2FQ0A

Solution structure of major conformation of holo-acyl carrier protein from malaria parasite plasmodium falciparum
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
79
structure length
79
Chain Sequence
LKSTFDDIKKIISKQLSVEEDKIQMNSNFTKDLGADSLDLVELIMALEEKFNVTISDQDALKINTVQDAIDYIEKNNKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords acyl carrier protein
publication title Solution structures of conformationally equilibrium forms of holo-acyl carrier protein (PfACP) from Plasmodium falciparum provides insight into the mechanism of activation of ACPs
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Lipid transport
total genus 18
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2006-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2fq0A00
5KP8B 2CGQA 4IZ6A 2KGDA 2KG9A 2KOPA 2LIUA 2MY5A 2LMLA 4MRTC 1HQBA 2AFEA 1T8KA 2LPKA 2DNWA 2KORA 1AF8A 2KW2A 2FADA 2N6ZA 2K0YA 3EJBA 4H2WC 2JQ4A 4HKGA 2XZ1C 2AFDA 2GDYA 4PWVB 3GZMA 4BPGA 1DV5A 2XZ0D 2AVAA 2GDXA 2KG8A 2N50A 2L9FA 2CNRA 2K93A 1KLPA 2MVVA 1L0HA 2L0QA 2ROQA 5EJDA 2K92A 2KGAA 5CZDB 1HY8A 1L0IA 2FQ1A 2FAEA 2EHTA 4H2YC 4PXHB 2JU2A 2MF4A 1ACPA 1OR5A 2LKIA 2LL8A 4BPFA 1VKUA 2JGPA 2N5IA 2LIWA 5HVCA 2FQ2A 3EJEA 2PNGA 3RG2A 2M5RA 2VSQA 2K94A 5KP6B 2AF8A 2FACA 4H2XC 2KGCA 1DNYA 2CQ8A 2K0XA 2KG6A 2KGEA 1F80D 2JU1A 2GDWA 2KR5A 2MD9A 3GZLA 4BPHA 1X3OA 1NQ4A 2KOOA 5KP7B 2LTEA 2EHSA 2N5HA 2L4BA 2FVAA 4NEOA 2X2BA 2MVUA 2MR8A 2N6YA 2KOSA 2FHSC 2KOQA 2MR7A 3LMOA 4CA3A 3EJDA 2L22A 4DG9A 2LOLA 2QNWA 3NY7B 2CG5B 2FVEA 5HV8A 4R0MA 2K2QA 2KWLA 2FQ0A 2N98A 2FVFA 3CE7A
chains in the Genus database with same CATH superfamily
4IZ6A 4COCA 2MY5A 1N8RQ 3G6EP 1ZMBA 5F2NA 3CCJP 4MRTC 1T8KA 2LPKA 3LRYA 4WYMA 1AF8A 2KW2A 2M8PA 3I56P 1IUQA 3CCMP 2GZFA 2EG5A 2GDXA 2L9FA 1K9MQ 5HGLA 1L0HA 1VQ4P 4U0FA 1VQNP 4H2YC 1VQ8P 2E1MA 2LKIA 2JGPA 2LIWA 1K8AQ 1YHQP 2KODA 2FQ2A 5BS2A 1A43A 1VQ5P 1QRJA 3RG2A 2K5XA 3I55P 2K94A 1QVFO 1A8OA 4H2XC 2FACA 2XT1A 2K0XA 5F2OA 1F80D 2KR5A 2GDWA 3GZLA 3VRLC 4BPHA 4COPA 3G21A 2JO0A 3CCLP 4XFYA 1VQ7P 2EHSA 3G1GA 2N5HA 1AUMA 5HGOA 2VLPA 1BXIA 4XFZA 2L4BA 4XFXA 2X2BA 1RO0A 1YJ9P 2KOSA 2KOQA 2MR7A 2L6EA 2P9XA 2BUOA 4XROA 3EJDA 4DG9A 2OTLP 2LOLA 2Z45A 2FQ0A 2N98A 1KC8Q 5KP8B 2WPTA 2KGDA 2GZJA 3GJNA 5DCKA 1BAJA 7CEIA 2PEMA 2N6ZA 3CXCO 2OTJP 4XRQA 3MGEA 4QNBA 4HKGA 4BPGA 2DGYA 1YITP 2N50A 1Q81Q 2K93A 1KLPA 3CC2P 1L0IA 3CMEP 2LL8A 1FR2A 1YJNP 2VLNA 3DS2A 3U43A 2PEJA 4UHPB 1NJIQ 1MZ8A 4M0IA 1E6JP 2JU1A 1ZNVA 2MD9A 3E2DA 1X3OA 3G1IA 2LF4A 2QEXP 1CEIA 3GKLC 1GXHA 2PEKA 4NEOA 3CCRP 2N6YA 1RNIA 3LMOA 4GR6A 1IMPA 3DPHA 3CPWO 2FVFA 1YJWP 3H4EA 2KOPA 2KG9A 4GR2A 1M90Q 1IMQA 2LMLA 2AFEA 2KORA 3G4SP 2K0YA 4U0CA 3EJBA 5F2KA 4H2WC 1VQKP 1K73Q 3CC7P 2XZ1C 2AFDA 2GDYA 2NO8A 5HGMA 1QVGO 3CCVP 2XZ0D 2AVAA 3B5IA 2KG8A 4F37A 1Z6MA 1VQ6P 1Q82Q 5CZDB 2KGAA 3P05A 1VQOP 2CWOA 2FQ1A 2EHTA 2PENA 4PXHB 1ACPA 1Q7YQ 5JPAA 3H47A 1EIAA 5HVCA 3EJEA 2JYLA 2JAZA 2PNGA 2M5RA 3DS4A 2VSQA 1JJ2O 2AF8A 3G28A 2KGCA 1W2BO 2KGEA 2PEQA 2JBGA 3DS1A 1VQLP 2M8NA 2ONTA 3CCQP 2KOOA 2JB0A 2VLOA 2LTEA 1Q86Q 1KD1Q 5HGNA 3HZQA 2MVUA 2MR8A 4U0AA 1GPJA 4CA3A 3DS3A 1YIJP 2L22A 2QNWA 1VQMP 1VQPP 5BS1A 2CG5B 2FVEA 3WBHA 2K2QA 4PH0A 2EFJA 2ERHA 2PY8A 1UNKA 2CGQA 2GZGA 4PH1A 2LIUA 2JYGA 1K30A 1M6EX 4QKOA 3CMAP 1EMVA 1AYIA 3CCEP 1HQBA 1VHNA 1UJZA 2Z44A 3NTEA 2DNWA 3CCUP 2FADA 1S72P 3G29A 2GZIA 2JQ4A 4PWVB 3GZMA 1D1DA 2BHVA 1M74A 1DV5A 3M1MA 2VLQA 3DTJA 3CCSP 2CNRA 2MVVA 2OARA 3B4QA 2L0QA 1KQSO 2ROQA 5EJDA 2K92A 1HY8A 4U0DA 2FAEA 3OW2O 4IPYA 3Q20A 2JU2A 2MF4A 1OR5A 4BPFA 1VKUA 3HYBA 2N5IA 2EIAA 3H0DA 3CC4P 5KP6B 1RO2A 1VQ9P 2GYKA 3RG6C 1M1KQ 2QA4P 2PEOA 1DNYA 2CQ8A 2GZEA 1EOQA 5EW5E 2KG6A 3DS5A 5I4TG 1GXGA 3G71P 2Z46A 1NQ4A 4U0BA 2XV6A 2K0DX 3G26A 3DS0A 5KP7B 2PEIA 2FVAA 1E0HA 4U0EA 2XXMA 1M6NA 3CD6P 1YI2P 2FHSC 3G0VA 3NY7B 5HV8A 4R0MA 2KWLA 2M8LA 3CE7A
chains in the Genus database with same CATH topology
5KP8B 2CGQA 4IZ6A 2KGDA 2KG9A 2KOPA 2LIUA 2MY5A 2LMLA 4MRTC 1HQBA 2AFEA 1T8KA 2LPKA 2DNWA 2KORA 1AF8A 2KW2A 2FADA 2N6ZA 2K0YA 3EJBA 4H2WC 2JQ4A 4HKGA 2XZ1C 2AFDA 2GDYA 4PWVB 3GZMA 4BPGA 1DV5A 2XZ0D 2AVAA 2GDXA 2KG8A 2N50A 2L9FA 2CNRA 2K93A 1KLPA 2MVVA 1L0HA 2L0QA 2ROQA 5EJDA 2K92A 2KGAA 5CZDB 1HY8A 1L0IA 2FQ1A 2FAEA 2EHTA 4H2YC 4PXHB 2JU2A 2MF4A 1ACPA 1OR5A 2LKIA 2LL8A 4BPFA 1VKUA 2JGPA 2N5IA 2LIWA 5HVCA 2FQ2A 3EJEA 2PNGA 3RG2A 2M5RA 2VSQA 2K94A 5KP6B 2AF8A 2FACA 4H2XC 2KGCA 1DNYA 2CQ8A 2K0XA 2KG6A 2KGEA 1F80D 2JU1A 2GDWA 2KR5A 2MD9A 3GZLA 4BPHA 1X3OA 1NQ4A 2KOOA 5KP7B 2LTEA 2EHSA 2N5HA 2L4BA 2FVAA 4NEOA 2X2BA 2MVUA 2MR8A 2N6YA 2KOSA 2FHSC 2KOQA 2MR7A 3LMOA 4CA3A 3EJDA 2L22A 4DG9A 2LOLA 2QNWA 3NY7B 2CG5B 2FVEA 5HV8A 4R0MA 2K2QA 2KWLA 2FQ0A 2N98A 2FVFA 3CE7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KP8 B;  2CGQ A;  4IZ6 A;  2KGD A;  2KG9 A;  2KOP A;  2LIU A;  2MY5 A;  2LML A;  4MRT C;  1HQB A;  2AFE A;  1T8K A;  2LPK A;  2DNW A;  2KOR A;  1AF8 A;  2KW2 A;  2FAD A;  2N6Z A;  2K0Y A;  3EJB A;  4H2W C;  2JQ4 A;  4HKG A;  2XZ1 C;  2AFD A;  2GDY A;  4PWV B;  3GZM A;  4BPG A;  1DV5 A;  2XZ0 D;  2AVA A;  2GDX A;  2KG8 A;  2N50 A;  2L9F A;  2CNR A;  2K93 A;  1KLP A;  2MVV A;  1L0H A;  2L0Q A;  2ROQ A;  5EJD A;  2K92 A;  2KGA A;  5CZD B;  1HY8 A;  1L0I A;  2FQ1 A;  2FAE A;  2EHT A;  4H2Y C;  4PXH B;  2JU2 A;  2MF4 A;  1ACP A;  1OR5 A;  2LKI A;  2LL8 A;  4BPF A;  1VKU A;  2JGP A;  2N5I A;  2LIW A;  5HVC A;  2FQ2 A;  3EJE A;  2PNG A;  3RG2 A;  2M5R A;  2VSQ A;  2K94 A;  5KP6 B;  2AF8 A;  2FAC A;  4H2X C;  2KGC A;  1DNY A;  2CQ8 A;  2K0X A;  2KG6 A;  2KGE A;  1F80 D;  2JU1 A;  2GDW A;  2KR5 A;  2MD9 A;  3GZL A;  4BPH A;  1X3O A;  1NQ4 A;  2KOO A;  5KP7 B;  2LTE A;  2EHS A;  2N5H A;  2L4B A;  2FVA A;  4NEO A;  2X2B A;  2MVU A;  2MR8 A;  2N6Y A;  2KOS A;  2FHS C;  2KOQ A;  2MR7 A;  3LMO A;  4CA3 A;  3EJD A;  2L22 A;  4DG9 A;  2LOL A;  2QNW A;  3NY7 B;  2CG5 B;  2FVE A;  5HV8 A;  4R0M A;  2K2Q A;  2KWL A;  2FQ0 A;  2N98 A;  2FVF A;  3CE7 A; 
#chains in the Genus database with same CATH topology
 4IZ6 A;  4COC A;  2MY5 A;  1N8R Q;  3G6E P;  1ZMB A;  5F2N A;  3CCJ P;  4MRT C;  1T8K A;  2LPK A;  3LRY A;  4WYM A;  1AF8 A;  2KW2 A;  2M8P A;  3I56 P;  1IUQ A;  3CCM P;  2GZF A;  2EG5 A;  2GDX A;  2L9F A;  1K9M Q;  5HGL A;  1L0H A;  1VQ4 P;  4U0F A;  1VQN P;  4H2Y C;  1VQ8 P;  2E1M A;  2LKI A;  2JGP A;  2LIW A;  1K8A Q;  1YHQ P;  2KOD A;  2FQ2 A;  5BS2 A;  1A43 A;  1VQ5 P;  1QRJ A;  3RG2 A;  2K5X A;  3I55 P;  2K94 A;  1QVF O;  1A8O A;  4H2X C;  2FAC A;  2XT1 A;  2K0X A;  5F2O A;  1F80 D;  2KR5 A;  2GDW A;  3GZL A;  3VRL C;  4BPH A;  4COP A;  3G21 A;  2JO0 A;  3CCL P;  4XFY A;  1VQ7 P;  2EHS A;  3G1G A;  2N5H A;  1AUM A;  5HGO A;  2VLP A;  1BXI A;  4XFZ A;  2L4B A;  4XFX A;  2X2B A;  1RO0 A;  1YJ9 P;  2KOS A;  2KOQ A;  2MR7 A;  2L6E A;  2P9X A;  2BUO A;  4XRO A;  3EJD A;  4DG9 A;  2OTL P;  2LOL A;  2Z45 A;  2FQ0 A;  2N98 A;  1KC8 Q;  5KP8 B;  2WPT A;  2KGD A;  2GZJ A;  3GJN A;  5DCK A;  1BAJ A;  7CEI A;  2PEM A;  2N6Z A;  3CXC O;  2OTJ P;  4XRQ A;  3MGE A;  4QNB A;  4HKG A;  4BPG A;  2DGY A;  1YIT P;  2N50 A;  1Q81 Q;  2K93 A;  1KLP A;  3CC2 P;  1L0I A;  3CME P;  2LL8 A;  1FR2 A;  1YJN P;  2VLN A;  3DS2 A;  3U43 A;  2PEJ A;  4UHP B;  1NJI Q;  1MZ8 A;  4M0I A;  1E6J P;  2JU1 A;  1ZNV A;  2MD9 A;  3E2D A;  1X3O A;  3G1I A;  2LF4 A;  2QEX P;  1CEI A;  3GKL C;  1GXH A;  2PEK A;  4NEO A;  3CCR P;  2N6Y A;  1RNI A;  3LMO A;  4GR6 A;  1IMP A;  3DPH A;  3CPW O;  2FVF A;  1YJW P;  3H4E A;  2KOP A;  2KG9 A;  4GR2 A;  1M90 Q;  1IMQ A;  2LML A;  2AFE A;  2KOR A;  3G4S P;  2K0Y A;  4U0C A;  3EJB A;  5F2K A;  4H2W C;  1VQK P;  1K73 Q;  3CC7 P;  2XZ1 C;  2AFD A;  2GDY A;  2NO8 A;  5HGM A;  1QVG O;  3CCV P;  2XZ0 D;  2AVA A;  3B5I A;  2KG8 A;  4F37 A;  1Z6M A;  1VQ6 P;  1Q82 Q;  5CZD B;  2KGA A;  3P05 A;  1VQO P;  2CWO A;  2FQ1 A;  2EHT A;  2PEN A;  4PXH B;  1ACP A;  1Q7Y Q;  5JPA A;  3H47 A;  1EIA A;  5HVC A;  3EJE A;  2JYL A;  2JAZ A;  2PNG A;  2M5R A;  3DS4 A;  2VSQ A;  1JJ2 O;  2AF8 A;  3G28 A;  2KGC A;  1W2B O;  2KGE A;  2PEQ A;  2JBG A;  3DS1 A;  1VQL P;  2M8N A;  2ONT A;  3CCQ P;  2KOO A;  2JB0 A;  2VLO A;  2LTE A;  1Q86 Q;  1KD1 Q;  5HGN A;  3HZQ A;  2MVU A;  2MR8 A;  4U0A A;  1GPJ A;  4CA3 A;  3DS3 A;  1YIJ P;  2L22 A;  2QNW A;  1VQM P;  1VQP P;  5BS1 A;  2CG5 B;  2FVE A;  3WBH A;  2K2Q A;  4PH0 A;  2EFJ A;  2ERH A;  2PY8 A;  1UNK A;  2CGQ A;  2GZG A;  4PH1 A;  2LIU A;  2JYG A;  1K30 A;  1M6E X;  4QKO A;  3CMA P;  1EMV A;  1AYI A;  3CCE P;  1HQB A;  1VHN A;  1UJZ A;  2Z44 A;  3NTE A;  2DNW A;  3CCU P;  2FAD A;  1S72 P;  3G29 A;  2GZI A;  2JQ4 A;  4PWV B;  3GZM A;  1D1D A;  2BHV A;  1M74 A;  1DV5 A;  3M1M A;  2VLQ A;  3DTJ A;  3CCS P;  2CNR A;  2MVV A;  2OAR A;  3B4Q A;  2L0Q A;  1KQS O;  2ROQ A;  5EJD A;  2K92 A;  1HY8 A;  4U0D A;  2FAE A;  3OW2 O;  4IPY A;  3Q20 A;  2JU2 A;  2MF4 A;  1OR5 A;  4BPF A;  1VKU A;  3HYB A;  2N5I A;  2EIA A;  3H0D A;  3CC4 P;  5KP6 B;  1RO2 A;  1VQ9 P;  2GYK A;  3RG6 C;  1M1K Q;  2QA4 P;  2PEO A;  1DNY A;  2CQ8 A;  2GZE A;  1EOQ A;  5EW5 E;  2KG6 A;  3DS5 A;  5I4T G;  1GXG A;  3G71 P;  2Z46 A;  1NQ4 A;  4U0B A;  2XV6 A;  2K0D X;  3G26 A;  3DS0 A;  5KP7 B;  2PEI A;  2FVA A;  1E0H A;  4U0E A;  2XXM A;  1M6N A;  3CD6 P;  1YI2 P;  2FHS C;  3G0V A;  3NY7 B;  5HV8 A;  4R0M A;  2KWL A;  2M8L A;  3CE7 A; 
#chains in the Genus database with same CATH homology
 5KP8 B;  2CGQ A;  4IZ6 A;  2KGD A;  2KG9 A;  2KOP A;  2LIU A;  2MY5 A;  2LML A;  4MRT C;  1HQB A;  2AFE A;  1T8K A;  2LPK A;  2DNW A;  2KOR A;  1AF8 A;  2KW2 A;  2FAD A;  2N6Z A;  2K0Y A;  3EJB A;  4H2W C;  2JQ4 A;  4HKG A;  2XZ1 C;  2AFD A;  2GDY A;  4PWV B;  3GZM A;  4BPG A;  1DV5 A;  2XZ0 D;  2AVA A;  2GDX A;  2KG8 A;  2N50 A;  2L9F A;  2CNR A;  2K93 A;  1KLP A;  2MVV A;  1L0H A;  2L0Q A;  2ROQ A;  5EJD A;  2K92 A;  2KGA A;  5CZD B;  1HY8 A;  1L0I A;  2FQ1 A;  2FAE A;  2EHT A;  4H2Y C;  4PXH B;  2JU2 A;  2MF4 A;  1ACP A;  1OR5 A;  2LKI A;  2LL8 A;  4BPF A;  1VKU A;  2JGP A;  2N5I A;  2LIW A;  5HVC A;  2FQ2 A;  3EJE A;  2PNG A;  3RG2 A;  2M5R A;  2VSQ A;  2K94 A;  5KP6 B;  2AF8 A;  2FAC A;  4H2X C;  2KGC A;  1DNY A;  2CQ8 A;  2K0X A;  2KG6 A;  2KGE A;  1F80 D;  2JU1 A;  2GDW A;  2KR5 A;  2MD9 A;  3GZL A;  4BPH A;  1X3O A;  1NQ4 A;  2KOO A;  5KP7 B;  2LTE A;  2EHS A;  2N5H A;  2L4B A;  2FVA A;  4NEO A;  2X2B A;  2MVU A;  2MR8 A;  2N6Y A;  2KOS A;  2FHS C;  2KOQ A;  2MR7 A;  3LMO A;  4CA3 A;  3EJD A;  2L22 A;  4DG9 A;  2LOL A;  2QNW A;  3NY7 B;  2CG5 B;  2FVE A;  5HV8 A;  4R0M A;  2K2Q A;  2KWL A;  2FQ0 A;  2N98 A;  2FVF A;  3CE7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...