFA 1A8OA 1KQSO 4PJ0H 5APTA 1GK4A 3AEEC 2FXMA 2H8PD 2GYKA 3P8CD 2HPCA 5BVZA 3CWBJ 1VQ5P 3CC7P 4YPCA 2JYLA 1CI6A 1SQPE 3PRJA 1FDMA 5CJ4A 1SQQK 3L75J 1FOSE 5CCGD 1EDJA 1EDLA 3BRVB 3WUVA 3DS4A 4DZOA 2WMMA 1CEIA 5BU8B 5APXA 3CXHH 3CCRP 2FYUJ 2PY8A 3NMDA 1GPJA 3IFMA 2IX7C 2M8NA 1K05A 1FR2A 4IOIH 1L0NK 2WWWA 4IL6H 2O3JA 1P84I 2JGPA 3RK3E 1H8AA 2K94A 3TNUA 1G1IA 2FYNC 1HH0A 3CX5H 4MN4C 4LLHA 4PJ0E 2W27A 1YQ4C 2PNGA 4OH8B 3CL3D 1HUCA 4IL6X 1YBKA 4H2YC 1PP9D 2GZJA 4L73A 1SQPK 1Z56A 3CXCO 2N9YB 1UIXA 4UB8H 5DCKA 2GZEA 3RBXA 2JBGA 1JCCA 4EDFA 1S5LX 2N6ZA 1M8OB 2K0YA 1PGOA 2M8PA 2KG8A 1SQPD 2N1TA 2N50A 2E75B 3HYBA 4H13B 1L4AC 3NXSA 2OYHA 4ASVA 1X8YA 2A06E 1HF9A 1PGJA 3KZIE 4COPA 1MKMA 2I1JA 4IL6E 2W83C 3L70G 4H13C 3OAKA 2KK7A 2CQ8A 1GMJA 3VN0A 1BGYG 2QA4P 2LTEA 4GR6A 3M9BA 1N8RQ 2PEIA 1CW5A 2AFEA 1NTKJ 3MTUE 1E0HA 5CCHC 1M7LA 2M8RA 4OGQB 4PD4D 1GW4A 1GL2B 5C39A 1JEKA 3AEGC 5F2KA 1SFCD 1E6JP 2DGYA 1NU1G 4UB8E 3DPHA 4OGQC 2ZT9B 2FQ1A 2FXOA 1GL2C 3H1HG 1NAFA 1IFJA 2LF4A 1KB9H 1PGQA 2ZYDA 2FVAA 2XDJA 3D6ZA 2Q3IA 1EMVA 4XFJA 2AEFA 5AW0B 1N73A 2M0BA 1HBWA 1OW8A 2QJKB 5HV8A 3EFGA 4L75A 5APWA 1KTMA 1URQD 3AE3C 2E74D 4BWNA 5CBOA 1GW3A 2CPBA 2QJKC 2Q3EA 1RY3A 3G29A 2XV5A 2NO8A 1IK7A 1YTZI 3HUSA 3USSA 2LKIA 1DEBA 2QM7A 2KUBA 4WYMA 4JYBA 2QJPC 4EOTA 4A7PA 3KYQA 1QVFO 1YTZT 3Q1MA 1AV1A 1SQVG 2O1KA 2QRXA 2LXCB 3A0BH 3Q5PA 3G0VA 3L73J 4U0FA 3L36A 1NTMG 1VQ6P 3HE5B 3P7KA 1UNKA 3E7KA 4U3FG 2GDWA 2FQ2A 2CK3H 2OQQA 1K9MQ 3SFEC 1KILD 1NO4A 2QIWA 1QGKB 4H0LD 2PGDA 4GKGA 1S3JA 2IZ1A 4IFFA 1EXIA 1IFMA 3MHVA 1D1DA 2V7QH 1KQFB 3E2DA 2WSCH 3VYIA 3R4YA 3G9RA 2FQ0A 2JO0A 2PEKA 3TDKA 1PZQA 3CE7A 1F80D 3BVHA 3PHLA 4U0EA 1T3JA 5AVZB 3FXEA 1NTZG 3G71P 1LTGC 3V6IA 1RO0A 1GXGA 1PEUA 3L70E
chains in the Genus database with same CATH topology
3P05A 2LF4A 1PEMA 3CCEP 1YITP 2OTJP 3RG6C 1W2BO 1K8AQ 1Q86Q 5HGOA 2PEMA 5HGLA 2QEXP 3VRLC 1JJ2O 4QNBA 2EIAA 1S72P 3B5IA 3DS1A 2Z45A 2CWOA 3G6EP 4M0IA 3G1GA 3CMAP 4XRQA 3H47A 3CPWO 1VQNP 1BAJA 1VQOP 1M6EX 2XXMA 1VQ9P 2P9XA 1VQ4P 4U0DA 4U0CA 2BHVA 2ONTA 3LRYA 1M90Q 1YJWP 1A43A 4XROA 3CCVP 1M74A 1EIAA 3G21A 1VQ7P 1NJIQ 4PH0A 2PEJA 3G28A 3CCQP 3CXCO 3I56P 2JYGA 1VQ8P 2L6EA 3M1MA 5DCKA 3G29A 3CCMP 3CCSP 2EFJA 2PENA 1M6NA 3CC4P 1RNIA 2Z46A 4COCA 3H0DA 5HGMA 2PEQA 1KC8Q 4U0BA 4WYMA 1Q7YQ 3WBHA 5JPAA 1YJ9P 1YIJP 2M8PA 5F2NA 3Q20A 3CCLP 2KODA 1QVFO 2OARA 3I55P 2Z44A 1A8OA 3G26A 1KQSO 3CMEP 4U0AA 1ZMBA 3HYBA 3CCJP 1YI2P 1VQMP 3DS5A 3MGEA 3G0VA 1K73Q 3H4EA 1VQ5P 3G4SP 3CC7P 5BS2A 2JYLA 3DTJA 3G1IA 3NTEA 4U0FA 4COPA 4XFZA 3HZQA 1VQ6P 3DS0A 1RO2A 2EG5A 2XT1A 1YHQP 5HGNA 1QRJA 1K9MQ 5F2OA 1K30A 5BS1A 2E1MA 1YJNP 2PEOA 2BQ1E 3DS3A 2QA4P 1Q81Q 1QVGO 2BUOA 4GR6A 1N8RQ 2PEIA 3DS4A 1KD1Q 1M1KQ 1D1DA 1IUQA 3E2DA 4GR2A 1VQKP 1VQLP 4XFXA 1EOQA 3CCRP 2JO0A 2PEKA 1PEOA 1AUMA 2PY8A 4XFYA 3OW2O 1PEQA 5F2KA 4PH1A 2OTLP 4U0EA 1E6JP 1VQPP 2DGYA 2M8NA 5I4TG 3CCUP 3CD6P 2XV6A 3G71P 1RO0A 3DPHA 3DS2A 1PEUA 4IPYA 2M8LA 3CC2P 1Q82Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YI2 P;  1VQM P;  1KD1 Q;  1M1K Q;  1VQ7 P;  1NJI Q;  3CCE P;  3CCQ P;  3CXC O;  3I56 P;  1YIT P;  1K73 Q;  2OTJ P;  1W2B O;  1K8A Q;  1VQK P;  1Q86 Q;  1VQ8 P;  1VQ5 P;  3G4S P;  1VQL P;  2QEX P;  3CC7 P;  3CCR P;  3CCM P;  1JJ2 O;  3CCS P;  1VQ6 P;  1S72 P;  1YHQ P;  3CC4 P;  3OW2 O;  3G6E P;  1K9M Q;  3CMA P;  1KC8 Q;  2OTL P;  1Q7Y Q;  3CPW O;  1VQN P;  1VQO P;  1YJN P;  1VQP P;  1YJ9 P;  1YIJ P;  1VQ9 P;  3CCU P;  1VQ4 P;  3CCL P;  3CD6 P;  1QVF O;  3G71 P;  3I55 P;  2QA4 P;  1Q81 Q;  1QVG O;  1M90 Q;  1YJW P;  1KQS O;  3CME P;  3CCV P;  1N8R Q;  3CC2 P;  1Q82 Q;  3CCJ P; 
#chains in the Genus database with same CATH topology
 2M3B A;  3W68 A;  2Y0E A;  2OTJ P;  2UWJ E;  4H44 B;  5AW8 B;  1BGY E;  2PEM A;  2P10 A;  1L2P A;  3GHG A;  4KJM A;  3RL0 g;  3TSI A;  3A0B E;  1ZRT D;  1M6E X;  2RMZ A;  2B9B A;  2GZG A;  2BHV A;  1G2C B;  2KG6 A;  1M90 Q;  1YJW P;  3V2R A;  2IPP A;  2IZ0 A;  1NQ4 A;  2FKW B;  1FZE A;  2WTY A;  3G3Z A;  4UB6 H;  1NU1 E;  3WUU A;  3AEA C;  3LW5 H;  4I1L A;  2LOL A;  1T3U A;  1SQB G;  3M91 A;  4N6J A;  3H1H E;  3L71 J;  1T2K D;  1YJ9 P;  3FWL A;  5CCH A;  1GK6 A;  3L71 D;  5APY A;  2VRS A;  1BE3 J;  2N6Y A;  2BAS A;  1CZQ A;  3C8V A;  2OYO A;  1U57 A;  4ZNC A;  3AE5 C;  2EHS A;  4XFZ A;  2P58 A;  1RO2 A;  2XT1 A;  4CPG A;  2H88 C;  3H1L G;  4WY4 D;  2PEO A;  1URQ B;  4WB4 A;  2E74 B;  1JY2 O;  2A45 H;  2FFD B;  2X2B A;  1XTG B;  1LGH B;  4RO0 A;  1M1K Q;  1TU3 F;  2OTK E;  1GU4 A;  3ABV C;  2LPK A;  2YNY A;  1URQ C;  1SQV E;  4H2X C;  3L70 D;  2E74 C;  1KYO H;  4R0M A;  2ROQ A;  2H7H A;  2FVF A;  2E5Y A;  1IMP A;  1BCC G;  4UB6 E;  1RE3 C;  2J5U A;  3HD7 B;  2WT7 B;  1NU1 K;  1NTM E;  3H32 A;  2CNR A;  1ZR2 A;  2CPS A;  4U3F E;  1ZV8 A;  3V4Q A;  2XND H;  2KOQ A;  2OYI B;  5AVS B;  1JB0 J;  2QEX P;  3EJE A;  4NPD A;  1KIL B;  3GF7 A;  3TGU J;  4N78 E;  4HJG H;  1OW6 A;  1BDC A;  1IFI A;  4JF7 A;  2FYU G;  3MD0 A;  2O01 N;  4RES B;  1AQT A;  5HVC A;  3GJN A;  1NHL A;  1KIL C;  4H0L C;  2XKM A;  1VDF A;  1LP1 B;  2Q6Q A;  1NTZ E;  1JY2 P;  2O01 H;  4BRY B;  3B8E B;  1NKN A;  3T97 B;  1KLP A;  3HE5 A;  4LGD E;  2PEQ A;  4GOD A;  3SFD C;  1Q90 D;  2FXP A;  3GMA A;  3G26 A;  2K0X A;  2NZ2 A;  1SQV K;  3M0D C;  1KYO E;  1QL1 A;  1VF5 D;  3MGE A;  2N5I A;  3E1R A;  3G4S P;  1USE A;  2WZ7 A;  5AVW B;  1NTM K;  3TK1 A;  4ASW A;  5F2O A;  1SQV D;  4YXW H;  1LT1 A;  2QNW A;  1RE4 A;  1Q81 Q;  1GZL A;  1KD1 Q;  5AVY B;  1YYC A;  1NTM D;  3F5H A;  2BCC J;  3H1J J;  1SQX D;  2QVA A;  4XFY A;  2WVR A;  1L0L J;  1OXZ A;  1NTZ K;  1G2C A;  2KSE A;  1T2K C;  5EW5 E;  3H1L E;  3RGU A;  2LML A;  1HTL C;  4I6M C;  3SWF A;  3L74 D;  1KFN A;  2WPQ A;  1KN7 A;  2WIT A;  3H1K J;  3VRL C;  4QNB A;  1NTK G;  2D2C D;  3CMA P;  3CPW O;  3SWY A;  2YO3 A;  3PP5 A;  2XXM A;  1VQ9 P;  1BSH A;  1QX8 A;  5B5E H;  3RK2 B;  4KT0 J;  4D6T D;  1BCC E;  1USD A;  1AFO A;  2JYG A;  2K93 A;  2R3C A;  2KS1 B;  4JBZ A;  1SQB K;  2YKP A;  2KGE A;  1RF1 B;  2FFD A;  4C7R A;  1FZF A;  2KZI A;  2FYU E;  2CG5 B;  5KLV D;  1SQB D;  1OMI A;  3L72 J;  4C7N B;  1RF1 C;  3BAS A;  4YTP C;  2KOR A;  4F37 A;  3PTZ A;  1HJB A;  2YKO A;  4GDO A;  3D71 A;  2E42 A;  3BRT B;  2KGA A;  3HD7 A;  2WT7 A;  2W6A A;  2KGD A;  2KLU A;  1IK9 A;  3B5N D;  4GR2 A;  2LR2 A;  2OYI A;  1HJ0 A;  2Q1K A;  3CI9 A;  4PWV B;  4GT1 A;  5B5E E;  1KIL A;  4I7Z C;  3L73 G;  2GM4 A;  3CCU P;  1FAV A;  1NWQ A;  1Q82 Q;  1PV3 A;  1NGM B;  2KG9 A;  2NPS D;  2FAC A;  3HE4 A;  1JTH B;  1LP1 A;  1SQQ J;  2DNW A;  4PV1 D;  3D6Y A;  2KP8 A;  1RH5 B;  2ERH A;  3M0D A;  1BXI A;  1SQQ D;  2KIK A;  2XU6 A;  3T97 A;  2POH A;  1FZB A;  2WPV B;  1JY2 N;  1BAJ A;  1VQO P;  1BSN A;  1PIX A;  2FYN B;  2PFX A;  2FYU K;  3NTN A;  1OZH A;  5BU5 A;  3GZM A;  1FS0 E;  3G21 A;  3AE7 C;  2PEJ A;  1N86 A;  1GU5 A;  1PL5 A;  2QM8 A;  3ZDM A;  5KKZ B;  1DIP A;  2L6E A;  3M1M A;  3P32 A;  2JWA A;  1L0N J;  4XE5 B;  2Z46 A;  5AVV B;  2R32 A;  3AE1 C;  3LIE A;  1PPJ G;  1L0N D;  3EFF K;  1S5L H;  1PP9 J;  5KKZ C;  5KJ7 D;  1NTK E;  4U0A A;  3AE6 C;  3K5B A;  2CGQ A;  1IFD A;  1K73 Q;  2KSJ A;  1SS1 A;  4YXD C;  1IFP A;  1SQP J;  1L4A B;  1OVV A;  3PLN A;  2BQ1 E;  3JC2 2;  1S2E A;  3IR9 A;  3U1A A;  2D2C C;  3CXH E;  2EHT A;  1EXJ A;  2AVA A;  4BPH A;  1RQV A;  1GTW A;  3WUT A;  4EIJ A;  2B89 A;  5CHX A;  2KOO A;  1BE3 G;  1FZC B;  1KMI Z;  1S9K E;  2RN0 A;  1FJK A;  3BCC G;  4KHX A;  1OIP A;  4IFD K;  2LL8 A;  1FZC C;  1LTA C;  4GOE A;  3CX5 E;  4ZKP A;  5GTH H;  5AW5 B;  2WPR A;  1UII A;  1IZN B;  3H6P A;  1S5L E;  1EQ7 A;  3A3Y B;  3PH0 A;  5B66 H;  1AQ5 A;  3RK3 D;  1NTK K;  2KS1 A;  1JMM A;  4XRQ A;  3H47 A;  4HKZ H;  3E1I A;  2IDB A;  2I8D A;  3C1L A;  2ONT A;  2C9N Y;  1QEX A;  1A43 A;  3CCV P;  4U7J A;  1GDT A;  1JOC A;  1H0T A;  3L73 E;  3JCU H;  3H1I G;  5KP6 B;  4C7N A;  3B5N C;  3QWO C;  1YQ3 C;  1N7S D;  1WMK A;  2ZFC A;  3CCL P;  2KOD A;  1NYH A;  4OWF A;  3CCJ P;  1FDO A;  4PV1 B;  2QJP B;  3MIW A;  5CCG C;  3CXH D;  2J58 A;  2EG5 A;  1KYO I;  2NPS C;  3L37 A;  4JPZ B;  5GTH E;  2K88 A;  2AXC A;  3CLQ A;  2HR3 A;  2A06 D;  1EZV G;  4PV1 C;  2KOP A;  1MV8 A;  2JQ4 A;  2HFE D;  1FDI A;  3GG2 A;  3R2P A;  5AW4 B;  5EJD A;  5KP7 B;  1M57 D;  1PPJ E;  3O6Q B;  3CX5 D;  1LT9 C;  5TJH A;  2AEJ A;  3A5T A;  1X3O A;  4PH1 A;  3JCU E;  4W80 A;  1VQP P;  1KB9 E;  3AE2 C;  2QJY C;  1L0I A;  2FAE A;  2JU2 A;  4MRT C;  1P84 H;  3Q5R A;  2QG4 A;  2AFD A;  2H89 C;  2Z5I A;  1UJZ A;  1ZR4 A;  2ZJS E;  1ACP A;  1JCD A;  4M0I A;  1BE3 E;  3NY7 B;  1LTJ B;  1JM0 A;  4WWI A;  4L74 A;  3LRY A;  4XRO A;  2A45 G;  1A02 F;  3BCC E;  2GDY A;  1L0L G;  2WSE J;  1NJI Q;  4PH0 A;  2C0W A;  3I56 P;  1R5S A;  2Q5U A;  3MUD C;  1FC2 C;  1K04 A;  1LTJ C;  2BEQ D;  4LC1 A;  4NPF X;  1AJY A;  4NPE A;  1L4A A;  3A0H H;  3F89 A;  3WBH A;  1DNY A;  4EYY Q;  1YIJ P;  2BEZ F;  2IBZ G;  2KGC A;  3CME P;  4HB1 A;  2J59 M;  3ITK A;  2NRG A;  2KOS A;  1FZC A;  1X22 A;  3HZQ A;  3FWN A;  1SFC B;  1P84 E;  4DT0 A;  2Z4E A;  1U7J A;  2VLN A;  3H1I E;  1LNQ A;  3RK3 C;  2R3S A;  1A02 J;  2BUO A;  1SFC C;  1KB9 D;  2JDI H;  1VQK P;  2FBW C;  3AE8 C;  5DJU B;  1LWU B;  3TGU E;  4DJG A;  3MGN A;  1GL2 A;  2K0D X;  3WMM 0;  3I5C A;  5CJ0 A;  3L72 G;  4DCK A;  2W6B A;  1DD4 A;  3KPE A;  1AYI A;  1LWU C;  2N1T D;  1N7S C;  1HWT C;  3GKL C;  3Q5S A;  3L70 J;  1EZV E;  3S9O A;  5L8R J;  1LTB C;  3BCC D;  1JJ2 O;  2L5G B;  1S72 P;  1E79 H;  3DS1 A;  3CWB G;  1ZOY C;  1BGY D;  2KR5 A;  5CCG A;  1VQ4 P;  3VTP C;  4UHP B;  3OA7 A;  5AW6 B;  2YIU C;  3L75 G;  5AVX B;  3KQG A;  1VQ8 P;  1Y9B A;  2PRR A;  3NFQ A;  1NU1 J;  1M6N A;  4H0L B;  4COC A;  2RH0 A;  2K5X A;  1NU1 D;  3WU2 H;  3IN6 A;  3MZW B;  4IFM A;  3H1H D;  2ZYG A;  2KWL A;  1NKZ B;  4QKO A;  2HG5 D;  2GZF A;  2W6J H;  3O6Q A;  4IZ6 A;  1FZA A;  3N7N A;  3S4R A;  1Y47 A;  2JWD A;  1L0L E;  2KOG A;  1QRJ A;  5KTB A;  2K1A A;  3GW6 A;  4HH2 A;  3U43 A;  2JEE A;  3QH9 A;  1PP9 G;  1IUQ A;  2IBZ E;  2L4B A;  3L4F A;  1T8K A;  2K9J B;  3CXH I;  1J1E B;  1ZN5 A;  2MD9 A;  2QE7 H;  1SQV J;  2L0Q A;  1LTS C;  1EZV D;  2WSF J;  2IYO A;  2ZXX A;  3U1C A;  3CD6 P;  3RBZ A;  3FX0 A;  1LTJ A;  2E43 A;  1J1E C;  1NTM J;  2FYZ A;  2N5H A;  5DJT B;  3TNU B;  1SQX J;  2Y9Y A;  4AQR D;  3WU2 E;  3CX5 I;  4U3F D;  2WSS H;  2EIA A;  2MVU A;  3V2P A;  2XZ1 C;  2XNX A;  2CWO A;  2WPT A;  2Y0C A;  3RL0 D;  1VPC A;  4U0D A;  4U0C A;  2K2Q A;  4N78 D;  3L74 J;  4DOJ A;  1L0L K;  3L72 E;  2PP6 A;  2MVV A;  4CA3 A;  1Q2N A;  2EFJ A;  4WY4 B;  1SFC A;  3H0D A;  4U0B A;  2JB0 A;  1NTZ D;  3VOP A;  1D7M A;  3VMZ A;  2ZXE B;  2B87 B;  3II6 A;  4D6T J;  1U7M A;  2K92 A;  4WY4 C;  3CWB E;  3EJD A;  1X79 B;  3OJA B;  3G1I A;  3NTE A;  1LWU A;  2KW2 A;  1KYO D;  4HKG A;  1YHQ P;  2KXP B;  2OYH C;  1IFN A;  3L75 E;  2IBZ D;  5BS1 A;  2E1M A;  2VLO A;  3LMO A;  1JO5 A;  1URQ A;  1JY3 O;  1QL2 A;  1AA0 A;  5KAF H;  1SQB J;  4C46 A;  5KLV J;  2PAJ A;  1GXH A;  2DW3 A;  4AUW A;  2E75 D;  2ZVO B;  1Y8A A;  2Q9I A;  4QMA A;  4RKU J;  1RE3 A;  2HLO A;  1ZME C;  1AUM A;  3GZL A;  2GUS A;  3AEC C;  1H88 A;  1PFI A;  3B4S A;  2Q7C A;  3SSU A;  5CCH D;  3DS2 A;  2M8L A;  4I7Z B;  5KLI C;  3D70 A;  2L9F A;  3VMY A;  1KB9 I;  2YO2 A;  3U59 A;  3P8M C;  3A2A A;  4PD4 H;  1N73 B;  3B5I A;  3H1L D;  3G6E P;  1PP9 E;  3S1K A;  2ZVN B;  1OW7 A;  4L76 A;  1VF5 B;  4O9B A;  1XTC C;  1M74 A;  1N73 C;  4Y99 B;  2ZT9 D;  1M1J B;  3B71 A;  1RQU A;  1BCC J;  3HUS B;  1AF8 A;  2HOD B;  1J2J B;  1NAY A;  1VF5 C;  2C0X A;  3CWB D;  1JY3 P;  4BRY A;  1BCC D;  5KAF E;  2HYN A;  4Y99 C;  1M1J C;  1HVV A;  3Q20 A;  5M1B A;  2M5A B;  3HUS C;  3L75 D;  4H2W C;  3KXD A;  1FOS F;  2R44 A;  3H4E A;  2JO1 A;  2JAZ A;  4PXH B;  3AED C;  3RL0 B;  1EDI A;  1NVO A;  5H2F H;  2K9J A;  2Y0D A;  2FYU D;  1MZ8 A;  2JR8 A;  1YJN P;  3KZI H;  1VKU A;  1LJ2 A;  2YMK A;  5KP8 B;  1OVR A;  2VSQ A;  3RL0 C;  4PD4 E;  5AW7 B;  3EJB A;  1DH3 A;  1VQL P;  2D2C B;  4BPG A;  4Z1M H;  2K9Y A;  1OVU A;  1NOH A;  2GZI A;  2YMY A;  2B88 A;  1JUN A;  2YKQ A;  2XV6 A;  2E76 D;  5CMZ A;  3L71 G;  2LXB A;  3CC2 P;  1SVF A;  1PEM A;  1YIT P;  1T6A A;  3JSV C;  1K8A Q;  3GHG B;  1CSB A;  5APQ A;  1DD3 A;  3FGA D;  4WY4 A;  1SP4 A;  1EZV I;  4AYC A;  3M06 A;  3GHG C;  2B87 A;  5H2F E;  5GTI H;  2G3A A;  2FHS C;  2ZYA A;  1G1J A;  2WSE H;  4H44 D;  2GDX A;  3N4X A;  3CC4 P;  3Q2Y A;  2E75 C;  1MUU A;  3LID A;  4NEO A;  5JPA A;  2L91 A;  3I55 P;  2AF8 A;  3B5N B;  1RF1 A;  1S4X A;  1ZXG A;  5AVT B;  1VHN A;  1DEE G;  1R5L A;  1KIL E;  1NTK D;  2KNC B;  5AVU B;  1AVO A;  2MR7 A;  2M5R A;  3M0A A;  3TF5 A;  2RKL A;  3V5B A;  3DS3 A;  3TGU G;  2A45 I;  2NPS B;  4B86 A;  1JMB A;  2ZT9 C;  5GTI E;  2FVE A;  3OW2 O;  1R8E A;  1X9V A;  1PGP A;  1MFZ A;  2IFN A;  2IBZ I;  1LT9 B;  3SWK A;  2LKM A;  4K35 A;  4OVN F;  3H32 B;  1S9K D;  3C9I A;  5B66 E;  2YXR B;  1W2B O;  1M1J A;  5AW1 B;  2QJY B;  5HGL A;  1ZRT E;  1JTH A;  1RHZ B;  1IC2 A;  2HOD A;  2SPZ A;  2KZJ A;  2XZ0 D;  1VQN P;  3EWK A;  4W7Z A;  1JY3 N;  4K3A A;  4W7Y A;  1H89 A;  2JJL A;  3A7O A;  3L35 A;  5TIS H;  2M5A A;  2IFM A;  4Y28 J;  1DV5 A;  2MKV A;  3HD7 D;  5AVQ B;  1GD2 E;  4ZMD A;  5KJ7 C;  3L71 E;  1SQX G;  3AE9 C;  5EFW B;  1J1D B;  3L73 D;  1RNI A;  1KC8 Q;  2WQY C;  2E76 B;  2L22 A;  2BCC G;  3H1J G;  5F2N A;  3M9Q A;  3HTK B;  2XZR A;  2R5D A;  3MP7 B;  1J1D C;  1MFT A;  5AW3 B;  2E76 C;  5CZD B;  1KZU B;  3DTJ A;  3L74 G;  3VMX A;  3DS0 A;  2R5B A;  1ZNV A;  1OWA A;  5HGN A;  2AXT H;  1M56 D;  3H1K G;  1QVG O;  2GA1 A;  1BDD A;  3HRN A;  3V4W A;  1FJP A;  1OFC X;  1RE4 C;  3IAO A;  4D6T G;  2KI7 B;  3RK3 B;  2AEM A;  1EOQ A;  7CEI A;  1ZLL A;  1PEO A;  2JU1 A;  5TIS E;  1PPJ D;  1PEQ A;  2K3R A;  4H44 C;  3VP9 A;  2WSF H;  1FE6 A;  4IPY A;  5AW9 B;  1N7L A;  4R4L A;  3M9H A;  3CCE P;  2KB7 P;  3RG6 C;  1Q86 Q;  1X0T A;  5HGO A;  1FU1 A;  5KLV G;  2MJZ A;  2VLP A;  2LIU A;  1N7S B;  5APS A;  1KQG B;  2LIW A;  1IJD B;  2P9X A;  2JKV A;  5APV A;  5AVR B;  2V4H A;  2E5T A;  3B4Q A;  3B5N A;  3KDP B;  1E5W A;  1BE3 D;  2AXT E;  3BCC J;  3A0H E;  3H25 A;  3CCM P;  2KNC A;  3VP8 A;  1BGY J;  2YIU B;  2I1K A;  4M3L A;  2O1J A;  1IMQ A;  3FXD A;  2Z5H A;  4TT3 H;  4HYT B;  2MR8 A;  1HY8 A;  1KFM A;  1ZMB A;  1MZ9 A;  2NPS A;  4XA4 A;  3AEB C;  1YI2 P;  1VQM P;  2GUV A;  1JNM A;  3VMA A;  1QLE D;  3RK2 D;  2P2U A;  1S1C X;  1RF0 C;  2FFD C;  2G8Y A;  2M3E A;  1OX3 A;  1SQQ G;  3H1H J;  4N3Y B;  2V7Q J;  1LT9 A;  2WSC J;  1P84 D;  3H1I J;  1SQX E;  2HPC B;  1SLQ A;  2H43 A;  3H1I D;  2BCC E;  3H1J E;  2Y9Z A;  3V2Q A;  1CI6 B;  3HD7 C;  5E79 H;  4PD4 I;  1NH4 A;  2KLV A;  2KYV A;  2OYI C;  2N9B A;  3TGU D;  5KJ7 A;  5I4T G;  1L0N G;  1W2E A;  3L74 E;  1VL2 A;  2W90 A;  2ZAE B;  3PJS K;  3HE4 B;  3H1K E;  4RJT A;  3V2N A;  3O8Z A;  1IO4 A;  3G1G A;  1LTT C;  1Z6M A;  2K37 A;  2FAD A;  4D6T E;  1KOR A;  3MUD A;  4GOF A;  2W8Z A;  5APU A;  3BAT A;  4WBA A;  1SQP G;  2QSI A;  3HTK A;  3UIA A;  1VQ7 P;  3LW5 J;  3G28 A;  3CCQ P;  2C9L Y;  4U3F J;  2FY8 A;  2MF4 A;  4WVZ A;  3CCS P;  1N2D C;  5CBN A;  2YXQ B;  1SQX K;  4BPF A;  2MY5 A;  2JP3 A;  3GLM A;  1DX7 A;  2P1J A;  4TLF A;  2OAR A;  2Z44 A;  1SQB E;  1WRG A;  1FBM A;  5E79 E;  5KLV E;  3W67 A;  3DS5 A;  2IYP A;  4BXL A;  1EDK A;  5BS2 A;  1T8Z A;  1EC5 A;  1NTZ J;  4EI2 A;  2BCC D;  3H1J D;  3RG2 A;  1K30 A;  3P8C E;  2N1T B;  1HGV A;  1HGZ A;  2ITA A;  1L0L D;  2OYH B;  2WPS A;  5KAI H;  1HQB A;  4ZKU A;  4R4M A;  4XFX A;  4I2L C;  4DG9 A;  2N1T C;  5AW2 B;  3GF3 A;  3H1K D;  1N7S A;  1AVY A;  2OTL P;  3EQ2 A;  3TYY A;  1ZW0 A;  4JQ0 D;  1L4A D;  5K5G B;  1ZP0 C;  3P05 A;  1SQQ E;  1L0H A;  4H13 D;  1LTI C;  1W5C E;  4JYC A;  5KLV K;  5KLI B;  1KV4 A;  2Z45 A;  3RK2 C;  1FZG A;  2A06 G;  1RF0 A;  3AE4 C;  1H0T B;  1EIA A;  2O01 J;  3KHU A;  2VLQ A;  3Q3D A;  1L0N E;  3H1L J;  2P67 A;  2PEN A;  2P7J A;  2N98 A;  1KQL A;  4OGQ D;  3L72 D;  5HGM A;  5KAI E;  1Q7Y Q;  1GL2 D;  3IF4 A;  3AEF C;  1WT6 A;  1OR5 A;  2OGU A;  4GIF A;  1A8O A;  1KQS O;  4PJ0 H;  5APT A;  1GK4 A;  3AEE C;  2FXM A;  2H8P D;  2GYK A;  3P8C D;  2HPC A;  5BVZ A;  3CWB J;  1VQ5 P;  3CC7 P;  4YPC A;  2JYL A;  1CI6 A;  1SQP E;  3PRJ A;  1FDM A;  5CJ4 A;  1SQQ K;  3L75 J;  1FOS E;  5CCG D;  1EDJ A;  1EDL A;  3BRV B;  3WUV A;  3DS4 A;  4DZO A;  2WMM A;  1CEI A;  5BU8 B;  5APX A;  3CXH H;  3CCR P;  2FYU J;  2PY8 A;  3NMD A;  1GPJ A;  3IFM A;  2IX7 C;  2M8N A;  1K05 A;  1FR2 A;  4IOI H;  1L0N K;  2WWW A;  4IL6 H;  2O3J A;  1P84 I;  2JGP A;  3RK3 E;  1H8A A;  2K94 A;  3TNU A;  1G1I A;  2FYN C;  1HH0 A;  3CX5 H;  4MN4 C;  4LLH A;  4PJ0 E;  2W27 A;  1YQ4 C;  2PNG A;  4OH8 B;  3CL3 D;  1HUC A;  4IL6 X;  1YBK A;  4H2Y C;  1PP9 D;  2GZJ A;  4L73 A;  1SQP K;  1Z56 A;  3CXC O;  2N9Y B;  1UIX A;  4UB8 H;  5DCK A;  2GZE A;  3RBX A;  2JBG A;  1JCC A;  4EDF A;  1S5L X;  2N6Z A;  1M8O B;  2K0Y A;  1PGO A;  2M8P A;  2KG8 A;  1SQP D;  2N1T A;  2N50 A;  2E75 B;  3HYB A;  4H13 B;  1L4A C;  3NXS A;  2OYH A;  4ASV A;  1X8Y A;  2A06 E;  1HF9 A;  1PGJ A;  3KZI E;  4COP A;  1MKM A;  2I1J A;  4IL6 E;  2W83 C;  3L70 G;  4H13 C;  3OAK A;  2KK7 A;  2CQ8 A;  1GMJ A;  3VN0 A;  1BGY G;  2QA4 P;  2LTE A;  4GR6 A;  3M9B A;  1N8R Q;  2PEI A;  1CW5 A;  2AFE A;  1NTK J;  3MTU E;  1E0H A;  5CCH C;  1M7L A;  2M8R A;  4OGQ B;  4PD4 D;  1GW4 A;  1GL2 B;  5C39 A;  1JEK A;  3AEG C;  5F2K A;  1SFC D;  1E6J P;  2DGY A;  1NU1 G;  4UB8 E;  3DPH A;  4OGQ C;  2ZT9 B;  2FQ1 A;  2FXO A;  1GL2 C;  3H1H G;  1NAF A;  1IFJ A;  2LF4 A;  1KB9 H;  1PGQ A;  2ZYD A;  2FVA A;  2XDJ A;  3D6Z A;  2Q3I A;  1EMV A;  4XFJ A;  2AEF A;  5AW0 B;  1N73 A;  2M0B A;  1HBW A;  1OW8 A;  2QJK B;  5HV8 A;  3EFG A;  4L75 A;  5APW A;  1KTM A;  1URQ D;  3AE3 C;  2E74 D;  4BWN A;  5CBO A;  1GW3 A;  2CPB A;  2QJK C;  2Q3E A;  1RY3 A;  3G29 A;  2XV5 A;  2NO8 A;  1IK7 A;  1YTZ I;  3HUS A;  3USS A;  2LKI A;  1DEB A;  2QM7 A;  2KUB A;  4WYM A;  4JYB A;  2QJP C;  4EOT A;  4A7P A;  3KYQ A;  1QVF O;  1YTZ T;  3Q1M A;  1AV1 A;  1SQV G;  2O1K A;  2QRX A;  2LXC B;  3A0B H;  3Q5P A;  3G0V A;  3L73 J;  4U0F A;  3L36 A;  1NTM G;  1VQ6 P;  3HE5 B;  3P7K A;  1UNK A;  3E7K A;  4U3F G;  2GDW A;  2FQ2 A;  2CK3 H;  2OQQ A;  1K9M Q;  3SFE C;  1KIL D;  1NO4 A;  2QIW A;  1QGK B;  4H0L D;  2PGD A;  4GKG A;  1S3J A;  2IZ1 A;  4IFF A;  1EXI A;  1IFM A;  3MHV A;  1D1D A;  2V7Q H;  1KQF B;  3E2D A;  2WSC H;  3VYI A;  3R4Y A;  3G9R A;  2FQ0 A;  2JO0 A;  2PEK A;  3TDK A;  1PZQ A;  3CE7 A;  1F80 D;  3BVH A;  3PHL A;  4U0E A;  1T3J A;  5AVZ B;  3FXE A;  1NTZ G;  3G71 P;  1LTG C;  3V6I A;  1RO0 A;  1GXG A;  1PEU A;  3L70 E; 
#chains in the Genus database with same CATH homology
 3P05 A;  2LF4 A;  1PEM A;  3CCE P;  1YIT P;  2OTJ P;  3RG6 C;  1W2B O;  1K8A Q;  1Q86 Q;  5HGO A;  2PEM A;  5HGL A;  2QEX P;  3VRL C;  1JJ2 O;  4QNB A;  2EIA A;  1S72 P;  3B5I A;  3DS1 A;  2Z45 A;  2CWO A;  3G6E P;  4M0I A;  3G1G A;  3CMA P;  4XRQ A;  3H47 A;  3CPW O;  1VQN P;  1BAJ A;  1VQO P;  1M6E X;  2XXM A;  1VQ9 P;  2P9X A;  1VQ4 P;  4U0D A;  4U0C A;  2BHV A;  2ONT A;  3LRY A;  1M90 Q;  1YJW P;  1A43 A;  4XRO A;  3CCV P;  1M74 A;  1EIA A;  3G21 A;  1VQ7 P;  1NJI Q;  4PH0 A;  2PEJ A;  3G28 A;  3CCQ P;  3CXC O;  3I56 P;  2JYG A;  1VQ8 P;  2L6E A;  3M1M A;  5DCK A;  3G29 A;  3CCM P;  3CCS P;  2EFJ A;  2PEN A;  1M6N A;  3CC4 P;  1RNI A;  2Z46 A;  4COC A;  3H0D A;  5HGM A;  2PEQ A;  1KC8 Q;  4U0B A;  4WYM A;  1Q7Y Q;  3WBH A;  5JPA A;  1YJ9 P;  1YIJ P;  2M8P A;  5F2N A;  3Q20 A;  3CCL P;  2KOD A;  1QVF O;  2OAR A;  3I55 P;  2Z44 A;  1A8O A;  3G26 A;  1KQS O;  3CME P;  4U0A A;  1ZMB A;  3HYB A;  3CCJ P;  1YI2 P;  1VQM P;  3DS5 A;  3MGE A;  3G0V A;  1K73 Q;  3H4E A;  1VQ5 P;  3G4S P;  3CC7 P;  5BS2 A;  2JYL A;  3DTJ A;  3G1I A;  3NTE A;  4U0F A;  4COP A;  4XFZ A;  3HZQ A;  1VQ6 P;  3DS0 A;  1RO2 A;  2EG5 A;  2XT1 A;  1YHQ P;  5HGN A;  1QRJ A;  1K9M Q;  5F2O A;  1K30 A;  5BS1 A;  2E1M A;  1YJN P;  2PEO A;  2BQ1 E;  3DS3 A;  2QA4 P;  1Q81 Q;  1QVG O;  2BUO A;  4GR6 A;  1N8R Q;  2PEI A;  3DS4 A;  1KD1 Q;  1M1K Q;  1D1D A;  1IUQ A;  3E2D A;  4GR2 A;  1VQK P;  1VQL P;  4XFX A;  1EOQ A;  3CCR P;  2JO0 A;  2PEK A;  1PEO A;  1AUM A;  2PY8 A;  4XFY A;  3OW2 O;  1PEQ A;  5F2K A;  4PH1 A;  2OTL P;  4U0E A;  1E6J P;  1VQP P;  2DGY A;  2M8N A;  5I4T G;  3CCU P;  3CD6 P;  2XV6 A;  3G71 P;  1RO0 A;  3DPH A;  3DS2 A;  1PEU A;  4IPY A;  2M8L A;  3CC2 P;  1Q82 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...