2FQ0A

Solution structure of major conformation of holo-acyl carrier protein from malaria parasite plasmodium falciparum
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
79
structure length
79
Chain Sequence
b'LKSTFDDIKKIISKQLSVEEDKIQMNSNFTKDLGADSLDLVELIMALEEKFNVTISDQDALKINTVQDAIDYIEKNNKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords acyl carrier protein
publication title Solution structures of conformationally equilibrium forms of holo-acyl carrier protein (PfACP) from Plasmodium falciparum provides insight into the mechanism of activation of ACPs
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Lipid transport
total genus 18
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2006-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2fq0A00
4PWVB 5HVCA 5EJDA 2JU2A 2K2QA 2KOQA 2KG8A 2AF8A 2FQ2A 2LMLA 1ACPA 3GZLA 2N98A 2FHSC 2LIUA 2K92A 2MVVA 2KWLA 2LPKA 1KLPA 4DG9A 2L4BA 2KGCA 2CNRA 2N6YA 1F80D 2FVEA 1HY8A 2K93A 4IZ6A 2N50A 4CA3A 2CGQA 2N5HA 1AF8A 3EJBA 5KP8B 2XZ0D 2GDYA 2VSQA 2KGAA 1L0IA 1X3OA 5KP7B 3GZMA 2LIWA 3LMOA 2EHSA 2KGEA 2FVAA 2AVAA 2GDXA 2QNWA 5CZDB 2KG9A 2CQ8A 2AFEA 2N5IA 5HV8A 2FACA 2N6ZA 2PNGA 4NEOA 2KR5A 3CE7A 3EJDA 1HQBA 2LKIA 2DNWA 2KOSA 2CG5B 3RG2A 2K0XA 2K0YA 3NY7B 2EHTA 2KORA 2FADA 1DNYA 2MD9A 2MR8A 2KOOA 2JU1A 4H2YC 2L9FA 2LL8A 2JGPA 4BPFA 2ROQA 2AFDA 2MVUA 4BPHA 1NQ4A 4BPGA 2L0QA 4R0MA 2X2BA 1OR5A 2FAEA 1L0HA 2KW2A 2FQ1A 2K94A 2KGDA 2FQ0A 1T8KA 2GDWA 4H2XC 2FVFA 2JQ4A 5KP6B 2LOLA 2KG6A 2LTEA 2KOPA 2L22A 4MRTC 3EJEA 2XZ1C 1DV5A 4HKGA 1VKUA 2M5RA 2MY5A 4H2WC 2MR7A 4PXHB 2MF4A
chains in the Genus database with same CATH superfamily
1YITP 4PWVB 1UJZA 4M0IA 5EJDA 3NTEA 3CCVP 1VHNA 3DS3A 2OTJP 1YJ9P 2LMLA 2GZGA 2N98A 2MVVA 1F80D 1HY8A 3G4SP 1RO2A 2N5HA 5KP8B 2PENA 1L0IA 2KGEA 4GR2A 2FVAA 2QNWA 2N6ZA 4XFXA 2PNGA 3E2DA 2L6EA 2GZFA 5EW5E 1Q7YQ 1HQBA 3CC4P 2LKIA 2KOSA 2OTLP 1M6EX 2EHTA 3DS1A 1YIJP 3G26A 4PH1A 3DTJA 2Z46A 3MGEA 2GYKA 2CWOA 2GZIA 2PEKA 2VLNA 2EFJA 2FAEA 1L0HA 1D1DA 3G0VA 5F2NA 1VQPP 1T8KA 4PH0A 3H4EA 1ZMBA 2KG6A 3EJEA 2VLQA 1DV5A 4HKGA 5F2OA 2MY5A 3Q20A 4U0FA 2PEIA 4XROA 3G71P 1GPJA 5HVCA 3OW2O 4XFZA 3CMAP 1NJIQ 1S72P 2AF8A 1QVFO 3U43A 3CCMP 2LIUA 1E0HA 2K92A 2Z45A 2L4BA 2N6YA 5JPAA 1JJ2O 2CGQA 2OARA 1AF8A 2GDYA 4COPA 1Z6MA 3GZMA 2LIWA 2PEJA 2AVAA 2GDXA 2KG9A 2CQ8A 1QVGO 4QKOA 3CC2P 2PEMA 5I4TG 3RG2A 2K0YA 3I56P 2MD9A 2JO0A 2JU1A 2L9FA 4BPFA 2AFDA 2E1MA 5BS1A 1UNKA 1GXHA 1YJNP 2FQ1A 5HGOA 1VQKP 1IUQA 4WYMA 2EG5A 2GDWA 1E6JP 4H2XC 1VQMP 5KP6B 2LOLA 1W2BO 4XFYA 2L22A 1FR2A 2EIAA 2XZ1C 4U0AA 1RNIA 3M1MA 1VKUA 4H2WC 3CCQP 4F37A 2MR7A 1GXGA 3RG6C 1VQ8P 2ONTA 1K8AQ 2K2QA 2KG8A 4XRQA 3WBHA 1VQ7P 1VQOP 2GZJA 2KWLA 2LPKA 1RO0A 1KLPA 2WPTA 4DG9A 1K9MQ 2K93A 3LRYA 3H0DA 4CA3A 2BUOA 1KD1Q 1MZ8A 3HZQA 2M8NA 1EOQA 3DS5A 2XZ0D 1X3OA 3LMOA 3I55P 5CZDB 2DGYA 2PY8A 3B4QA 2FACA 4NEOA 1KC8Q 3CE7A 1VQ9P 3H47A 3CCRP 5DCKA 1AYIA 1M6NA 2CG5B 2JB0A 2K0XA 3NY7B 3B5IA 3GKLC 2KORA 3G6EP 1DNYA 3HYBA 5HGLA 2MR8A 2QA4P 1N8RQ 2KODA 3CMEP 2PEOA 2LL8A 2JGPA 2M8LA 1Q82Q 2ROQA 3VRLC 1KQSO 3CCLP 4BPHA 1BXIA 1NQ4A 2KW2A 1A43A 2K94A 2GZEA 2KGDA 2FQ0A 1EMVA 1A8OA 4GR6A 1VQLP 1K73Q 2ERHA 5BS2A 2KOPA 4MRTC 1YI2P 2M5RA 2LF4A 2M8PA 3G28A 2K5XA 3DS0A 1ZNVA 2XT1A 1BAJA 1Q81Q 2JU2A 2KOQA 2FQ2A 3GJNA 1ACPA 3CXCO 3GZLA 2FHSC 3G21A 3CCSP 4IPYA 1YJWP 3P05A 1VQ4P 2CNRA 2KGCA 2FVEA 4IZ6A 2N50A 3G1IA 2JYLA 2VLPA 3EJBA 2VSQA 2KGAA 3DS2A 5KP7B 2EHSA 2N5IA 2AFEA 4U0DA 1VQNP 3G29A 2BHVA 1M90Q 1M74A 3CC7P 5HV8A 2Z44A 2KR5A 2P9XA 3EJDA 1K30A 2DNWA 3CCEP 2VLOA 2JYGA 2PEQA 2FADA 1AUMA 4U0EA 2KOOA 3CCUP 3DPHA 4COCA 1QRJA 4H2YC 2XV6A 2XXMA 4UHPB 2QEXP 2MVUA 1YHQP 4BPGA 1VQ6P 2L0QA 4U0BA 3CCJP 4R0MA 2X2BA 1OR5A 4U0CA 2NO8A 1M1KQ 5F2KA 4QNBA 1VQ5P 3CPWO 1EIAA 2FVFA 2JQ4A 3CD6P 5HGMA 2JAZA 2LTEA 5HGNA 1IMPA 1Q86Q 3G1GA 1CEIA 2JBGA 4PXHB 2K0DX 2MF4A 1IMQA 7CEIA 3DS4A
chains in the Genus database with same CATH topology
4PWVB 5HVCA 5EJDA 2JU2A 2K2QA 2KOQA 2KG8A 2AF8A 2FQ2A 2LMLA 1ACPA 3GZLA 2N98A 2FHSC 2LIUA 2K92A 2MVVA 2KWLA 2LPKA 1KLPA 4DG9A 2L4BA 2KGCA 2CNRA 2N6YA 1F80D 2FVEA 1HY8A 2K93A 4IZ6A 2N50A 4CA3A 2CGQA 2N5HA 1AF8A 3EJBA 5KP8B 2XZ0D 2GDYA 2VSQA 2KGAA 1L0IA 1X3OA 5KP7B 3GZMA 2LIWA 3LMOA 2EHSA 2KGEA 2FVAA 2AVAA 2GDXA 2QNWA 5CZDB 2KG9A 2CQ8A 2AFEA 2N5IA 5HV8A 2FACA 2N6ZA 2PNGA 4NEOA 2KR5A 3CE7A 3EJDA 1HQBA 2LKIA 2DNWA 2KOSA 2CG5B 3RG2A 2K0XA 2K0YA 3NY7B 2EHTA 2KORA 2FADA 1DNYA 2MD9A 2MR8A 2KOOA 2JU1A 4H2YC 2L9FA 2LL8A 2JGPA 4BPFA 2ROQA 2AFDA 2MVUA 4BPHA 1NQ4A 4BPGA 2L0QA 4R0MA 2X2BA 1OR5A 2FAEA 1L0HA 2KW2A 2FQ1A 2K94A 2KGDA 2FQ0A 1T8KA 2GDWA 4H2XC 2FVFA 2JQ4A 5KP6B 2LOLA 2KG6A 2LTEA 2KOPA 2L22A 4MRTC 3EJEA 2XZ1C 1DV5A 4HKGA 1VKUA 2M5RA 2MY5A 4H2WC 2MR7A 4PXHB 2MF4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PWV B;  5HVC A;  5EJD A;  2JU2 A;  2K2Q A;  2KOQ A;  2KG8 A;  2AF8 A;  2FQ2 A;  2LML A;  1ACP A;  3GZL A;  2N98 A;  2FHS C;  2LIU A;  2K92 A;  2MVV A;  2KWL A;  2LPK A;  1KLP A;  4DG9 A;  2L4B A;  2KGC A;  2CNR A;  2N6Y A;  1F80 D;  2FVE A;  1HY8 A;  2K93 A;  4IZ6 A;  2N50 A;  4CA3 A;  2CGQ A;  2N5H A;  1AF8 A;  3EJB A;  5KP8 B;  2XZ0 D;  2GDY A;  2VSQ A;  2KGA A;  1L0I A;  1X3O A;  5KP7 B;  3GZM A;  2LIW A;  3LMO A;  2EHS A;  2KGE A;  2FVA A;  2AVA A;  2GDX A;  2QNW A;  5CZD B;  2KG9 A;  2CQ8 A;  2AFE A;  2N5I A;  5HV8 A;  2FAC A;  2N6Z A;  2PNG A;  4NEO A;  2KR5 A;  3CE7 A;  3EJD A;  1HQB A;  2LKI A;  2DNW A;  2KOS A;  2CG5 B;  3RG2 A;  2K0X A;  2K0Y A;  3NY7 B;  2EHT A;  2KOR A;  2FAD A;  1DNY A;  2MD9 A;  2MR8 A;  2KOO A;  2JU1 A;  4H2Y C;  2L9F A;  2LL8 A;  2JGP A;  4BPF A;  2ROQ A;  2AFD A;  2MVU A;  4BPH A;  1NQ4 A;  4BPG A;  2L0Q A;  4R0M A;  2X2B A;  1OR5 A;  2FAE A;  1L0H A;  2KW2 A;  2FQ1 A;  2K94 A;  2KGD A;  2FQ0 A;  1T8K A;  2GDW A;  4H2X C;  2FVF A;  2JQ4 A;  5KP6 B;  2LOL A;  2KG6 A;  2LTE A;  2KOP A;  2L22 A;  4MRT C;  3EJE A;  2XZ1 C;  1DV5 A;  4HKG A;  1VKU A;  2M5R A;  2MY5 A;  4H2W C;  2MR7 A;  4PXH B;  2MF4 A; 
#chains in the Genus database with same CATH topology
 1YIT P;  4PWV B;  1UJZ A;  4M0I A;  5EJD A;  3NTE A;  3CCV P;  1VHN A;  3DS3 A;  2OTJ P;  1YJ9 P;  2LML A;  2GZG A;  2N98 A;  2MVV A;  1F80 D;  1HY8 A;  3G4S P;  1RO2 A;  2N5H A;  5KP8 B;  2PEN A;  1L0I A;  2KGE A;  4GR2 A;  2FVA A;  2QNW A;  2N6Z A;  4XFX A;  2PNG A;  3E2D A;  2L6E A;  2GZF A;  5EW5 E;  1Q7Y Q;  1HQB A;  3CC4 P;  2LKI A;  2KOS A;  2OTL P;  1M6E X;  2EHT A;  3DS1 A;  1YIJ P;  3G26 A;  4PH1 A;  3DTJ A;  2Z46 A;  3MGE A;  2GYK A;  2CWO A;  2GZI A;  2PEK A;  2VLN A;  2EFJ A;  2FAE A;  1L0H A;  1D1D A;  3G0V A;  5F2N A;  1VQP P;  1T8K A;  4PH0 A;  3H4E A;  1ZMB A;  2KG6 A;  3EJE A;  2VLQ A;  1DV5 A;  4HKG A;  5F2O A;  2MY5 A;  3Q20 A;  4U0F A;  2PEI A;  4XRO A;  3G71 P;  1GPJ A;  5HVC A;  3OW2 O;  4XFZ A;  3CMA P;  1NJI Q;  1S72 P;  2AF8 A;  1QVF O;  3U43 A;  3CCM P;  2LIU A;  1E0H A;  2K92 A;  2Z45 A;  2L4B A;  2N6Y A;  5JPA A;  1JJ2 O;  2CGQ A;  2OAR A;  1AF8 A;  2GDY A;  4COP A;  1Z6M A;  3GZM A;  2LIW A;  2PEJ A;  2AVA A;  2GDX A;  2KG9 A;  2CQ8 A;  1QVG O;  4QKO A;  3CC2 P;  2PEM A;  5I4T G;  3RG2 A;  2K0Y A;  3I56 P;  2MD9 A;  2JO0 A;  2JU1 A;  2L9F A;  4BPF A;  2AFD A;  2E1M A;  5BS1 A;  1UNK A;  1GXH A;  1YJN P;  2FQ1 A;  5HGO A;  1VQK P;  1IUQ A;  4WYM A;  2EG5 A;  2GDW A;  1E6J P;  4H2X C;  1VQM P;  5KP6 B;  2LOL A;  1W2B O;  4XFY A;  2L22 A;  1FR2 A;  2EIA A;  2XZ1 C;  4U0A A;  1RNI A;  3M1M A;  1VKU A;  4H2W C;  3CCQ P;  4F37 A;  2MR7 A;  1GXG A;  3RG6 C;  1VQ8 P;  2ONT A;  1K8A Q;  2K2Q A;  2KG8 A;  4XRQ A;  3WBH A;  1VQ7 P;  1VQO P;  2GZJ A;  2KWL A;  2LPK A;  1RO0 A;  1KLP A;  2WPT A;  4DG9 A;  1K9M Q;  2K93 A;  3LRY A;  3H0D A;  4CA3 A;  2BUO A;  1KD1 Q;  1MZ8 A;  3HZQ A;  2M8N A;  1EOQ A;  3DS5 A;  2XZ0 D;  1X3O A;  3LMO A;  3I55 P;  5CZD B;  2DGY A;  2PY8 A;  3B4Q A;  2FAC A;  4NEO A;  1KC8 Q;  3CE7 A;  1VQ9 P;  3H47 A;  3CCR P;  5DCK A;  1AYI A;  1M6N A;  2CG5 B;  2JB0 A;  2K0X A;  3NY7 B;  3B5I A;  3GKL C;  2KOR A;  3G6E P;  1DNY A;  3HYB A;  5HGL A;  2MR8 A;  2QA4 P;  1N8R Q;  2KOD A;  3CME P;  2PEO A;  2LL8 A;  2JGP A;  2M8L A;  1Q82 Q;  2ROQ A;  3VRL C;  1KQS O;  3CCL P;  4BPH A;  1BXI A;  1NQ4 A;  2KW2 A;  1A43 A;  2K94 A;  2GZE A;  2KGD A;  2FQ0 A;  1EMV A;  1A8O A;  4GR6 A;  1VQL P;  1K73 Q;  2ERH A;  5BS2 A;  2KOP A;  4MRT C;  1YI2 P;  2M5R A;  2LF4 A;  2M8P A;  3G28 A;  2K5X A;  3DS0 A;  1ZNV A;  2XT1 A;  1BAJ A;  1Q81 Q;  2JU2 A;  2KOQ A;  2FQ2 A;  3GJN A;  1ACP A;  3CXC O;  3GZL A;  2FHS C;  3G21 A;  3CCS P;  4IPY A;  1YJW P;  3P05 A;  1VQ4 P;  2CNR A;  2KGC A;  2FVE A;  4IZ6 A;  2N50 A;  3G1I A;  2JYL A;  2VLP A;  3EJB A;  2VSQ A;  2KGA A;  3DS2 A;  5KP7 B;  2EHS A;  2N5I A;  2AFE A;  4U0D A;  1VQN P;  3G29 A;  2BHV A;  1M90 Q;  1M74 A;  3CC7 P;  5HV8 A;  2Z44 A;  2KR5 A;  2P9X A;  3EJD A;  1K30 A;  2DNW A;  3CCE P;  2VLO A;  2JYG A;  2PEQ A;  2FAD A;  1AUM A;  4U0E A;  2KOO A;  3CCU P;  3DPH A;  4COC A;  1QRJ A;  4H2Y C;  2XV6 A;  2XXM A;  4UHP B;  2QEX P;  2MVU A;  1YHQ P;  4BPG A;  1VQ6 P;  2L0Q A;  4U0B A;  3CCJ P;  4R0M A;  2X2B A;  1OR5 A;  4U0C A;  2NO8 A;  1M1K Q;  5F2K A;  4QNB A;  1VQ5 P;  3CPW O;  1EIA A;  2FVF A;  2JQ4 A;  3CD6 P;  5HGM A;  2JAZ A;  2LTE A;  5HGN A;  1IMP A;  1Q86 Q;  3G1G A;  1CEI A;  2JBG A;  4PXH B;  2K0D X;  2MF4 A;  1IMQ A;  7CEI A;  3DS4 A; 
#chains in the Genus database with same CATH homology
 4PWV B;  5HVC A;  5EJD A;  2JU2 A;  2K2Q A;  2KOQ A;  2KG8 A;  2AF8 A;  2FQ2 A;  2LML A;  1ACP A;  3GZL A;  2N98 A;  2FHS C;  2LIU A;  2K92 A;  2MVV A;  2KWL A;  2LPK A;  1KLP A;  4DG9 A;  2L4B A;  2KGC A;  2CNR A;  2N6Y A;  1F80 D;  2FVE A;  1HY8 A;  2K93 A;  4IZ6 A;  2N50 A;  4CA3 A;  2CGQ A;  2N5H A;  1AF8 A;  3EJB A;  5KP8 B;  2XZ0 D;  2GDY A;  2VSQ A;  2KGA A;  1L0I A;  1X3O A;  5KP7 B;  3GZM A;  2LIW A;  3LMO A;  2EHS A;  2KGE A;  2FVA A;  2AVA A;  2GDX A;  2QNW A;  5CZD B;  2KG9 A;  2CQ8 A;  2AFE A;  2N5I A;  5HV8 A;  2FAC A;  2N6Z A;  2PNG A;  4NEO A;  2KR5 A;  3CE7 A;  3EJD A;  1HQB A;  2LKI A;  2DNW A;  2KOS A;  2CG5 B;  3RG2 A;  2K0X A;  2K0Y A;  3NY7 B;  2EHT A;  2KOR A;  2FAD A;  1DNY A;  2MD9 A;  2MR8 A;  2KOO A;  2JU1 A;  4H2Y C;  2L9F A;  2LL8 A;  2JGP A;  4BPF A;  2ROQ A;  2AFD A;  2MVU A;  4BPH A;  1NQ4 A;  4BPG A;  2L0Q A;  4R0M A;  2X2B A;  1OR5 A;  2FAE A;  1L0H A;  2KW2 A;  2FQ1 A;  2K94 A;  2KGD A;  2FQ0 A;  1T8K A;  2GDW A;  4H2X C;  2FVF A;  2JQ4 A;  5KP6 B;  2LOL A;  2KG6 A;  2LTE A;  2KOP A;  2L22 A;  4MRT C;  3EJE A;  2XZ1 C;  1DV5 A;  4HKG A;  1VKU A;  2M5R A;  2MY5 A;  4H2W C;  2MR7 A;  4PXH B;  2MF4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...