3CC2P

The refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution with rrna sequence for the 23s rrna and genome-derived sequences for r-proteins
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
total genus 48
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2008-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3cc2P03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 3cc2P01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 3cc2P02
1KQSO 1VQ5P 1YI2P 1VQ7P 3CC4P 3CC7P 1NJIQ 1QVGO 1S72P 1Q82Q 1YJ9P 1N8RQ 3CCUP 3CCQP 1VQLP 1VQKP 3I55P 3CCEP 3G4SP 3CCJP 1JJ2O 1QVFO 1YIJP 3G71P 3CMEP 1YJNP 3CCSP 2QEXP 1Q7YQ 1KC8Q 3CD6P 1VQ9P 1YJWP 1M90Q 1YHQP 1W2BO 1VQPP 1Q81Q 1KD1Q 2OTLP 1M1KQ 3CXCO 1VQNP 1K73Q 1K9MQ 3CCVP 3CPWO 1K8AQ 1VQ8P 3OW2O 2QA4P 3CCMP 3CC2P 1VQMP 3CCRP 3G6EP 1YITP 3I56P 3CCLP 3CMAP 1VQOP 1VQ6P 1VQ4P 1Q86Q 2OTJP
chains in the Genus database with same CATH superfamily
2KOSA 2ITAA 2L22A 1Q90D 2FY8A 2QG4A 2JWAA 5F2OA 1J1DB 3BCCJ 2OGUA 2B89A 1PFIA 3Q5SA 1LT9C 2MVUA 3CXHE 2O1JA 3SWFA 1J1EB 5CCHA 3MUDC 2JO0A 4UB6H 4XFZA 1PEUA 3CCSP 1U7JA 2Q3IA 2KGCA 1ZLLA 3LIDA 1YHQP 4I1LA 1M7LA 2FXOA 1KILD 3RK3D 2HYNA 1VQ8P 3HUSC 4PD4E 1JY3P 2H8PD 4XA4A 1HH0A 3R4YA 3MGNA 2ZYGA 4U3FJ 4WVZA 3RG6C 2JBGA 2CPBA 3CI9A 2QM8A 2EHTA 5L8RJ 2QEXP 3GF7A 3WU2H 4H13C 3SFEC 3CWBG 2N1TD 2FYZA 1H8AA 3G1IA 2QRXA 2IDBA 3Q5PA 3G4SP 3C8VA 1AVYA 4BRYB 2N5HA 3HD7C 1NAFA 4ZNCA 2KK7A 3RL0C 3GJNA 1YQ3C 1RF1C 2W83C 3ZDMA 1J1EC 2P9XA 3EJEA 1ZP0C 3K5BA 1RE3A 5DJUB 3CMAP 5TJHA 1SQBG 1M74A 1SQVD 1R8EA 3G28A 2K3RA 4BWNA 2LIUA 5F2NA 1S2EA 2LMLA 2E42A 3D70A 3O8ZA 3CC2P 3JCUH 2FQ1A 3CL3D 1L0LE 1OX3A 4MRTC 1K05A 1NTMJ 3B5NC 3HE5B 2HG5D 3S4RA 2Q5UA 2PRRA 5EJDA 5CCGC 4Z1MH 1SQQD 1T8ZA 1H88A 3GKLC 2FVFA 2N6YA 1M1KQ 1SQBE 1PPJG 1L4AA 5KAFE 3L71D 2QNWA 4PD4H 4U0AA 2M8NA 3QWOC 1EZVD 2DW3A 4BRYA 2KOGA 3WUVA 1NU1G 3CCJP 3H32A 2O01N 2YIUC 2RKLA 2HFED 2N98A 4IOIH 3VN0A 1JUNA 2YKOA 2HLOA 2WSFJ 3TK1A 1VL2A 1PGOA 3V2PA 4NEOA 2KB7P 2WSEJ 3S1KA 3SWKA 5CZDB 5EFWB 2KLUA 3HUSB 5KAIE 3L71J 3D6YA 3PH0A 1KB9I 3AE7C 1BAJA 4H2XC 1CZQA 1BSNA 3JC22 3L36A 2L6EA 4UB8H 1NWQA 3BASA 3AEGC 1VQ7P 2OYIB 5KLVD 2QE7H 1BDCA 3JSVC 3LIEA 1L0LJ 2ZAEB 2GYKA 3CXHI 1IFNA 1SFCD 3TSIA 1BXIA 3DPHA 1KILA 1OWAA 3U59A 1EIAA 3HE4A 1KILE 1U57A 2JWDA 3RK3E 1OVRA 1VQ6P 1HWTC 3NTNA 2MVVA 4LGDE 3H1LD 3V2RA 2K5XA 2GZIA 3A3YB 2I1JA 2AF8A 2XKMA 1KV4A 1IFIA 1KYOI 2BCCD 1OVUA 1LNQA 1FZBA 1GK4A 1RY3A 2PAJA 1NAYA 3V4WA 1N7SB 3H1IG 1DH3A 2A45I 1PP9G 2K93A 2P67A 1IZNB 2P10A 2WSCJ 3DS0A 2HPCB 2CWOA 5APVA 1SQQE 3II6A 2JB0A 2YMKA 1KLPA 4IPYA 1EDLA 1NTMD 1OMIA 3GLMA 1RE4C 3H1JG 2VRSA 2XNXA 2KWLA 3BATA 2PY8A 3M9HA 4N78E 2E43A 2OTJP 2QJPB 4GIFA 5BU8B 3TGUG 3EQ2A 2K92A 2M8PA 2Q9IA 2GDWA 4L74A 2KNCA 1M6EX 4COPA 1GU5A 1NH4A 1RF0A 3HE4B 2CPSA 1FZFA 3B5NB 3FWNA 3H1ID 5EW5E 2B88A 1SS1A 3CWBD 1BGYD 4NPDA 3AEBC 2A06D 2M5AB 4AUWA 1M8OB 1FC2C 3V2NA 1Y47A 1IFMA 1VQNP 5KP7B 5CCGA 1QEXA 2FFDA 3T97A 3CXHH 3M0DC 2PEIA 2Z5HA 4TLFA 3PRJA 2QJYC 2NRGA 3WBHA 3WUTA 5HV8A 3GHGB 3PHLA 2KODA 1S5LH 2BHVA 3RBXA 5KLVK 4COCA 1PPJE 3P8CD 3BCCD 2LKMA 4IL6E 3SFDC 2FVEA 1NTKG 3HD7D 4OGQD 2X2BA 3CCMP 4H0LC 3ABVC 4N6JA 3CCRP 1AQ5A 2OYHA 2ZT9D 3U1CA 2QJKC 5KP8B 1HJ0A 2E5YA 1L4AC 1LT9A 2K9JA 1SVFA 2AXCA 2L4BA 1KD1Q 4D6TJ 2AFDA 1GL2A 1E6JP 1OW6A 1L2PA 1CW5A 1GZLA 2E1MA 3B8EB 1HQBA 3CXHD 3L35A 1OVVA 2VSQA 3EWKA 1LTGC 1CI6B 2WPRA 2ERHA 3Q1MA 3I5CA 1EDKA 2I1KA 4AYCA 2QJPC 2KG9A 2CG5B 2FFDB 1KQLA 2O3JA 2Z44A 4L76A 3VRLC 3L70G 2V7QH 1EDJA 3AE4C 1YTZI 2WPQA 1Q2NA 2KS1B 1L0NG 4I7ZC 2GZGA 2H43A 3M06A 4JYBA 1NO4A 3P7KA 1ZRTE 2OQQA 2D2CC 3BCCG 1GW4A 1H0TA 1DV5A 2IFNA 4D6TG 2N1TA 2R32A 2OYIA 2W8ZA 2D2CD 1T2KD 3N7NA 1DNYA 1AA0A 3B5NA 1SQVK 1PEOA 3U1AA 2WQYC 2WTYA 1RF0C 2EHSA 3Q3DA 1OZHA 3AEAC 1JO5A 2XV6A 1BGYG 1BE3E 3O6QB 3M1MA 5CCGD 5AVTB 2WT7A 3B4QA 3CCQP 1NHLA 1JCCA 5JPAA 3HRNA 2R5BA 2FFDC 3KDPB 2WSCH 1X79B 2NPSC 3JCUE 2FADA 3L72E 4YTPC 5B66H 3HYBA 2QVAA 1L4AD 4IL6X 1MUUA 3B5IA 1R5LA 5AVZB 1AYIA 1GXHA 2ZT9C 3RK2B 2IYOA 2SPZA 1M1JA 2R44A 1BE3G 3KXDA 4W80A 4QMAA 2K0DX 2XNDH 5APSA 1LWUA 3W68A 1BCCG 2KORA 2V4HA 1M56D 3H1KG 4DOJA 2QJKB 2XT1A 2YO3A 3A0BH 3M0DA 1IC2A 2KSEA 3A5TA 2GZJA 3EJBA 1KB9D 4RJTA 1SQPE 4EYYQ 2QJYB 1JEKA 2RH0A 2LIWA 5APXA 3CE7A 5DCKA 4YXWH 3H25A 1GD2E 2B87B 1SLQA 3RG2A 5AVWB 1KQSO 3MTUE 5KLVJ 1S72P 1IMQA 5AVSB 2RMZA 3TNUB 2C9NY 3VTPC 1IMPA 2FBWC 4U3FD 3HTKA 1M90Q 2MD9A 3L72D 3H32B 3L70E 1BCCE 1N7SD 4R4LA 2JO1A 1VF5C 2J5UA 4EI2A 2OARA 3CX5E 4DJGA 5AW1B 2WSEH 3B5ND 3HZQA 1PP9E 4N3YB 4PD4D 4H44C 1S3JA 1NGMB 1NVOA 2E75C 4WBAA 4HJGH 1G2CB 1LTTC 3AE3C 2AXTE 1FS0E 4DT0A 3AE2C 2K88A 4ZMDA 1QGKB 3M0AA 3CXCO 1L0HA 5HGNA 2PFXA 2WWWA 5KTBA 5B5EE 3HD7B 2Q3EA 1FZAA 3CC7P 1KB9E 1LT9B 2C9LY 4K35A 3WMM0 1SQQJ 3LW5J 4XFXA 1J2JB 3V2QA 5CJ0A 1NTMK 1NU1J 3VMAA 3H47A 1SQPJ 4Y99C 2GUSA 1KZUB 4PXHB 1BDDA 1JTHB 3BCCE 5E79H 1N7SC 3F5HA 3LW5H 1RE3C 1GL2C 1D1DA 1W2BO 3AEEC 2W6BA 2YIUB 2Y9ZA 3L72G 3WUUA 1VQ4P 4JQ0D 1RO2A 1S9KE 3CCUP 3H1IE 3M9QA 3L73J 2P2UA 1A43A 1VQPP 3BRTB 1M57D 1SQVG 5AVVB 1N73A 4OVNF 2E74D 5BU5A 2BASA 3E1IA 5H2FE 3L37A 2YXRB 2O1KA 5KP6B 5KLVE 2YMYA 3NY7B 4H44B 2KOOA 4XFJA 3D71A 3CX5D 2KGAA 3V6IA 1VQOP 2EIAA 3IR9A 3P05A 3GZMA 1MZ9A 1A8OA 3SWYA 5GTIH 3H1LJ 2KUBA 3L74G 4NPFX 2JJLA 1JM0A 2PEOA 1SQBJ 1KC8Q 1W5CE 1VQ9P 1NTZD 2M5RA 2KS1A 1FU1A 2PENA 5GTHH 2KI7B 7CEIA 3CCLP 1N86A 4R0MA 1QVGO 1FZCC 1FJKA 1ZRTD 3GG2A 1LP1A 1PGQA 3CWBJ 3L4FA 3N4XA 2WPSA 2PGDA 4WYMA 4IFFA 1G1JA 2M8LA 2IZ1A 2UWJE 3OA7A 1PGJA 1QX8A 1NQ4A 2WVRA 2E75B 1MKMA 1X22A 2ZJSE 4PJ0H 2GA1A 2W90A 4GKGA 1LTSC 2B87A 1VF5D 3A2AA 1QRJA 2J58A 1EDIA 2K1AA 5I4TG 2Q1KA 1ZR4A 2Z45A 2MR7A 1SQPK 2A45H 5APWA 1P84D 4BPHA 3DS4A 1LTIC 2FXMA 3G71P 4RKUJ 1NTKE 3LMOA 1IUQA 2Z4EA 3L73D 2MY5A 1JMMA 2L91A 1UIXA 4U0EA 3L71E 5AVRB 4UHPB 2CQ8A 1LP1B 1EZVI 2IBZE 2XV5A 2FYUE 1LT1A 3H1HG 1BGYE 4BPFA 2Z5IA 1SQPG 2JDIH 1N73C 2IFMA 1VKUA 2KGEA 2OTKE 3HD7A 3B4SA 2WPTA 3OJAB 3EJDA 2Y9YA 3L72J 2W6AA 3IF4A 4HH2A 5TISE 2YNYA 2BCCE 1KQGB 4QKOA 1KYOD 3F89A 2Y0DA 3VMZA 1RE4A 3H1LE 1MZ8A 2OYOA 1VDFA 1NU1D 4K3AA 3OW2O 2YKQA 5CJ4A 1BE3J 3A0HH 4GT1A 4AQRD 1K04A 1KTMA 3GW6A 2KP8A 3Q2YA 1VHNA 5K5GB 2FVAA 1SQVE 1SQQG 3MGEA 2MJZA 5F2KA 4U7JA 1FE6A 1R5SA 1G1IA 2YKPA 3NTEA 1ZR2A 4PH0A 2P1JA 3E2DA 1HUCA 1PP9D 1T3UA 1KMIZ 1ACPA 4O9BA 1T8KA 1YYCA 3M91A 2AFEA 2W6JH 1OIPA 4U3FG 2KZIA 4GR6A 3FX0A 3GHGA 1N73B 1OW7A 1FJPA 4WB4A 3H1JE 4C7NA 1WMKA 1Y9BA 5HGMA 3B71A 1IK7A 2KZJA 2Y0EA 3V5BA 2EFJA 2I8DA 4IFDK 2QIWA 4M0IA 3G9RA 2IBZD 2YO2A 3VP8A 2N5IA 4PV1B 2GZFA 5CHXA 3R2PA 1JMBA 1GDTA 2AVAA 1YJNP 4YXDC 3W67A 1D7MA 3EFFK 1NKNA 1K9MQ 3LRYA 4RO0A 2Y0CA 3RL0D 1PP9J 1DIPA 4DCKA 3V4QA 2N50A 1PV3A 4ASWA 1E79H 5DJTB 2XZ1C 1RNIA 4ZKPA 1KYOE 2JYGA 1USDA 1U7MA 3OAKA 3Q20A 3L70J 2R5DA 1FZCA 4IFMA 1NU1E 2O01H 4OWFA 2WITA 2NZ2A 1SQXG 2FXPA 2KG6A 2E76D 5CBNA 3TDKA 1MFZA 2IYPA 2FYUK 4HKGA 2LL8A 1JNMA 3KHUA 2Z46A 1SQBD 4WY4D 1N7SA 2N1TB 5AW2B 3P32A 4DG9A 1VQKP 1ZOYC 1N7LA 1NTZK 2HODB 1GK6A 1L0LK 1TU3F 5BS1A 5AW6B 3KZIE 2N6ZA 3A0HE 3FXDA 2GM4A 1F80D 4OGQC 1HBWA 1FDIA 4JF7A 4LC1A 1VQMP 5AVUB 4XRQA 2QM7A 3ITKA 1X9VA 1FDMA 2FYUG 4U0FA 3O6QA 5CCHC 3KZIH 1P84I 2W27A 2N9BA 5TISH 2NPSA 4CA3A 3IN6A 1JTHA 2FACA 2AEJA 1YBKA 1EMVA 1ZN5A 3G29A 1HVVA 4WY4B 3H6PA 3L75J 4GDOA 2ZVOB 3CC4P 3H4EA 1JJ2O 1JOCA 1DEEG 2OYIC 2KGDA 1L0IA 1T6AA 1A02J 1EC5A 1MFTA 3IFMA 2KG8A 4WY4C 2FAEA 1NTMG 1L0NJ 1PGPA 1RH5B 4YPCA 2KNCB 3S9OA 3RK2D 4PD4I 1NOHA 1AV1A 3KYQA 3H0DA 1PIXA 3BRVB 2GUVA 1SQXE 3HUSA 1L4AB 3A0BE 5AW9B 2E76C 5KLIC 1WT6A 1FOSF 4RESB 2IBZI 2WMMA 3I56P 2LF4A 2KR5A 2RN0A 2E75D 2ZFCA 2OYHC 1A02F 2C0WA 1EQ7A 1IJDB 1L0ND 2E74B 2N1TC 3MP7B 4XROA 2OTLP 2G8YA 2BQ1E 1GXGA 1KILB 3RK3B 4Y28J 4A7PA 3L75D 4I7ZB 2JQ4A 2LXCB 2NO8A 3NXSA 1QLED 5KKZC 4TT3H 4XE5B 1N8RQ 2JU2A 5KJ7A 1GW3A 3G21A 1RF1A 2VLQA 4C7RA 1URQC 1BCCJ 1X0TA 2EG5A 3G26A 1L0LD 1P84E 1G2CA 3CWBE 1GMJA 1HY8A 3H1KD 4EDFA 1P84H 3CCEP 2K9YA 3H1KE 1J1DC 1QL2A 3KPEA 1DEBA 5CMZA 1Z6MA 2HODA 1N2DC 2XDJA 5C39A 2N9YB 2WPVB 1ZNVA 4ZKUA 2K9JB 2IZ0A 2DGYA 4GOEA 3L75G 1OFCX 1JY2P 2FYNB 4D6TD 1EZVE 5AW0B 3DTJA 2KOPA 3E7KA 5CBOA 1KFMA 3VMXA 2VLPA 1MV8A 5AW3B 3U43A 3RL0B 2IPPA 4C46A 2ZVNB 2PEJA 4QNBA 1NTME 3L74E 2FYUJ 3G3ZA 2K0XA 1PEQA 3DS2A 4WY4A 2A45G 3SSUA 1JY3N 5APQA 3CX5I 3TGUJ 2BCCG 1XTCC 4I2LC 2HPCA 5KLIB 2FYNC 2M3BA 3RK2C 1SQXD 2AEFA 1GU4A 4JYCA 4C7NB 2L0QA 1H0TB 2ONTA 5AVYB 1LTBC 2JYLA 2E5TA 3P8MC 1IFJA 4H44D 2CNRA 2JGPA 1SP4A 1NTZE 3AEDC 1URQB 3H1IJ 3T97B 1YJ9P 1JY2O 3L70D 1S1CX 5E79E 3TGUD 3FGAD 3CD6P 1Q81Q 1AQTA 1S5LX 3RGUA 1L0NK 2H88C 1DD4A 2PEQA 1LWUC 3L71G 4PH1A 1PPJD 3H1JD 3P8CE 5AW7B 3GZLA 4IL6H 2FYUD 4JPZB 3MD0A 2E74C 1KB9H 3VOPA 1RO0A 2GDXA 1GPJA 3H1HE 3A7OA 5APYA 1ZMBA 2KLVA 2KIKA 4H13B 1VPCA 1IO4A 5AW5B 2XZRA 2R3CA 4I6MC 2K2QA 3NFQA 4EOTA 2KOQA 3RBZA 3AECC 2FQ0A 3TNUA 2LXBA 1AUMA 1LWUB 4MN4C 3PTZA 2K0YA 3H1JJ 3G1GA 1ZXGA 1DD3A 3CX5H 2WSFH 3CLQA 1LJ2A 1NTKD 5GTHE 2VLNA 4ASVA 3M9BA 1X3OA 3MIWA 1YQ4C 2NPSD 5KLVG 2KW2A 4PWVB 5GTIE 3L74J 4H0LD 1KILC 3RK3C 1PZQA 1WRGA 2L9FA 1BE3D 1KYOH 1AFOA 3TGUE 2FKWB 1SQBK 1FZEA 1VF5B 1NTZG 2JKVA 2MR8A 1EOQA 3DS3A 4W7ZA 2R3SA 5KJ7D 5APUA 2CK3H 2PP6A 2ZYDA 3RL0g 2BUOA 1AJYA 1XTGB 2Q7CA 2PEKA 2K37A 1T2KC 3USSA 1IFDA 1USEA 4U3FE 2WT7B 1BSHA 1EZVG 4L73A 3L73G 2M3EA 5B66E 2IBZG 1LTJB 2ZYAA 2B9BA 1FBMA 4NPEA 1OW8A 4KHXA 3AE9C 2PEMA 5M1BA 2GDYA 1ZV8A 1URQD 4GOFA 4PV1D 1PL5A 1W2EA 3GF3A 5AVQB 2ROQA 1AF8A 3HE5A 4U0DA 4BXLA 1BCCD 1OXZA 1M6NA 4L75A 3AE1C 2XXMA 2KYVA 4H2WC 1GL2D 3E1RA 4LLHA 5KAIH 1YJWP 1FAVA 2GZEA 3VYIA 1PEMA 3D6ZA 1KN7A 2NPSB 3CCVP 5HVCA 2QA4P 4OGQB 3AE6C 4EIJA 5B5EH 5BVZA 2M5AA 2LTEA 3FWLA 3NMDA 1JB0J 1L0LG 1RF1B 1FR2A 1SQVJ 2AXTH 1SQXJ 4H2YC 1Q7YQ 1LTJA 3C9IA 3CPWO 3UIAA 1E5WA 1URQA 1E0HA 1K30A 3G6EP 1NYHA 4HKZH 2BCCJ 5KAFH 1L0NE 3FXEA 1YTZT 1SQQK 3GMAA 3TYYA 1GTWA 2XU6A 3AE8C 2O01J 2D2CB 1FZGA 2H7HA 1OR5A 2VLOA 4N78D 2A06E 1Y8AA 3DS1A 3MHVA 4D6TE 2LOLA 3L73E 2CGQA 1Q86Q 2JP3A 2J59M 1CSBA 2BEZF 4W7YA 3VMYA 1VQLP 2JAZA 2L5GB 3IAOA 3HTKB 3CMEP 4KJMA 1SFCA 1LGHB 5KKZB 1KFNA 1RHZB 4F37A 4KT0J 1M1JC 1S9KD 3TF5A 2KXPB 4M3LA 4GR2A 1IFPA 1CI6A 3H1KJ 2MKVA 5AW4B 2LPKA 1VQ5P 4PJ0E 1FZCB 5BS2A 2P58A 3AEFC 2POHA 1S5LE 3PJSK 1X8YA 1T3JA 2A06G 3KQGA 5APTA 2Q6QA 1QL1A 3Q5RA 1ZW0A 5CCHD 2FHSC 1YITP 2KSJA 3MUDA 5HGOA 4U0CA 3I55P 1IK9A 2V7QJ 1SQPD 3WU2E 1YIJP 4H13D 1JY2N 4HB1A 4R4MA 4CPGA 1SQXK 4OH8B 1EXIA 3EFGA 1SFCC 2HR3A 1K8AQ 1K73Q 5AW8B 2MF4A 2K94A 1FOSE 4XFYA 4B86A 2QSIA 2JR8A 1KQFB 1FDOA 1NTZJ 3VP9A 1JCDA 5AVXB 1CEIA 3BVHA 1HJBA 1LTAC 4JBZA 2ZXEB 4UB6E 2WZ7A 1DX7A 1AVOA 1UNKA 1NTKK 2IX7C 1S4XA 4HYTB 3AE5C 1Z56A 1NJIQ 1HGZA 3QH9A 1EXJA 5H2FH 4IZ6A 2FQ2A 1H89A 1KORA 3H1LG 3L75E 1JY3O 1NKZB 3PLNA 3MZWB 1NU1K 1RQUA 2BEQD 2P7JA 4BPGA 1YI2P 2C0XA 4H0LB 1M1JB 2JU1A 2LR2A 3PP5A 4Y99B 2LKIA 3H1HJ 2M8RA 1HF9A 1RQVA 4WWIA 3G0VA 2JEEA 3C1LA 2OYHB 2AEMA 2DNWA 3GHGC 2PNGA 2M0BA 1LTJC 4PV1C 1NTKJ 1BGYJ 2YXQB 1UIIA 1Q82Q 1HGVA 2XZ0D 3DS5A 4GODA 1SFCB 2E76B 2ZXXA 1QVFO 4DZOA 1GL2B 2G3AA 5HGLA 1UJZA 3L74D 2H89C 4UB8E 2WSSH 4U0BA 2ZT9B 1HTLC 1ZMEC 5KJ7C 3H1HD
chains in the Genus database with same CATH topology
1VQ7P 3CC4P 1M74A 2PEQA 1QVGO 2XT1A 4PH1A 3H4EA 1JJ2O 1RNIA 3G28A 5F2OA 2DGYA 3DPHA 1RO0A 1D1DA 2JYGA 1W2BO 5F2NA 1VQNP 1EIAA 3Q20A 3OW2O 3CC2P 4WYMA 3DS1A 5DCKA 3DTJA 1VQ6P 2M8LA 1ZMBA 1VQ4P 1Q86Q 2PEIA 1KQSO 1NJIQ 3WBHA 1RO2A 1S72P 2JO0A 1VQLP 3CCUP 2PEJA 4QNBA 2KODA 4XFZA 3H0DA 2BHVA 2PEMA 4COCA 3CMEP 1PEUA 3CCSP 3MGEA 1PEOA 5F2KA 1PEQA 3DS2A 1A43A 1M90Q 1YHQP 1VQPP 1AUMA 3NTEA 1M1KQ 4PH0A 1VQ8P 3E2DA 3G1GA 3CCMP 1QRJA 2OARA 2XV6A 4GR2A 4U0DA 3CCRP 2Z46A 3I56P 3M1MA 2LF4A 3HZQA 5I4TG 2M8NA 2Z45A 1VQ5P 1YI2P 1M6NA 3RG6C 5BS2A 2XXMA 3CCQP 3DS4A 1VQKP 3DS0A 3CCJP 2CWOA 3G71P 5JPAA 4GR6A 2QEXP 4IPYA 2ONTA 1YJWP 5BS1A 4XROA 1PEMA 1KD1Q 2JYLA 2OTLP 3CXCO 3G0VA 1IUQA 3CCVP 2BQ1E 1E6JP 2QA4P 2E1MA 5HGMA 1VQMP 5HGNA 1YITP 2PY8A 4XRQA 1VQOP 2EIAA 2EFJA 3HYBA 2OTJP 3P05A 4U0EA 5HGOA 4M0IA 3CC7P 2M8PA 4U0CA 4U0FA 1Q82Q 1YJ9P 1N8RQ 3G1IA 3DS5A 3I55P 3B5IA 3G4SP 1A8OA 1M6EX 4COPA 1QVFO 1YIJP 1EOQA 3G21A 3DS3A 1YJNP 5HGLA 2PEOA 1Q7YQ 1KC8Q 3CD6P 2EG5A 1VQ9P 4XFXA 2Z44A 3G26A 3VRLC 1BAJA 1Q81Q 1K73Q 1K9MQ 4U0BA 3CPWO 1K8AQ 3LRYA 3G29A 2PENA 2BUOA 2P9XA 3H47A 4XFYA 1K30A 3G6EP 3CCLP 2PEKA 3CMAP 2L6EA 3CCEP 4U0AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KQS O;  1VQ5 P;  1YI2 P;  1VQ7 P;  3CC4 P;  3CC7 P;  1NJI Q;  1QVG O;  1S72 P;  1Q82 Q;  1YJ9 P;  1N8R Q;  3CCU P;  3CCQ P;  1VQL P;  1VQK P;  3I55 P;  3CCE P;  3G4S P;  3CCJ P;  1JJ2 O;  1QVF O;  1YIJ P;  3G71 P;  3CME P;  1YJN P;  3CCS P;  2QEX P;  1Q7Y Q;  1KC8 Q;  3CD6 P;  1VQ9 P;  1YJW P;  1M90 Q;  1YHQ P;  1W2B O;  1VQP P;  1Q81 Q;  1KD1 Q;  2OTL P;  1M1K Q;  3CXC O;  1VQN P;  1K73 Q;  1K9M Q;  3CCV P;  3CPW O;  1K8A Q;  1VQ8 P;  3OW2 O;  2QA4 P;  3CCM P;  3CC2 P;  1VQM P;  3CCR P;  3G6E P;  1YIT P;  3I56 P;  3CCL P;  3CMA P;  1VQO P;  1VQ6 P;  1VQ4 P;  1Q86 Q;  2OTJ P; 
#chains in the Genus database with same CATH topology
 2KOS A;  2ITA A;  2L22 A;  1Q90 D;  2FY8 A;  2QG4 A;  2JWA A;  5F2O A;  1J1D B;  3BCC J;  2OGU A;  2B89 A;  1PFI A;  3Q5S A;  1LT9 C;  2MVU A;  3CXH E;  2O1J A;  3SWF A;  1J1E B;  5CCH A;  3MUD C;  2JO0 A;  4UB6 H;  4XFZ A;  1PEU A;  3CCS P;  1U7J A;  2Q3I A;  2KGC A;  1ZLL A;  3LID A;  1YHQ P;  4I1L A;  1M7L A;  2FXO A;  1KIL D;  3RK3 D;  2HYN A;  1VQ8 P;  3HUS C;  4PD4 E;  1JY3 P;  2H8P D;  4XA4 A;  1HH0 A;  3R4Y A;  3MGN A;  2ZYG A;  4U3F J;  4WVZ A;  3RG6 C;  2JBG A;  2CPB A;  3CI9 A;  2QM8 A;  2EHT A;  5L8R J;  2QEX P;  3GF7 A;  3WU2 H;  4H13 C;  3SFE C;  3CWB G;  2N1T D;  2FYZ A;  1H8A A;  3G1I A;  2QRX A;  2IDB A;  3Q5P A;  3G4S P;  3C8V A;  1AVY A;  4BRY B;  2N5H A;  3HD7 C;  1NAF A;  4ZNC A;  2KK7 A;  3RL0 C;  3GJN A;  1YQ3 C;  1RF1 C;  2W83 C;  3ZDM A;  1J1E C;  2P9X A;  3EJE A;  1ZP0 C;  3K5B A;  1RE3 A;  5DJU B;  3CMA P;  5TJH A;  1SQB G;  1M74 A;  1SQV D;  1R8E A;  3G28 A;  2K3R A;  4BWN A;  2LIU A;  5F2N A;  1S2E A;  2LML A;  2E42 A;  3D70 A;  3O8Z A;  3CC2 P;  3JCU H;  2FQ1 A;  3CL3 D;  1L0L E;  1OX3 A;  4MRT C;  1K05 A;  1NTM J;  3B5N C;  3HE5 B;  2HG5 D;  3S4R A;  2Q5U A;  2PRR A;  5EJD A;  5CCG C;  4Z1M H;  1SQQ D;  1T8Z A;  1H88 A;  3GKL C;  2FVF A;  2N6Y A;  1M1K Q;  1SQB E;  1PPJ G;  1L4A A;  5KAF E;  3L71 D;  2QNW A;  4PD4 H;  4U0A A;  2M8N A;  3QWO C;  1EZV D;  2DW3 A;  4BRY A;  2KOG A;  3WUV A;  1NU1 G;  3CCJ P;  3H32 A;  2O01 N;  2YIU C;  2RKL A;  2HFE D;  2N98 A;  4IOI H;  3VN0 A;  1JUN A;  2YKO A;  2HLO A;  2WSF J;  3TK1 A;  1VL2 A;  1PGO A;  3V2P A;  4NEO A;  2KB7 P;  2WSE J;  3S1K A;  3SWK A;  5CZD B;  5EFW B;  2KLU A;  3HUS B;  5KAI E;  3L71 J;  3D6Y A;  3PH0 A;  1KB9 I;  3AE7 C;  1BAJ A;  4H2X C;  1CZQ A;  1BSN A;  3JC2 2;  3L36 A;  2L6E A;  4UB8 H;  1NWQ A;  3BAS A;  3AEG C;  1VQ7 P;  2OYI B;  5KLV D;  2QE7 H;  1BDC A;  3JSV C;  3LIE A;  1L0L J;  2ZAE B;  2GYK A;  3CXH I;  1IFN A;  1SFC D;  3TSI A;  1BXI A;  3DPH A;  1KIL A;  1OWA A;  3U59 A;  1EIA A;  3HE4 A;  1KIL E;  1U57 A;  2JWD A;  3RK3 E;  1OVR A;  1VQ6 P;  1HWT C;  3NTN A;  2MVV A;  4LGD E;  3H1L D;  3V2R A;  2K5X A;  2GZI A;  3A3Y B;  2I1J A;  2AF8 A;  2XKM A;  1KV4 A;  1IFI A;  1KYO I;  2BCC D;  1OVU A;  1LNQ A;  1FZB A;  1GK4 A;  1RY3 A;  2PAJ A;  1NAY A;  3V4W A;  1N7S B;  3H1I G;  1DH3 A;  2A45 I;  1PP9 G;  2K93 A;  2P67 A;  1IZN B;  2P10 A;  2WSC J;  3DS0 A;  2HPC B;  2CWO A;  5APV A;  1SQQ E;  3II6 A;  2JB0 A;  2YMK A;  1KLP A;  4IPY A;  1EDL A;  1NTM D;  1OMI A;  3GLM A;  1RE4 C;  3H1J G;  2VRS A;  2XNX A;  2KWL A;  3BAT A;  2PY8 A;  3M9H A;  4N78 E;  2E43 A;  2OTJ P;  2QJP B;  4GIF A;  5BU8 B;  3TGU G;  3EQ2 A;  2K92 A;  2M8P A;  2Q9I A;  2GDW A;  4L74 A;  2KNC A;  1M6E X;  4COP A;  1GU5 A;  1NH4 A;  1RF0 A;  3HE4 B;  2CPS A;  1FZF A;  3B5N B;  3FWN A;  3H1I D;  5EW5 E;  2B88 A;  1SS1 A;  3CWB D;  1BGY D;  4NPD A;  3AEB C;  2A06 D;  2M5A B;  4AUW A;  1M8O B;  1FC2 C;  3V2N A;  1Y47 A;  1IFM A;  1VQN P;  5KP7 B;  5CCG A;  1QEX A;  2FFD A;  3T97 A;  3CXH H;  3M0D C;  2PEI A;  2Z5H A;  4TLF A;  3PRJ A;  2QJY C;  2NRG A;  3WBH A;  3WUT A;  5HV8 A;  3GHG B;  3PHL A;  2KOD A;  1S5L H;  2BHV A;  3RBX A;  5KLV K;  4COC A;  1PPJ E;  3P8C D;  3BCC D;  2LKM A;  4IL6 E;  3SFD C;  2FVE A;  1NTK G;  3HD7 D;  4OGQ D;  2X2B A;  3CCM P;  4H0L C;  3ABV C;  4N6J A;  3CCR P;  1AQ5 A;  2OYH A;  2ZT9 D;  3U1C A;  2QJK C;  5KP8 B;  1HJ0 A;  2E5Y A;  1L4A C;  1LT9 A;  2K9J A;  1SVF A;  2AXC A;  2L4B A;  1KD1 Q;  4D6T J;  2AFD A;  1GL2 A;  1E6J P;  1OW6 A;  1L2P A;  1CW5 A;  1GZL A;  2E1M A;  3B8E B;  1HQB A;  3CXH D;  3L35 A;  1OVV A;  2VSQ A;  3EWK A;  1LTG C;  1CI6 B;  2WPR A;  2ERH A;  3Q1M A;  3I5C A;  1EDK A;  2I1K A;  4AYC A;  2QJP C;  2KG9 A;  2CG5 B;  2FFD B;  1KQL A;  2O3J A;  2Z44 A;  4L76 A;  3VRL C;  3L70 G;  2V7Q H;  1EDJ A;  3AE4 C;  1YTZ I;  2WPQ A;  1Q2N A;  2KS1 B;  1L0N G;  4I7Z C;  2GZG A;  2H43 A;  3M06 A;  4JYB A;  1NO4 A;  3P7K A;  1ZRT E;  2OQQ A;  2D2C C;  3BCC G;  1GW4 A;  1H0T A;  1DV5 A;  2IFN A;  4D6T G;  2N1T A;  2R32 A;  2OYI A;  2W8Z A;  2D2C D;  1T2K D;  3N7N A;  1DNY A;  1AA0 A;  3B5N A;  1SQV K;  1PEO A;  3U1A A;  2WQY C;  2WTY A;  1RF0 C;  2EHS A;  3Q3D A;  1OZH A;  3AEA C;  1JO5 A;  2XV6 A;  1BGY G;  1BE3 E;  3O6Q B;  3M1M A;  5CCG D;  5AVT B;  2WT7 A;  3B4Q A;  3CCQ P;  1NHL A;  1JCC A;  5JPA A;  3HRN A;  2R5B A;  2FFD C;  3KDP B;  2WSC H;  1X79 B;  2NPS C;  3JCU E;  2FAD A;  3L72 E;  4YTP C;  5B66 H;  3HYB A;  2QVA A;  1L4A D;  4IL6 X;  1MUU A;  3B5I A;  1R5L A;  5AVZ B;  1AYI A;  1GXH A;  2ZT9 C;  3RK2 B;  2IYO A;  2SPZ A;  1M1J A;  2R44 A;  1BE3 G;  3KXD A;  4W80 A;  4QMA A;  2K0D X;  2XND H;  5APS A;  1LWU A;  3W68 A;  1BCC G;  2KOR A;  2V4H A;  1M56 D;  3H1K G;  4DOJ A;  2QJK B;  2XT1 A;  2YO3 A;  3A0B H;  3M0D A;  1IC2 A;  2KSE A;  3A5T A;  2GZJ A;  3EJB A;  1KB9 D;  4RJT A;  1SQP E;  4EYY Q;  2QJY B;  1JEK A;  2RH0 A;  2LIW A;  5APX A;  3CE7 A;  5DCK A;  4YXW H;  3H25 A;  1GD2 E;  2B87 B;  1SLQ A;  3RG2 A;  5AVW B;  1KQS O;  3MTU E;  5KLV J;  1S72 P;  1IMQ A;  5AVS B;  2RMZ A;  3TNU B;  2C9N Y;  3VTP C;  1IMP A;  2FBW C;  4U3F D;  3HTK A;  1M90 Q;  2MD9 A;  3L72 D;  3H32 B;  3L70 E;  1BCC E;  1N7S D;  4R4L A;  2JO1 A;  1VF5 C;  2J5U A;  4EI2 A;  2OAR A;  3CX5 E;  4DJG A;  5AW1 B;  2WSE H;  3B5N D;  3HZQ A;  1PP9 E;  4N3Y B;  4PD4 D;  4H44 C;  1S3J A;  1NGM B;  1NVO A;  2E75 C;  4WBA A;  4HJG H;  1G2C B;  1LTT C;  3AE3 C;  2AXT E;  1FS0 E;  4DT0 A;  3AE2 C;  2K88 A;  4ZMD A;  1QGK B;  3M0A A;  3CXC O;  1L0H A;  5HGN A;  2PFX A;  2WWW A;  5KTB A;  5B5E E;  3HD7 B;  2Q3E A;  1FZA A;  3CC7 P;  1KB9 E;  1LT9 B;  2C9L Y;  4K35 A;  3WMM 0;  1SQQ J;  3LW5 J;  4XFX A;  1J2J B;  3V2Q A;  5CJ0 A;  1NTM K;  1NU1 J;  3VMA A;  3H47 A;  1SQP J;  4Y99 C;  2GUS A;  1KZU B;  4PXH B;  1BDD A;  1JTH B;  3BCC E;  5E79 H;  1N7S C;  3F5H A;  3LW5 H;  1RE3 C;  1GL2 C;  1D1D A;  1W2B O;  3AEE C;  2W6B A;  2YIU B;  2Y9Z A;  3L72 G;  3WUU A;  1VQ4 P;  4JQ0 D;  1RO2 A;  1S9K E;  3CCU P;  3H1I E;  3M9Q A;  3L73 J;  2P2U A;  1A43 A;  1VQP P;  3BRT B;  1M57 D;  1SQV G;  5AVV B;  1N73 A;  4OVN F;  2E74 D;  5BU5 A;  2BAS A;  3E1I A;  5H2F E;  3L37 A;  2YXR B;  2O1K A;  5KP6 B;  5KLV E;  2YMY A;  3NY7 B;  4H44 B;  2KOO A;  4XFJ A;  3D71 A;  3CX5 D;  2KGA A;  3V6I A;  1VQO P;  2EIA A;  3IR9 A;  3P05 A;  3GZM A;  1MZ9 A;  1A8O A;  3SWY A;  5GTI H;  3H1L J;  2KUB A;  3L74 G;  4NPF X;  2JJL A;  1JM0 A;  2PEO A;  1SQB J;  1KC8 Q;  1W5C E;  1VQ9 P;  1NTZ D;  2M5R A;  2KS1 A;  1FU1 A;  2PEN A;  5GTH H;  2KI7 B;  7CEI A;  3CCL P;  1N86 A;  4R0M A;  1QVG O;  1FZC C;  1FJK A;  1ZRT D;  3GG2 A;  1LP1 A;  1PGQ A;  3CWB J;  3L4F A;  3N4X A;  2WPS A;  2PGD A;  4WYM A;  4IFF A;  1G1J A;  2M8L A;  2IZ1 A;  2UWJ E;  3OA7 A;  1PGJ A;  1QX8 A;  1NQ4 A;  2WVR A;  2E75 B;  1MKM A;  1X22 A;  2ZJS E;  4PJ0 H;  2GA1 A;  2W90 A;  4GKG A;  1LTS C;  2B87 A;  1VF5 D;  3A2A A;  1QRJ A;  2J58 A;  1EDI A;  2K1A A;  5I4T G;  2Q1K A;  1ZR4 A;  2Z45 A;  2MR7 A;  1SQP K;  2A45 H;  5APW A;  1P84 D;  4BPH A;  3DS4 A;  1LTI C;  2FXM A;  3G71 P;  4RKU J;  1NTK E;  3LMO A;  1IUQ A;  2Z4E A;  3L73 D;  2MY5 A;  1JMM A;  2L91 A;  1UIX A;  4U0E A;  3L71 E;  5AVR B;  4UHP B;  2CQ8 A;  1LP1 B;  1EZV I;  2IBZ E;  2XV5 A;  2FYU E;  1LT1 A;  3H1H G;  1BGY E;  4BPF A;  2Z5I A;  1SQP G;  2JDI H;  1N73 C;  2IFM A;  1VKU A;  2KGE A;  2OTK E;  3HD7 A;  3B4S A;  2WPT A;  3OJA B;  3EJD A;  2Y9Y A;  3L72 J;  2W6A A;  3IF4 A;  4HH2 A;  5TIS E;  2YNY A;  2BCC E;  1KQG B;  4QKO A;  1KYO D;  3F89 A;  2Y0D A;  3VMZ A;  1RE4 A;  3H1L E;  1MZ8 A;  2OYO A;  1VDF A;  1NU1 D;  4K3A A;  3OW2 O;  2YKQ A;  5CJ4 A;  1BE3 J;  3A0H H;  4GT1 A;  4AQR D;  1K04 A;  1KTM A;  3GW6 A;  2KP8 A;  3Q2Y A;  1VHN A;  5K5G B;  2FVA A;  1SQV E;  1SQQ G;  3MGE A;  2MJZ A;  5F2K A;  4U7J A;  1FE6 A;  1R5S A;  1G1I A;  2YKP A;  3NTE A;  1ZR2 A;  4PH0 A;  2P1J A;  3E2D A;  1HUC A;  1PP9 D;  1T3U A;  1KMI Z;  1ACP A;  4O9B A;  1T8K A;  1YYC A;  3M91 A;  2AFE A;  2W6J H;  1OIP A;  4U3F G;  2KZI A;  4GR6 A;  3FX0 A;  3GHG A;  1N73 B;  1OW7 A;  1FJP A;  4WB4 A;  3H1J E;  4C7N A;  1WMK A;  1Y9B A;  5HGM A;  3B71 A;  1IK7 A;  2KZJ A;  2Y0E A;  3V5B A;  2EFJ A;  2I8D A;  4IFD K;  2QIW A;  4M0I A;  3G9R A;  2IBZ D;  2YO2 A;  3VP8 A;  2N5I A;  4PV1 B;  2GZF A;  5CHX A;  3R2P A;  1JMB A;  1GDT A;  2AVA A;  1YJN P;  4YXD C;  3W67 A;  1D7M A;  3EFF K;  1NKN A;  1K9M Q;  3LRY A;  4RO0 A;  2Y0C A;  3RL0 D;  1PP9 J;  1DIP A;  4DCK A;  3V4Q A;  2N50 A;  1PV3 A;  4ASW A;  1E79 H;  5DJT B;  2XZ1 C;  1RNI A;  4ZKP A;  1KYO E;  2JYG A;  1USD A;  1U7M A;  3OAK A;  3Q20 A;  3L70 J;  2R5D A;  1FZC A;  4IFM A;  1NU1 E;  2O01 H;  4OWF A;  2WIT A;  2NZ2 A;  1SQX G;  2FXP A;  2KG6 A;  2E76 D;  5CBN A;  3TDK A;  1MFZ A;  2IYP A;  2FYU K;  4HKG A;  2LL8 A;  1JNM A;  3KHU A;  2Z46 A;  1SQB D;  4WY4 D;  1N7S A;  2N1T B;  5AW2 B;  3P32 A;  4DG9 A;  1VQK P;  1ZOY C;  1N7L A;  1NTZ K;  2HOD B;  1GK6 A;  1L0L K;  1TU3 F;  5BS1 A;  5AW6 B;  3KZI E;  2N6Z A;  3A0H E;  3FXD A;  2GM4 A;  1F80 D;  4OGQ C;  1HBW A;  1FDI A;  4JF7 A;  4LC1 A;  1VQM P;  5AVU B;  4XRQ A;  2QM7 A;  3ITK A;  1X9V A;  1FDM A;  2FYU G;  4U0F A;  3O6Q A;  5CCH C;  3KZI H;  1P84 I;  2W27 A;  2N9B A;  5TIS H;  2NPS A;  4CA3 A;  3IN6 A;  1JTH A;  2FAC A;  2AEJ A;  1YBK A;  1EMV A;  1ZN5 A;  3G29 A;  1HVV A;  4WY4 B;  3H6P A;  3L75 J;  4GDO A;  2ZVO B;  3CC4 P;  3H4E A;  1JJ2 O;  1JOC A;  1DEE G;  2OYI C;  2KGD A;  1L0I A;  1T6A A;  1A02 J;  1EC5 A;  1MFT A;  3IFM A;  2KG8 A;  4WY4 C;  2FAE A;  1NTM G;  1L0N J;  1PGP A;  1RH5 B;  4YPC A;  2KNC B;  3S9O A;  3RK2 D;  4PD4 I;  1NOH A;  1AV1 A;  3KYQ A;  3H0D A;  1PIX A;  3BRV B;  2GUV A;  1SQX E;  3HUS A;  1L4A B;  3A0B E;  5AW9 B;  2E76 C;  5KLI C;  1WT6 A;  1FOS F;  4RES B;  2IBZ I;  2WMM A;  3I56 P;  2LF4 A;  2KR5 A;  2RN0 A;  2E75 D;  2ZFC A;  2OYH C;  1A02 F;  2C0W A;  1EQ7 A;  1IJD B;  1L0N D;  2E74 B;  2N1T C;  3MP7 B;  4XRO A;  2OTL P;  2G8Y A;  2BQ1 E;  1GXG A;  1KIL B;  3RK3 B;  4Y28 J;  4A7P A;  3L75 D;  4I7Z B;  2JQ4 A;  2LXC B;  2NO8 A;  3NXS A;  1QLE D;  5KKZ C;  4TT3 H;  4XE5 B;  1N8R Q;  2JU2 A;  5KJ7 A;  1GW3 A;  3G21 A;  1RF1 A;  2VLQ A;  4C7R A;  1URQ C;  1BCC J;  1X0T A;  2EG5 A;  3G26 A;  1L0L D;  1P84 E;  1G2C A;  3CWB E;  1GMJ A;  1HY8 A;  3H1K D;  4EDF A;  1P84 H;  3CCE P;  2K9Y A;  3H1K E;  1J1D C;  1QL2 A;  3KPE A;  1DEB A;  5CMZ A;  1Z6M A;  2HOD A;  1N2D C;  2XDJ A;  5C39 A;  2N9Y B;  2WPV B;  1ZNV A;  4ZKU A;  2K9J B;  2IZ0 A;  2DGY A;  4GOE A;  3L75 G;  1OFC X;  1JY2 P;  2FYN B;  4D6T D;  1EZV E;  5AW0 B;  3DTJ A;  2KOP A;  3E7K A;  5CBO A;  1KFM A;  3VMX A;  2VLP A;  1MV8 A;  5AW3 B;  3U43 A;  3RL0 B;  2IPP A;  4C46 A;  2ZVN B;  2PEJ A;  4QNB A;  1NTM E;  3L74 E;  2FYU J;  3G3Z A;  2K0X A;  1PEQ A;  3DS2 A;  4WY4 A;  2A45 G;  3SSU A;  1JY3 N;  5APQ A;  3CX5 I;  3TGU J;  2BCC G;  1XTC C;  4I2L C;  2HPC A;  5KLI B;  2FYN C;  2M3B A;  3RK2 C;  1SQX D;  2AEF A;  1GU4 A;  4JYC A;  4C7N B;  2L0Q A;  1H0T B;  2ONT A;  5AVY B;  1LTB C;  2JYL A;  2E5T A;  3P8M C;  1IFJ A;  4H44 D;  2CNR A;  2JGP A;  1SP4 A;  1NTZ E;  3AED C;  1URQ B;  3H1I J;  3T97 B;  1YJ9 P;  1JY2 O;  3L70 D;  1S1C X;  5E79 E;  3TGU D;  3FGA D;  3CD6 P;  1Q81 Q;  1AQT A;  1S5L X;  3RGU A;  1L0N K;  2H88 C;  1DD4 A;  2PEQ A;  1LWU C;  3L71 G;  4PH1 A;  1PPJ D;  3H1J D;  3P8C E;  5AW7 B;  3GZL A;  4IL6 H;  2FYU D;  4JPZ B;  3MD0 A;  2E74 C;  1KB9 H;  3VOP A;  1RO0 A;  2GDX A;  1GPJ A;  3H1H E;  3A7O A;  5APY A;  1ZMB A;  2KLV A;  2KIK A;  4H13 B;  1VPC A;  1IO4 A;  5AW5 B;  2XZR A;  2R3C A;  4I6M C;  2K2Q A;  3NFQ A;  4EOT A;  2KOQ A;  3RBZ A;  3AEC C;  2FQ0 A;  3TNU A;  2LXB A;  1AUM A;  1LWU B;  4MN4 C;  3PTZ A;  2K0Y A;  3H1J J;  3G1G A;  1ZXG A;  1DD3 A;  3CX5 H;  2WSF H;  3CLQ A;  1LJ2 A;  1NTK D;  5GTH E;  2VLN A;  4ASV A;  3M9B A;  1X3O A;  3MIW A;  1YQ4 C;  2NPS D;  5KLV G;  2KW2 A;  4PWV B;  5GTI E;  3L74 J;  4H0L D;  1KIL C;  3RK3 C;  1PZQ A;  1WRG A;  2L9F A;  1BE3 D;  1KYO H;  1AFO A;  3TGU E;  2FKW B;  1SQB K;  1FZE A;  1VF5 B;  1NTZ G;  2JKV A;  2MR8 A;  1EOQ A;  3DS3 A;  4W7Z A;  2R3S A;  5KJ7 D;  5APU A;  2CK3 H;  2PP6 A;  2ZYD A;  3RL0 g;  2BUO A;  1AJY A;  1XTG B;  2Q7C A;  2PEK A;  2K37 A;  1T2K C;  3USS A;  1IFD A;  1USE A;  4U3F E;  2WT7 B;  1BSH A;  1EZV G;  4L73 A;  3L73 G;  2M3E A;  5B66 E;  2IBZ G;  1LTJ B;  2ZYA A;  2B9B A;  1FBM A;  4NPE A;  1OW8 A;  4KHX A;  3AE9 C;  2PEM A;  5M1B A;  2GDY A;  1ZV8 A;  1URQ D;  4GOF A;  4PV1 D;  1PL5 A;  1W2E A;  3GF3 A;  5AVQ B;  2ROQ A;  1AF8 A;  3HE5 A;  4U0D A;  4BXL A;  1BCC D;  1OXZ A;  1M6N A;  4L75 A;  3AE1 C;  2XXM A;  2KYV A;  4H2W C;  1GL2 D;  3E1R A;  4LLH A;  5KAI H;  1YJW P;  1FAV A;  2GZE A;  3VYI A;  1PEM A;  3D6Z A;  1KN7 A;  2NPS B;  3CCV P;  5HVC A;  2QA4 P;  4OGQ B;  3AE6 C;  4EIJ A;  5B5E H;  5BVZ A;  2M5A A;  2LTE A;  3FWL A;  3NMD A;  1JB0 J;  1L0L G;  1RF1 B;  1FR2 A;  1SQV J;  2AXT H;  1SQX J;  4H2Y C;  1Q7Y Q;  1LTJ A;  3C9I A;  3CPW O;  3UIA A;  1E5W A;  1URQ A;  1E0H A;  1K30 A;  3G6E P;  1NYH A;  4HKZ H;  2BCC J;  5KAF H;  1L0N E;  3FXE A;  1YTZ T;  1SQQ K;  3GMA A;  3TYY A;  1GTW A;  2XU6 A;  3AE8 C;  2O01 J;  2D2C B;  1FZG A;  2H7H A;  1OR5 A;  2VLO A;  4N78 D;  2A06 E;  1Y8A A;  3DS1 A;  3MHV A;  4D6T E;  2LOL A;  3L73 E;  2CGQ A;  1Q86 Q;  2JP3 A;  2J59 M;  1CSB A;  2BEZ F;  4W7Y A;  3VMY A;  1VQL P;  2JAZ A;  2L5G B;  3IAO A;  3HTK B;  3CME P;  4KJM A;  1SFC A;  1LGH B;  5KKZ B;  1KFN A;  1RHZ B;  4F37 A;  4KT0 J;  1M1J C;  1S9K D;  3TF5 A;  2KXP B;  4M3L A;  4GR2 A;  1IFP A;  1CI6 A;  3H1K J;  2MKV A;  5AW4 B;  2LPK A;  1VQ5 P;  4PJ0 E;  1FZC B;  5BS2 A;  2P58 A;  3AEF C;  2POH A;  1S5L E;  3PJS K;  1X8Y A;  1T3J A;  2A06 G;  3KQG A;  5APT A;  2Q6Q A;  1QL1 A;  3Q5R A;  1ZW0 A;  5CCH D;  2FHS C;  1YIT P;  2KSJ A;  3MUD A;  5HGO A;  4U0C A;  3I55 P;  1IK9 A;  2V7Q J;  1SQP D;  3WU2 E;  1YIJ P;  4H13 D;  1JY2 N;  4HB1 A;  4R4M A;  4CPG A;  1SQX K;  4OH8 B;  1EXI A;  3EFG A;  1SFC C;  2HR3 A;  1K8A Q;  1K73 Q;  5AW8 B;  2MF4 A;  2K94 A;  1FOS E;  4XFY A;  4B86 A;  2QSI A;  2JR8 A;  1KQF B;  1FDO A;  1NTZ J;  3VP9 A;  1JCD A;  5AVX B;  1CEI A;  3BVH A;  1HJB A;  1LTA C;  4JBZ A;  2ZXE B;  4UB6 E;  2WZ7 A;  1DX7 A;  1AVO A;  1UNK A;  1NTK K;  2IX7 C;  1S4X A;  4HYT B;  3AE5 C;  1Z56 A;  1NJI Q;  1HGZ A;  3QH9 A;  1EXJ A;  5H2F H;  4IZ6 A;  2FQ2 A;  1H89 A;  1KOR A;  3H1L G;  3L75 E;  1JY3 O;  1NKZ B;  3PLN A;  3MZW B;  1NU1 K;  1RQU A;  2BEQ D;  2P7J A;  4BPG A;  1YI2 P;  2C0X A;  4H0L B;  1M1J B;  2JU1 A;  2LR2 A;  3PP5 A;  4Y99 B;  2LKI A;  3H1H J;  2M8R A;  1HF9 A;  1RQV A;  4WWI A;  3G0V A;  2JEE A;  3C1L A;  2OYH B;  2AEM A;  2DNW A;  3GHG C;  2PNG A;  2M0B A;  1LTJ C;  4PV1 C;  1NTK J;  1BGY J;  2YXQ B;  1UII A;  1Q82 Q;  1HGV A;  2XZ0 D;  3DS5 A;  4GOD A;  1SFC B;  2E76 B;  2ZXX A;  1QVF O;  4DZO A;  1GL2 B;  2G3A A;  5HGL A;  1UJZ A;  3L74 D;  2H89 C;  4UB8 E;  2WSS H;  4U0B A;  2ZT9 B;  1HTL C;  1ZME C;  5KJ7 C;  3H1H D; 
#chains in the Genus database with same CATH homology
 1VQ7 P;  3CC4 P;  1M74 A;  2PEQ A;  1QVG O;  2XT1 A;  4PH1 A;  3H4E A;  1JJ2 O;  1RNI A;  3G28 A;  5F2O A;  2DGY A;  3DPH A;  1RO0 A;  1D1D A;  2JYG A;  1W2B O;  5F2N A;  1VQN P;  1EIA A;  3Q20 A;  3OW2 O;  3CC2 P;  4WYM A;  3DS1 A;  5DCK A;  3DTJ A;  1VQ6 P;  2M8L A;  1ZMB A;  1VQ4 P;  1Q86 Q;  2PEI A;  1KQS O;  1NJI Q;  3WBH A;  1RO2 A;  1S72 P;  2JO0 A;  1VQL P;  3CCU P;  2PEJ A;  4QNB A;  2KOD A;  4XFZ A;  3H0D A;  2BHV A;  2PEM A;  4COC A;  3CME P;  1PEU A;  3CCS P;  3MGE A;  1PEO A;  5F2K A;  1PEQ A;  3DS2 A;  1A43 A;  1M90 Q;  1YHQ P;  1VQP P;  1AUM A;  3NTE A;  1M1K Q;  4PH0 A;  1VQ8 P;  3E2D A;  3G1G A;  3CCM P;  1QRJ A;  2OAR A;  2XV6 A;  4GR2 A;  4U0D A;  3CCR P;  2Z46 A;  3I56 P;  3M1M A;  2LF4 A;  3HZQ A;  5I4T G;  2M8N A;  2Z45 A;  1VQ5 P;  1YI2 P;  1M6N A;  3RG6 C;  5BS2 A;  2XXM A;  3CCQ P;  3DS4 A;  1VQK P;  3DS0 A;  3CCJ P;  2CWO A;  3G71 P;  5JPA A;  4GR6 A;  2QEX P;  4IPY A;  2ONT A;  1YJW P;  5BS1 A;  4XRO A;  1PEM A;  1KD1 Q;  2JYL A;  2OTL P;  3CXC O;  3G0V A;  1IUQ A;  3CCV P;  2BQ1 E;  1E6J P;  2QA4 P;  2E1M A;  5HGM A;  1VQM P;  5HGN A;  1YIT P;  2PY8 A;  4XRQ A;  1VQO P;  2EIA A;  2EFJ A;  3HYB A;  2OTJ P;  3P05 A;  4U0E A;  5HGO A;  4M0I A;  3CC7 P;  2M8P A;  4U0C A;  4U0F A;  1Q82 Q;  1YJ9 P;  1N8R Q;  3G1I A;  3DS5 A;  3I55 P;  3B5I A;  3G4S P;  1A8O A;  1M6E X;  4COP A;  1QVF O;  1YIJ P;  1EOQ A;  3G21 A;  3DS3 A;  1YJN P;  5HGL A;  2PEO A;  1Q7Y Q;  1KC8 Q;  3CD6 P;  2EG5 A;  1VQ9 P;  4XFX A;  2Z44 A;  3G26 A;  3VRL C;  1BAJ A;  1Q81 Q;  1K73 Q;  1K9M Q;  4U0B A;  3CPW O;  1K8A Q;  3LRY A;  3G29 A;  2PEN A;  2BUO A;  2P9X A;  3H47 A;  4XFY A;  1K30 A;  3G6E P;  3CCL P;  2PEK A;  3CMA P;  2L6E A;  3CCE P;  4U0A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...