2FQ0A

Solution structure of major conformation of holo-acyl carrier protein from malaria parasite plasmodium falciparum
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
79
structure length
79
Chain Sequence
LKSTFDDIKKIISKQLSVEEDKIQMNSNFTKDLGADSLDLVELIMALEEKFNVTISDQDALKINTVQDAIDYIEKNNKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structures of conformationally equilibrium forms of holo-acyl carrier protein (PfACP) from Plasmodium falciparum provides insight into the mechanism of activation of ACPs
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Lipid transport
molecule keywords acyl carrier protein
total genus 18
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2006-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2fq0A00
1OR5A 5HV8A 4H2XC 4PWVB 2FACA 4CA3A 2MD9A 3GZLA 2AFEA 2KORA 3NY7B 2JQ4A 2KG6A 3EJBA 1HQBA 2N6YA 2FQ1A 2FAEA 1KLPA 2XZ1C 4HKGA 1L0HA 2GDWA 4IZ6A 2CQ8A 2N98A 4H2WC 4BPGA 2L22A 3LMOA 2LL8A 3RG2A 2LKIA 3CE7A 2M5RA 2AVAA 1F80D 3EJDA 2K93A 1DV5A 2FQ2A 2PNGA 1DNYA 2CG5B 2FQ0A 1AF8A 2CGQA 2MVVA 2JU2A 2GDXA 2X2BA 2JGPA 2KWLA 2KGDA 2EHTA 2FVEA 2KW2A 2VSQA 2K0YA 4PXHB 4R0MA 1NQ4A 5HVCA 2AFDA 2KGCA 2MF4A 2L0QA 1T8KA 2EHSA 5CZDB 4NEOA 2N50A 2KOSA 2LIUA 2MR8A 1ACPA 2LMLA 2MVUA 2N6ZA 2LIWA 2LOLA 2DNWA 2QNWA 2ROQA 2MY5A 5KP8B 4H2YC 2N5IA 4MRTC 2KGEA 2L4BA 4DG9A 1X3OA 2FADA 2FVFA 2LPKA 5KP7B 2N5HA 2CNRA 2KOQA 2K94A 2KGAA 1VKUA 2K2QA 1HY8A 2L9FA 2K0XA 2GDYA 5EJDA 2FVAA 2KG8A 3GZMA 4BPHA 1L0IA 2KR5A 2AF8A 2LTEA 2MR7A 2KOPA 3EJEA 2XZ0D 2KOOA 2KG9A 5KP6B 2K92A 2JU1A 4BPFA 2FHSC
chains in the Genus database with same CATH superfamily
3MGEA 3CD6P 3NTEA 5HV8A 4H2XC 4IPYA 3GKLC 4PWVB 4U0DA 2MD9A 2KODA 2WPTA 1QVFO 2EIAA 2KG6A 2M8NA 2CQ8A 1VQ4P 2QA4P 2L6EA 1VQNP 2VLOA 4U0AA 3CCEP 3RG2A 1CEIA 2XT1A 3DS0A 1RO2A 2M5RA 1ZMBA 1F80D 2K5XA 2M8PA 5JPAA 2BUOA 2PEQA 2PNGA 2FQ0A 3CC7P 3DTJA 2JGPA 2Z45A 1VQ7P 2VSQA 2K0YA 4PXHB 5HVCA 7CEIA 1YHQP 2KGCA 4QNBA 3P05A 2MF4A 2L0QA 1Q82Q 2KOSA 2LIUA 2LMLA 3G6EP 2LOLA 2NO8A 4UHPB 3DS4A 2XXMA 3CMEP 3CCQP 2N5IA 1EMVA 2FVFA 3M1MA 2PEIA 1VKUA 1IMQA 1HY8A 2K0XA 5I4TG 1VQPP 2KG8A 3GZMA 3H0DA 2KR5A 1GPJA 3HZQA 1E0HA 2K0DX 2DGYA 3RG6C 2KOOA 2KG9A 2VLNA 1KD1Q 1YJWP 1M6EX 3G26A 1BAJA 3CC2P 2BHVA 2P9XA 5BS2A 2PEMA 3CPWO 3CXCO 1VQMP 2PY8A 5F2NA 3GZLA 4PH0A 1ZNVA 2AFEA 4PH1A 2JQ4A 3E2DA 2N6YA 1KLPA 2XZ1C 2N98A 2L22A 3LMOA 3HYBA 3DS1A 1GXGA 2LF4A 1RO0A 2AVAA 1N8RQ 3U43A 3EJDA 2FQ2A 1DNYA 3B4QA 1UJZA 2KGDA 2KW2A 2ONTA 5HGNA 4GR2A 4M0IA 2N50A 3DS2A 2XV6A 2MVUA 2N6ZA 5DCKA 2QNWA 2EFJA 1GXHA 5KP8B 3CC4P 4U0FA 2JO0A 1VHNA 1IUQA 4DG9A 2FADA 2N5HA 3CCLP 2KGAA 2VLPA 1UNKA 2QEXP 4XROA 3G4SP 2GDYA 3G29A 4BPHA 1FR2A 3G0VA 1M6NA 2EG5A 2KOPA 1YIJP 1JJ2O 1KC8Q 4U0EA 3CMAP 4XRQA 2FHSC 2JAZA 1A43A 1KQSO 1OR5A 1K73Q 1VQKP 2KORA 2VLQA 3LRYA 2CWOA 1HQBA 2FQ1A 2FAEA 1L0HA 2GDWA 1VQ5P 2GZGA 2JB0A 2LL8A 2ERHA 2OTJP 3CCVP 3CE7A 4WYMA 1QRJA 2JU2A 3CCMP 2KWLA 3G1IA 1BXIA 3G71P 2EHTA 2FVEA 1M74A 4R0MA 1NQ4A 1YJ9P 1VQ8P 5HGOA 1EIAA 1NJIQ 1VQ9P 4XFXA 2EHSA 5CZDB 2MR8A 3VRLC 2PEOA 2OTLP 2MY5A 1D1DA 4H2YC 2KGEA 2L4BA 3G1GA 3H4EA 5KP7B 2CNRA 2JYLA 2KOQA 1YI2P 2K94A 1VQLP 3CCJP 2K2QA 2L9FA 3I56P 2GZEA 2FVAA 4COCA 1AUMA 1Z6MA 1L0IA 2AF8A 2MR7A 2Z44A 2GZJA 2PEJA 1YJNP 3DS5A 1EOQA 3I55P 2JU1A 1YITP 4BPFA 4GR6A 1QVGO 1IMPA 2FACA 4CA3A 3NY7B 1M1KQ 2PEKA 3EJBA 4HKGA 4IZ6A 2GYKA 4H2WC 4BPGA 5F2KA 3DPHA 1A8OA 3H47A 3G28A 1K30A 1AYIA 4U0BA 5EW5E 2OARA 1M90Q 2LKIA 1MZ8A 2JYGA 2K93A 1DV5A 5HGMA 2GZFA 5BS1A 2CG5B 1AF8A 2CGQA 2MVVA 3CCSP 3B5IA 1K9MQ 2GDXA 2X2BA 1RNIA 3OW2O 4COPA 2PENA 2Z46A 4F37A 1Q7YQ 2AFDA 4QKOA 2E1MA 3G21A 1T8KA 3Q20A 4NEOA 1ACPA 4U0CA 4XFYA 2LIWA 5F2OA 2DNWA 2ROQA 3CCRP 2M8LA 4MRTC 1K8AQ 1Q86Q 1X3OA 2LPKA 1VQ6P 5HGLA 2GZIA 3WBHA 1W2BO 3GJNA 5EJDA 3CCUP 2LTEA 1Q81Q 1E6JP 3EJEA 2XZ0D 3DS3A 1S72P 5KP6B 4XFZA 2K92A 1VQOP 2JBGA
chains in the Genus database with same CATH topology
1OR5A 5HV8A 4H2XC 4PWVB 2FACA 4CA3A 2MD9A 3GZLA 2AFEA 2KORA 3NY7B 2JQ4A 2KG6A 3EJBA 1HQBA 2N6YA 2FQ1A 2FAEA 1KLPA 2XZ1C 4HKGA 1L0HA 2GDWA 4IZ6A 2CQ8A 2N98A 4H2WC 4BPGA 2L22A 3LMOA 2LL8A 3RG2A 2LKIA 3CE7A 2M5RA 2AVAA 1F80D 3EJDA 2K93A 1DV5A 2FQ2A 2PNGA 1DNYA 2CG5B 2FQ0A 1AF8A 2CGQA 2MVVA 2JU2A 2GDXA 2X2BA 2JGPA 2KWLA 2KGDA 2EHTA 2FVEA 2KW2A 2VSQA 2K0YA 4PXHB 4R0MA 1NQ4A 5HVCA 2AFDA 2KGCA 2MF4A 2L0QA 1T8KA 2EHSA 5CZDB 4NEOA 2N50A 2KOSA 2LIUA 2MR8A 1ACPA 2LMLA 2MVUA 2N6ZA 2LIWA 2LOLA 2DNWA 2QNWA 2ROQA 2MY5A 5KP8B 4H2YC 2N5IA 4MRTC 2KGEA 2L4BA 4DG9A 1X3OA 2FADA 2FVFA 2LPKA 5KP7B 2N5HA 2CNRA 2KOQA 2K94A 2KGAA 1VKUA 2K2QA 1HY8A 2L9FA 2K0XA 2GDYA 5EJDA 2FVAA 2KG8A 3GZMA 4BPHA 1L0IA 2KR5A 2AF8A 2LTEA 2MR7A 2KOPA 3EJEA 2XZ0D 2KOOA 2KG9A 5KP6B 2K92A 2JU1A 4BPFA 2FHSC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OR5 A;  5HV8 A;  4H2X C;  4PWV B;  2FAC A;  4CA3 A;  2MD9 A;  3GZL A;  2AFE A;  2KOR A;  3NY7 B;  2JQ4 A;  2KG6 A;  3EJB A;  1HQB A;  2N6Y A;  2FQ1 A;  2FAE A;  1KLP A;  2XZ1 C;  4HKG A;  1L0H A;  2GDW A;  4IZ6 A;  2CQ8 A;  2N98 A;  4H2W C;  4BPG A;  2L22 A;  3LMO A;  2LL8 A;  3RG2 A;  2LKI A;  3CE7 A;  2M5R A;  2AVA A;  1F80 D;  3EJD A;  2K93 A;  1DV5 A;  2FQ2 A;  2PNG A;  1DNY A;  2CG5 B;  2FQ0 A;  1AF8 A;  2CGQ A;  2MVV A;  2JU2 A;  2GDX A;  2X2B A;  2JGP A;  2KWL A;  2KGD A;  2EHT A;  2FVE A;  2KW2 A;  2VSQ A;  2K0Y A;  4PXH B;  4R0M A;  1NQ4 A;  5HVC A;  2AFD A;  2KGC A;  2MF4 A;  2L0Q A;  1T8K A;  2EHS A;  5CZD B;  4NEO A;  2N50 A;  2KOS A;  2LIU A;  2MR8 A;  1ACP A;  2LML A;  2MVU A;  2N6Z A;  2LIW A;  2LOL A;  2DNW A;  2QNW A;  2ROQ A;  2MY5 A;  5KP8 B;  4H2Y C;  2N5I A;  4MRT C;  2KGE A;  2L4B A;  4DG9 A;  1X3O A;  2FAD A;  2FVF A;  2LPK A;  5KP7 B;  2N5H A;  2CNR A;  2KOQ A;  2K94 A;  2KGA A;  1VKU A;  2K2Q A;  1HY8 A;  2L9F A;  2K0X A;  2GDY A;  5EJD A;  2FVA A;  2KG8 A;  3GZM A;  4BPH A;  1L0I A;  2KR5 A;  2AF8 A;  2LTE A;  2MR7 A;  2KOP A;  3EJE A;  2XZ0 D;  2KOO A;  2KG9 A;  5KP6 B;  2K92 A;  2JU1 A;  4BPF A;  2FHS C; 
#chains in the Genus database with same CATH topology
 3MGE A;  3CD6 P;  3NTE A;  5HV8 A;  4H2X C;  4IPY A;  3GKL C;  4PWV B;  4U0D A;  2MD9 A;  2KOD A;  2WPT A;  1QVF O;  2EIA A;  2KG6 A;  2M8N A;  2CQ8 A;  1VQ4 P;  2QA4 P;  2L6E A;  1VQN P;  2VLO A;  4U0A A;  3CCE P;  3RG2 A;  1CEI A;  2XT1 A;  3DS0 A;  1RO2 A;  2M5R A;  1ZMB A;  1F80 D;  2K5X A;  2M8P A;  5JPA A;  2BUO A;  2PEQ A;  2PNG A;  2FQ0 A;  3CC7 P;  3DTJ A;  2JGP A;  2Z45 A;  1VQ7 P;  2VSQ A;  2K0Y A;  4PXH B;  5HVC A;  7CEI A;  1YHQ P;  2KGC A;  4QNB A;  3P05 A;  2MF4 A;  2L0Q A;  1Q82 Q;  2KOS A;  2LIU A;  2LML A;  3G6E P;  2LOL A;  2NO8 A;  4UHP B;  3DS4 A;  2XXM A;  3CME P;  3CCQ P;  2N5I A;  1EMV A;  2FVF A;  3M1M A;  2PEI A;  1VKU A;  1IMQ A;  1HY8 A;  2K0X A;  5I4T G;  1VQP P;  2KG8 A;  3GZM A;  3H0D A;  2KR5 A;  1GPJ A;  3HZQ A;  1E0H A;  2K0D X;  2DGY A;  3RG6 C;  2KOO A;  2KG9 A;  2VLN A;  1KD1 Q;  1YJW P;  1M6E X;  3G26 A;  1BAJ A;  3CC2 P;  2BHV A;  2P9X A;  5BS2 A;  2PEM A;  3CPW O;  3CXC O;  1VQM P;  2PY8 A;  5F2N A;  3GZL A;  4PH0 A;  1ZNV A;  2AFE A;  4PH1 A;  2JQ4 A;  3E2D A;  2N6Y A;  1KLP A;  2XZ1 C;  2N98 A;  2L22 A;  3LMO A;  3HYB A;  3DS1 A;  1GXG A;  2LF4 A;  1RO0 A;  2AVA A;  1N8R Q;  3U43 A;  3EJD A;  2FQ2 A;  1DNY A;  3B4Q A;  1UJZ A;  2KGD A;  2KW2 A;  2ONT A;  5HGN A;  4GR2 A;  4M0I A;  2N50 A;  3DS2 A;  2XV6 A;  2MVU A;  2N6Z A;  5DCK A;  2QNW A;  2EFJ A;  1GXH A;  5KP8 B;  3CC4 P;  4U0F A;  2JO0 A;  1VHN A;  1IUQ A;  4DG9 A;  2FAD A;  2N5H A;  3CCL P;  2KGA A;  2VLP A;  1UNK A;  2QEX P;  4XRO A;  3G4S P;  2GDY A;  3G29 A;  4BPH A;  1FR2 A;  3G0V A;  1M6N A;  2EG5 A;  2KOP A;  1YIJ P;  1JJ2 O;  1KC8 Q;  4U0E A;  3CMA P;  4XRQ A;  2FHS C;  2JAZ A;  1A43 A;  1KQS O;  1OR5 A;  1K73 Q;  1VQK P;  2KOR A;  2VLQ A;  3LRY A;  2CWO A;  1HQB A;  2FQ1 A;  2FAE A;  1L0H A;  2GDW A;  1VQ5 P;  2GZG A;  2JB0 A;  2LL8 A;  2ERH A;  2OTJ P;  3CCV P;  3CE7 A;  4WYM A;  1QRJ A;  2JU2 A;  3CCM P;  2KWL A;  3G1I A;  1BXI A;  3G71 P;  2EHT A;  2FVE A;  1M74 A;  4R0M A;  1NQ4 A;  1YJ9 P;  1VQ8 P;  5HGO A;  1EIA A;  1NJI Q;  1VQ9 P;  4XFX A;  2EHS A;  5CZD B;  2MR8 A;  3VRL C;  2PEO A;  2OTL P;  2MY5 A;  1D1D A;  4H2Y C;  2KGE A;  2L4B A;  3G1G A;  3H4E A;  5KP7 B;  2CNR A;  2JYL A;  2KOQ A;  1YI2 P;  2K94 A;  1VQL P;  3CCJ P;  2K2Q A;  2L9F A;  3I56 P;  2GZE A;  2FVA A;  4COC A;  1AUM A;  1Z6M A;  1L0I A;  2AF8 A;  2MR7 A;  2Z44 A;  2GZJ A;  2PEJ A;  1YJN P;  3DS5 A;  1EOQ A;  3I55 P;  2JU1 A;  1YIT P;  4BPF A;  4GR6 A;  1QVG O;  1IMP A;  2FAC A;  4CA3 A;  3NY7 B;  1M1K Q;  2PEK A;  3EJB A;  4HKG A;  4IZ6 A;  2GYK A;  4H2W C;  4BPG A;  5F2K A;  3DPH A;  1A8O A;  3H47 A;  3G28 A;  1K30 A;  1AYI A;  4U0B A;  5EW5 E;  2OAR A;  1M90 Q;  2LKI A;  1MZ8 A;  2JYG A;  2K93 A;  1DV5 A;  5HGM A;  2GZF A;  5BS1 A;  2CG5 B;  1AF8 A;  2CGQ A;  2MVV A;  3CCS P;  3B5I A;  1K9M Q;  2GDX A;  2X2B A;  1RNI A;  3OW2 O;  4COP A;  2PEN A;  2Z46 A;  4F37 A;  1Q7Y Q;  2AFD A;  4QKO A;  2E1M A;  3G21 A;  1T8K A;  3Q20 A;  4NEO A;  1ACP A;  4U0C A;  4XFY A;  2LIW A;  5F2O A;  2DNW A;  2ROQ A;  3CCR P;  2M8L A;  4MRT C;  1K8A Q;  1Q86 Q;  1X3O A;  2LPK A;  1VQ6 P;  5HGL A;  2GZI A;  3WBH A;  1W2B O;  3GJN A;  5EJD A;  3CCU P;  2LTE A;  1Q81 Q;  1E6J P;  3EJE A;  2XZ0 D;  3DS3 A;  1S72 P;  5KP6 B;  4XFZ A;  2K92 A;  1VQO P;  2JBG A; 
#chains in the Genus database with same CATH homology
 1OR5 A;  5HV8 A;  4H2X C;  4PWV B;  2FAC A;  4CA3 A;  2MD9 A;  3GZL A;  2AFE A;  2KOR A;  3NY7 B;  2JQ4 A;  2KG6 A;  3EJB A;  1HQB A;  2N6Y A;  2FQ1 A;  2FAE A;  1KLP A;  2XZ1 C;  4HKG A;  1L0H A;  2GDW A;  4IZ6 A;  2CQ8 A;  2N98 A;  4H2W C;  4BPG A;  2L22 A;  3LMO A;  2LL8 A;  3RG2 A;  2LKI A;  3CE7 A;  2M5R A;  2AVA A;  1F80 D;  3EJD A;  2K93 A;  1DV5 A;  2FQ2 A;  2PNG A;  1DNY A;  2CG5 B;  2FQ0 A;  1AF8 A;  2CGQ A;  2MVV A;  2JU2 A;  2GDX A;  2X2B A;  2JGP A;  2KWL A;  2KGD A;  2EHT A;  2FVE A;  2KW2 A;  2VSQ A;  2K0Y A;  4PXH B;  4R0M A;  1NQ4 A;  5HVC A;  2AFD A;  2KGC A;  2MF4 A;  2L0Q A;  1T8K A;  2EHS A;  5CZD B;  4NEO A;  2N50 A;  2KOS A;  2LIU A;  2MR8 A;  1ACP A;  2LML A;  2MVU A;  2N6Z A;  2LIW A;  2LOL A;  2DNW A;  2QNW A;  2ROQ A;  2MY5 A;  5KP8 B;  4H2Y C;  2N5I A;  4MRT C;  2KGE A;  2L4B A;  4DG9 A;  1X3O A;  2FAD A;  2FVF A;  2LPK A;  5KP7 B;  2N5H A;  2CNR A;  2KOQ A;  2K94 A;  2KGA A;  1VKU A;  2K2Q A;  1HY8 A;  2L9F A;  2K0X A;  2GDY A;  5EJD A;  2FVA A;  2KG8 A;  3GZM A;  4BPH A;  1L0I A;  2KR5 A;  2AF8 A;  2LTE A;  2MR7 A;  2KOP A;  3EJE A;  2XZ0 D;  2KOO A;  2KG9 A;  5KP6 B;  2K92 A;  2JU1 A;  4BPF A;  2FHS C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...