2FQ0A

Solution structure of major conformation of holo-acyl carrier protein from malaria parasite plasmodium falciparum
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
79
structure length
79
Chain Sequence
LKSTFDDIKKIISKQLSVEEDKIQMNSNFTKDLGADSLDLVELIMALEEKFNVTISDQDALKINTVQDAIDYIEKNNKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structures of conformationally equilibrium forms of holo-acyl carrier protein (PfACP) from Plasmodium falciparum provides insight into the mechanism of activation of ACPs
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Lipid transport
molecule keywords acyl carrier protein
total genus 18
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2006-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2fq0A00
2KGEA 2K0YA 1T8KA 3GZMA 4BPHA 2GDXA 2GDWA 2MY5A 2K92A 2FVFA 2K2QA 2L4BA 1ACPA 4MRTC 2JGPA 1F80D 2JU1A 2N6ZA 2KGCA 2KG6A 1OR5A 5KP7B 5KP8B 2AVAA 2KOOA 2FACA 2K94A 1AF8A 5CZDB 3EJDA 5EJDA 2KGDA 2KGAA 2KG9A 2FHSC 4BPFA 1KLPA 2KORA 2LPKA 2L22A 2LIUA 3GZLA 3CE7A 2FQ2A 1X3OA 2LL8A 5HVCA 2KOQA 3EJBA 2N6YA 2JQ4A 4H2XC 2GDYA 2VSQA 4BPGA 2KWLA 2KW2A 2N5IA 2CGQA 2X2BA 2LTEA 2ROQA 2CG5B 2KOPA 2LIWA 2AFDA 2CQ8A 2FADA 2L0QA 2M5RA 1VKUA 2K93A 1NQ4A 4H2YC 2MR8A 2K0XA 2XZ0D 2LMLA 2FQ1A 2FVAA 4PWVB 1HQBA 2AF8A 4R0MA 5HV8A 3NY7B 2PNGA 2FQ0A 2N5HA 4NEOA 2FVEA 2AFEA 1HY8A 2KR5A 2N98A 2KOSA 5KP6B 2QNWA 2CNRA 2XZ1C 1DNYA 2JU2A 2MVUA 4PXHB 2DNWA 3LMOA 4HKGA 2MD9A 4H2WC 2L9FA 2MR7A 4CA3A 1L0IA 4DG9A 2MVVA 1DV5A 2LKIA 2EHSA 3RG2A 3EJEA 2LOLA 1L0HA 4IZ6A 2KG8A 2FAEA 2MF4A 2N50A 2EHTA
chains in the Genus database with same CATH superfamily
2K0YA 1YI2P 3GZMA 2GDXA 2JO0A 4XFYA 2K92A 4QNBA 2XT1A 5F2KA 3G6EP 2L4BA 1BXIA 1BAJA 4M0IA 2QA4P 1VQ5P 5KP7B 3DS5A 2AVAA 1JJ2O 3CCMP 2KOOA 2Z44A 5HGMA 2FACA 2PENA 3G4SP 3G71P 2PEJA 2LPKA 2LIUA 1A43A 1YJNP 2DGYA 3CE7A 2PEMA 1RO0A 1Q81Q 2NO8A 1IUQA 5F2OA 2JQ4A 2GDYA 1E6JP 3CMAP 2LTEA 3CCUP 1K9MQ 2CG5B 2PEIA 5HGLA 1EIAA 1QVGO 1YJWP 3OW2O 2WPTA 1M6EX 2XZ0D 2LMLA 1A8OA 4XROA 3CD6P 1HQBA 4R0MA 4XRQA 1GXGA 3G0VA 3NY7B 4U0CA 2VLOA 3GJNA 2FVEA 4GR2A 1HY8A 2N98A 5I4TG 2PY8A 1D1DA 3E2DA 2CNRA 3CC2P 2XZ1C 1KQSO 1DNYA 1Q82Q 1QRJA 1VQMP 3DS3A 3B4QA 4F37A 1VQ8P 3H0DA 4GR6A 2LKIA 2JYLA 3I55P 4U0AA 2PEOA 2KGEA 3CMEP 1ACPA 3CCJP 3U43A 3DS1A 1F80D 3CCRP 2KGCA 2KG6A 1OR5A 3RG6C 5HGOA 2K94A 3HYBA 2KGAA 2FHSC 1KLPA 4U0BA 2L22A 2VLNA 2FQ2A 3CCLP 1X3OA 3CPWO 2ERHA 3CCQP 1ZMBA 1AUMA 1Q7YQ 2VSQA 2GYKA 4BPGA 2KWLA 2CGQA 2GZEA 1VQLP 2LIWA 2CQ8A 2FADA 2L0QA 1VKUA 2M5RA 2K5XA 3H47A 3CC4P 3MGEA 4PWVB 2CWOA 2PNGA 2EFJA 1Q86Q 2GZIA 3LRYA 4U0DA 2Z45A 5KP6B 1VQ4P 4PXHB 2LF4A 3LMOA 2GZGA 4H2WC 2L9FA 2MR7A 3GKLC 1L0IA 1YHQP 2JB0A 1FR2A 1VHNA 3G1IA 3B5IA 2EHSA 2PEQA 1GPJA 2FAEA 3M1MA 3H4EA 2N50A 5EW5E 1CEIA 4BPHA 3P05A 2GDWA 4UHPB 2EG5A 2BHVA 2K2QA 1M6NA 4MRTC 2JGPA 3G29A 3CCSP 2N6ZA 2GZJA 1AF8A 5CZDB 1MZ8A 3EJDA 5EJDA 2QEXP 2K0DX 2KGDA 4U0FA 2KORA 2OTJP 1AYIA 2PEKA 2LL8A 3EJBA 4XFXA 2N6YA 5JPAA 2JYGA 3G21A 4XFZA 2AFDA 2M8NA 5F2NA 4WYMA 5DCKA 2K93A 3G26A 2MR8A 3I56P 3Q20A 1YIJP 1IMPA 2K0XA 3G1GA 2OTLP 5HV8A 5HGNA 1QVFO 2GZFA 1YITP 2FQ0A 4COCA 4NEOA 2L6EA 2VLPA 2KR5A 2QNWA 1Z6MA 2M8PA 1KD1Q 2DNWA 4DG9A 1VQ6P 3G28A 1DV5A 1ZNVA 7CEIA 3EJEA 2XV6A 4COPA 1L0HA 4PH1A 1M90Q 1VQKP 2EHTA 1T8KA 5BS1A 3VRLC 1K8AQ 2MY5A 2FVFA 4PH0A 1VQNP 2JU1A 1VQOP 5KP8B 5BS2A 3DS2A 3DTJA 4IPYA 3CXCO 1E0HA 2KG9A 4BPFA 1VQ7P 3GZLA 3CCVP 1RO2A 1K30A 3DS4A 5HVCA 2KOQA 3NTEA 2BUOA 4U0EA 1VQPP 4H2XC 2OARA 2N5IA 2KW2A 3WBHA 2X2BA 2ROQA 3HZQA 1UNKA 2KOPA 1EOQA 1NQ4A 1UJZA 4H2YC 2KODA 1M1KQ 2FQ1A 2FVAA 2AF8A 3CC7P 1IMQA 2N5HA 2Z46A 2AFEA 1N8RQ 2E1MA 1NJIQ 1K73Q 1YJ9P 2KOSA 3CCEP 2JU2A 2JBGA 2MVUA 2VLQA 4QKOA 1RNIA 1VQ9P 4HKGA 1S72P 2MD9A 2JAZA 2ONTA 4CA3A 1M74A 1GXHA 2P9XA 2MVVA 2EIAA 1EMVA 3DS0A 1KC8Q 1W2BO 3RG2A 2LOLA 2XXMA 4IZ6A 2KG8A 2MF4A 3DPHA 2M8LA
chains in the Genus database with same CATH topology
2KGEA 2K0YA 1T8KA 3GZMA 4BPHA 2GDXA 2GDWA 2MY5A 2K92A 2FVFA 2K2QA 2L4BA 1ACPA 4MRTC 2JGPA 1F80D 2JU1A 2N6ZA 2KGCA 2KG6A 1OR5A 5KP7B 5KP8B 2AVAA 2KOOA 2FACA 2K94A 1AF8A 5CZDB 3EJDA 5EJDA 2KGDA 2KGAA 2KG9A 2FHSC 4BPFA 1KLPA 2KORA 2LPKA 2L22A 2LIUA 3GZLA 3CE7A 2FQ2A 1X3OA 2LL8A 5HVCA 2KOQA 3EJBA 2N6YA 2JQ4A 4H2XC 2GDYA 2VSQA 4BPGA 2KWLA 2KW2A 2N5IA 2CGQA 2X2BA 2LTEA 2ROQA 2CG5B 2KOPA 2LIWA 2AFDA 2CQ8A 2FADA 2L0QA 2M5RA 1VKUA 2K93A 1NQ4A 4H2YC 2MR8A 2K0XA 2XZ0D 2LMLA 2FQ1A 2FVAA 4PWVB 1HQBA 2AF8A 4R0MA 5HV8A 3NY7B 2PNGA 2FQ0A 2N5HA 4NEOA 2FVEA 2AFEA 1HY8A 2KR5A 2N98A 2KOSA 5KP6B 2QNWA 2CNRA 2XZ1C 1DNYA 2JU2A 2MVUA 4PXHB 2DNWA 3LMOA 4HKGA 2MD9A 4H2WC 2L9FA 2MR7A 4CA3A 1L0IA 4DG9A 2MVVA 1DV5A 2LKIA 2EHSA 3RG2A 3EJEA 2LOLA 1L0HA 4IZ6A 2KG8A 2FAEA 2MF4A 2N50A 2EHTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KGE A;  2K0Y A;  1T8K A;  3GZM A;  4BPH A;  2GDX A;  2GDW A;  2MY5 A;  2K92 A;  2FVF A;  2K2Q A;  2L4B A;  1ACP A;  4MRT C;  2JGP A;  1F80 D;  2JU1 A;  2N6Z A;  2KGC A;  2KG6 A;  1OR5 A;  5KP7 B;  5KP8 B;  2AVA A;  2KOO A;  2FAC A;  2K94 A;  1AF8 A;  5CZD B;  3EJD A;  5EJD A;  2KGD A;  2KGA A;  2KG9 A;  2FHS C;  4BPF A;  1KLP A;  2KOR A;  2LPK A;  2L22 A;  2LIU A;  3GZL A;  3CE7 A;  2FQ2 A;  1X3O A;  2LL8 A;  5HVC A;  2KOQ A;  3EJB A;  2N6Y A;  2JQ4 A;  4H2X C;  2GDY A;  2VSQ A;  4BPG A;  2KWL A;  2KW2 A;  2N5I A;  2CGQ A;  2X2B A;  2LTE A;  2ROQ A;  2CG5 B;  2KOP A;  2LIW A;  2AFD A;  2CQ8 A;  2FAD A;  2L0Q A;  2M5R A;  1VKU A;  2K93 A;  1NQ4 A;  4H2Y C;  2MR8 A;  2K0X A;  2XZ0 D;  2LML A;  2FQ1 A;  2FVA A;  4PWV B;  1HQB A;  2AF8 A;  4R0M A;  5HV8 A;  3NY7 B;  2PNG A;  2FQ0 A;  2N5H A;  4NEO A;  2FVE A;  2AFE A;  1HY8 A;  2KR5 A;  2N98 A;  2KOS A;  5KP6 B;  2QNW A;  2CNR A;  2XZ1 C;  1DNY A;  2JU2 A;  2MVU A;  4PXH B;  2DNW A;  3LMO A;  4HKG A;  2MD9 A;  4H2W C;  2L9F A;  2MR7 A;  4CA3 A;  1L0I A;  4DG9 A;  2MVV A;  1DV5 A;  2LKI A;  2EHS A;  3RG2 A;  3EJE A;  2LOL A;  1L0H A;  4IZ6 A;  2KG8 A;  2FAE A;  2MF4 A;  2N50 A;  2EHT A; 
#chains in the Genus database with same CATH topology
 2K0Y A;  1YI2 P;  3GZM A;  2GDX A;  2JO0 A;  4XFY A;  2K92 A;  4QNB A;  2XT1 A;  5F2K A;  3G6E P;  2L4B A;  1BXI A;  1BAJ A;  4M0I A;  2QA4 P;  1VQ5 P;  5KP7 B;  3DS5 A;  2AVA A;  1JJ2 O;  3CCM P;  2KOO A;  2Z44 A;  5HGM A;  2FAC A;  2PEN A;  3G4S P;  3G71 P;  2PEJ A;  2LPK A;  2LIU A;  1A43 A;  1YJN P;  2DGY A;  3CE7 A;  2PEM A;  1RO0 A;  1Q81 Q;  2NO8 A;  1IUQ A;  5F2O A;  2JQ4 A;  2GDY A;  1E6J P;  3CMA P;  2LTE A;  3CCU P;  1K9M Q;  2CG5 B;  2PEI A;  5HGL A;  1EIA A;  1QVG O;  1YJW P;  3OW2 O;  2WPT A;  1M6E X;  2XZ0 D;  2LML A;  1A8O A;  4XRO A;  3CD6 P;  1HQB A;  4R0M A;  4XRQ A;  1GXG A;  3G0V A;  3NY7 B;  4U0C A;  2VLO A;  3GJN A;  2FVE A;  4GR2 A;  1HY8 A;  2N98 A;  5I4T G;  2PY8 A;  1D1D A;  3E2D A;  2CNR A;  3CC2 P;  2XZ1 C;  1KQS O;  1DNY A;  1Q82 Q;  1QRJ A;  1VQM P;  3DS3 A;  3B4Q A;  4F37 A;  1VQ8 P;  3H0D A;  4GR6 A;  2LKI A;  2JYL A;  3I55 P;  4U0A A;  2PEO A;  2KGE A;  3CME P;  1ACP A;  3CCJ P;  3U43 A;  3DS1 A;  1F80 D;  3CCR P;  2KGC A;  2KG6 A;  1OR5 A;  3RG6 C;  5HGO A;  2K94 A;  3HYB A;  2KGA A;  2FHS C;  1KLP A;  4U0B A;  2L22 A;  2VLN A;  2FQ2 A;  3CCL P;  1X3O A;  3CPW O;  2ERH A;  3CCQ P;  1ZMB A;  1AUM A;  1Q7Y Q;  2VSQ A;  2GYK A;  4BPG A;  2KWL A;  2CGQ A;  2GZE A;  1VQL P;  2LIW A;  2CQ8 A;  2FAD A;  2L0Q A;  1VKU A;  2M5R A;  2K5X A;  3H47 A;  3CC4 P;  3MGE A;  4PWV B;  2CWO A;  2PNG A;  2EFJ A;  1Q86 Q;  2GZI A;  3LRY A;  4U0D A;  2Z45 A;  5KP6 B;  1VQ4 P;  4PXH B;  2LF4 A;  3LMO A;  2GZG A;  4H2W C;  2L9F A;  2MR7 A;  3GKL C;  1L0I A;  1YHQ P;  2JB0 A;  1FR2 A;  1VHN A;  3G1I A;  3B5I A;  2EHS A;  2PEQ A;  1GPJ A;  2FAE A;  3M1M A;  3H4E A;  2N50 A;  5EW5 E;  1CEI A;  4BPH A;  3P05 A;  2GDW A;  4UHP B;  2EG5 A;  2BHV A;  2K2Q A;  1M6N A;  4MRT C;  2JGP A;  3G29 A;  3CCS P;  2N6Z A;  2GZJ A;  1AF8 A;  5CZD B;  1MZ8 A;  3EJD A;  5EJD A;  2QEX P;  2K0D X;  2KGD A;  4U0F A;  2KOR A;  2OTJ P;  1AYI A;  2PEK A;  2LL8 A;  3EJB A;  4XFX A;  2N6Y A;  5JPA A;  2JYG A;  3G21 A;  4XFZ A;  2AFD A;  2M8N A;  5F2N A;  4WYM A;  5DCK A;  2K93 A;  3G26 A;  2MR8 A;  3I56 P;  3Q20 A;  1YIJ P;  1IMP A;  2K0X A;  3G1G A;  2OTL P;  5HV8 A;  5HGN A;  1QVF O;  2GZF A;  1YIT P;  2FQ0 A;  4COC A;  4NEO A;  2L6E A;  2VLP A;  2KR5 A;  2QNW A;  1Z6M A;  2M8P A;  1KD1 Q;  2DNW A;  4DG9 A;  1VQ6 P;  3G28 A;  1DV5 A;  1ZNV A;  7CEI A;  3EJE A;  2XV6 A;  4COP A;  1L0H A;  4PH1 A;  1M90 Q;  1VQK P;  2EHT A;  1T8K A;  5BS1 A;  3VRL C;  1K8A Q;  2MY5 A;  2FVF A;  4PH0 A;  1VQN P;  2JU1 A;  1VQO P;  5KP8 B;  5BS2 A;  3DS2 A;  3DTJ A;  4IPY A;  3CXC O;  1E0H A;  2KG9 A;  4BPF A;  1VQ7 P;  3GZL A;  3CCV P;  1RO2 A;  1K30 A;  3DS4 A;  5HVC A;  2KOQ A;  3NTE A;  2BUO A;  4U0E A;  1VQP P;  4H2X C;  2OAR A;  2N5I A;  2KW2 A;  3WBH A;  2X2B A;  2ROQ A;  3HZQ A;  1UNK A;  2KOP A;  1EOQ A;  1NQ4 A;  1UJZ A;  4H2Y C;  2KOD A;  1M1K Q;  2FQ1 A;  2FVA A;  2AF8 A;  3CC7 P;  1IMQ A;  2N5H A;  2Z46 A;  2AFE A;  1N8R Q;  2E1M A;  1NJI Q;  1K73 Q;  1YJ9 P;  2KOS A;  3CCE P;  2JU2 A;  2JBG A;  2MVU A;  2VLQ A;  4QKO A;  1RNI A;  1VQ9 P;  4HKG A;  1S72 P;  2MD9 A;  2JAZ A;  2ONT A;  4CA3 A;  1M74 A;  1GXH A;  2P9X A;  2MVV A;  2EIA A;  1EMV A;  3DS0 A;  1KC8 Q;  1W2B O;  3RG2 A;  2LOL A;  2XXM A;  4IZ6 A;  2KG8 A;  2MF4 A;  3DPH A;  2M8L A; 
#chains in the Genus database with same CATH homology
 2KGE A;  2K0Y A;  1T8K A;  3GZM A;  4BPH A;  2GDX A;  2GDW A;  2MY5 A;  2K92 A;  2FVF A;  2K2Q A;  2L4B A;  1ACP A;  4MRT C;  2JGP A;  1F80 D;  2JU1 A;  2N6Z A;  2KGC A;  2KG6 A;  1OR5 A;  5KP7 B;  5KP8 B;  2AVA A;  2KOO A;  2FAC A;  2K94 A;  1AF8 A;  5CZD B;  3EJD A;  5EJD A;  2KGD A;  2KGA A;  2KG9 A;  2FHS C;  4BPF A;  1KLP A;  2KOR A;  2LPK A;  2L22 A;  2LIU A;  3GZL A;  3CE7 A;  2FQ2 A;  1X3O A;  2LL8 A;  5HVC A;  2KOQ A;  3EJB A;  2N6Y A;  2JQ4 A;  4H2X C;  2GDY A;  2VSQ A;  4BPG A;  2KWL A;  2KW2 A;  2N5I A;  2CGQ A;  2X2B A;  2LTE A;  2ROQ A;  2CG5 B;  2KOP A;  2LIW A;  2AFD A;  2CQ8 A;  2FAD A;  2L0Q A;  2M5R A;  1VKU A;  2K93 A;  1NQ4 A;  4H2Y C;  2MR8 A;  2K0X A;  2XZ0 D;  2LML A;  2FQ1 A;  2FVA A;  4PWV B;  1HQB A;  2AF8 A;  4R0M A;  5HV8 A;  3NY7 B;  2PNG A;  2FQ0 A;  2N5H A;  4NEO A;  2FVE A;  2AFE A;  1HY8 A;  2KR5 A;  2N98 A;  2KOS A;  5KP6 B;  2QNW A;  2CNR A;  2XZ1 C;  1DNY A;  2JU2 A;  2MVU A;  4PXH B;  2DNW A;  3LMO A;  4HKG A;  2MD9 A;  4H2W C;  2L9F A;  2MR7 A;  4CA3 A;  1L0I A;  4DG9 A;  2MVV A;  1DV5 A;  2LKI A;  2EHS A;  3RG2 A;  3EJE A;  2LOL A;  1L0H A;  4IZ6 A;  2KG8 A;  2FAE A;  2MF4 A;  2N50 A;  2EHT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...