2FQ0A

Solution structure of major conformation of holo-acyl carrier protein from malaria parasite plasmodium falciparum
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
79
structure length
79
Chain Sequence
LKSTFDDIKKIISKQLSVEEDKIQMNSNFTKDLGADSLDLVELIMALEEKFNVTISDQDALKINTVQDAIDYIEKNNKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lipid transport
molecule keywords acyl carrier protein
publication title Solution structures of conformationally equilibrium forms of holo-acyl carrier protein (PfACP) from Plasmodium falciparum provides insight into the mechanism of activation of ACPs
pubmed doi rcsb
source organism Plasmodium falciparum
total genus 18
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2006-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2fq0A00
2DNWA 2JU1A 1DNYA 2FQ1A 2AVAA 2LKIA 2L0QA 3EJEA 2KG8A 3RG2A 4H2WC 2KR5A 1T8KA 4DG9A 2N6ZA 2K0XA 2MF4A 2X2BA 4MRTC 2FHSC 2ROQA 2AFEA 2LMLA 2LL8A 3EJBA 2KGEA 2JQ4A 2FAEA 1L0HA 1AF8A 1NQ4A 2L22A 2MVVA 1L0IA 4PWVB 3EJDA 4CA3A 5KP8B 1DV5A 2K94A 4IZ6A 2XZ0D 2LPKA 2KGDA 5CZDB 2XZ1C 2AFDA 1F80D 2KW2A 2FQ0A 2K93A 4PXHB 2KOQA 2QNWA 2GDXA 5KP7B 2FACA 2KG9A 1VKUA 4R0MA 2KWLA 2LIWA 2MD9A 2K0YA 2MY5A 2N98A 2FVEA 2KG6A 4BPGA 2GDYA 5HV8A 4BPHA 2N5IA 1ACPA 2GDWA 2CQ8A 3LMOA 2KOSA 2JU2A 2M5RA 2N5HA 4H2XC 5HVCA 1HQBA 2PNGA 2MVUA 2FADA 2CG5B 2FVAA 2VSQA 2AF8A 2EHSA 2KORA 2FVFA 3GZMA 2CGQA 2K92A 3CE7A 1X3OA 5EJDA 1HY8A 2LIUA 2K2QA 4H2YC 2N6YA 4BPFA 5KP6B 2EHTA 2FQ2A 2MR7A 1OR5A 2JGPA 4HKGA 2KGAA 2KOOA 2N50A 2L4BA 3NY7B 2KOPA 2CNRA 2KGCA 2LTEA 4NEOA 2LOLA 2L9FA 1KLPA 2MR8A 3GZLA
chains in the Genus database with same CATH superfamily
1DNYA 2FQ1A 1NJIQ 1VQNP 2KG8A 1K8AQ 2KR5A 1T8KA 1VQLP 1VQ9P 4U0AA 1M6NA 3E2DA 2M8PA 2MF4A 2X2BA 2LMLA 4U0DA 2LL8A 1Q86Q 1VQ4P 2GZGA 2MVVA 3EJDA 4CA3A 3G71P 1YITP 4IZ6A 2XZ0D 3DS0A 4U0EA 1AUMA 2XZ1C 1EIAA 2KW2A 2FQ0A 2OTJP 4PXHB 1IMPA 3OW2O 1W2BO 1RO0A 1VQMP 3CC7P 5HGNA 2OTLP 2PEJA 2LIWA 3DS4A 2MD9A 3CCSP 2JYLA 2N98A 3H4EA 4BPGA 1BXIA 4BPHA 2CWOA 1RNIA 3RG6C 2EG5A 1ACPA 3Q20A 1D1DA 2L6EA 3M1MA 3G1GA 2LF4A 1M90Q 1KC8Q 3HZQA 4U0BA 1HY8A 2JGPA 2ONTA 2PENA 2KGAA 3DS2A 1M1KQ 2N50A 1KD1Q 2KGCA 4NEOA 1K73Q 1UNKA 2L9FA 1YI2P 3H47A 1E0HA 3B5IA 3G0VA 2M8NA 2L0QA 4PH0A 3RG2A 4U0CA 2GZEA 4UHPB 2K0XA 3CCQP 2FHSC 3CMAP 3CCRP 2FAEA 2KGEA 4F37A 1L0HA 4COCA 2GYKA 3CC4P 2L22A 2JO0A 4GR2A 4PWVB 3LRYA 1Q81Q 5KP8B 2JAZA 4XROA 2K94A 2JYGA 1F80D 2K93A 3NTEA 2OARA 3CCVP 1EMVA 2GDXA 4GR6A 1Q7YQ 2FACA 1VKUA 4R0MA 1JJ2O 2MY5A 1ZNVA 3DS5A 2GDWA 2JU2A 3G21A 2M5RA 2E1MA 2N5HA 4M0IA 4H2XC 2PY8A 1VQ8P 1YJ9P 2MVUA 2FADA 1QVGO 2VLQA 2VLPA 2CGQA 1IUQA 1A8OA 3I55P 1X3OA 2DGYA 2Z45A 5EJDA 3CCEP 4H2YC 2N6YA 4PH1A 1OR5A 4HKGA 2KOOA 3P05A 2BUOA 2L4BA 3CMEP 3NY7B 4U0FA 3G4SP 2CNRA 5HGOA 2JB0A 3B4QA 2K0DX 2LTEA 2LOLA 1VQPP 2MR8A 4QKOA 3G29A 1Q82Q 2P9XA 2JU1A 1GXHA 5HGLA 5F2NA 1CEIA 3G1IA 2Z44A 3GJNA 4H2WC 3G6EP 5DCKA 1UJZA 4MRTC 2AFEA 3EJBA 2JQ4A 1NQ4A 1L0IA 1AYIA 1QVFO 4QNBA 4XFXA 1DV5A 3DPHA 3CCMP 2LPKA 5CZDB 3WBHA 2QNWA 1FR2A 1YJWP 2PEMA 2VLOA 5HGMA 5KP7B 3CC2P 2KG6A 5HV8A 1YHQP 2N5IA 2K5XA 1VQ7P 5EW5E 2CQ8A 3LMOA 2PEIA 2KOSA 1YJNP 1GPJA 2PEKA 2Z46A 5HVCA 1HQBA 3I56P 2PNGA 1YIJP 2CG5B 1A43A 1E6JP 2AF8A 3GZMA 3G26A 1IMQA 3CE7A 2M8LA 3CCJP 4BPFA 5KP6B 2EHTA 1EOQA 2MR7A 2QA4P 1N8RQ 3DS3A 1M6EX 3HYBA 3U43A 3VRLC 1KLPA 3CCLP 2DNWA 1VQOP 1MZ8A 3DTJA 2AVAA 2LKIA 2KODA 1VQKP 1K9MQ 2VLNA 3EJEA 4XFZA 2EIAA 2GZFA 2XV6A 4DG9A 2N6ZA 4XRQA 1GXGA 5F2OA 2ROQA 1AF8A 2NO8A 2PEQA 2PEOA 2XXMA 1ZMBA 3G28A 2BHVA 1M74A 1Z6MA 2ERHA 4COPA 3H0DA 3CCUP 4WYMA 2KGDA 3DS1A 1VQ5P 2AFDA 4IPYA 2KOQA 2GZIA 3CPWO 4XFYA 1QRJA 2KG9A 2KWLA 2K0YA 7CEIA 2FVEA 3CD6P 2GDYA 1S72P 2GZJA 2QEXP 3GKLC 2JBGA 1K30A 3GZLA 1VHNA 2FVAA 2VSQA 1BAJA 2EHSA 2KORA 2FVFA 2K92A 3MGEA 2EFJA 2WPTA 2LIUA 2K2QA 1VQ6P 5F2KA 2FQ2A 5BS1A 5BS2A 2KOPA 5I4TG 2XT1A 5JPAA 1KQSO 1RO2A 3CXCO
chains in the Genus database with same CATH topology
2DNWA 2JU1A 1DNYA 2FQ1A 2AVAA 2LKIA 2L0QA 3EJEA 2KG8A 3RG2A 4H2WC 2KR5A 1T8KA 4DG9A 2N6ZA 2K0XA 2MF4A 2X2BA 4MRTC 2FHSC 2ROQA 2AFEA 2LMLA 2LL8A 3EJBA 2KGEA 2JQ4A 2FAEA 1L0HA 1AF8A 1NQ4A 2L22A 2MVVA 1L0IA 4PWVB 3EJDA 4CA3A 5KP8B 1DV5A 2K94A 4IZ6A 2XZ0D 2LPKA 2KGDA 5CZDB 2XZ1C 2AFDA 1F80D 2KW2A 2FQ0A 2K93A 4PXHB 2KOQA 2QNWA 2GDXA 5KP7B 2FACA 2KG9A 1VKUA 4R0MA 2KWLA 2LIWA 2MD9A 2K0YA 2MY5A 2N98A 2FVEA 2KG6A 4BPGA 2GDYA 5HV8A 4BPHA 2N5IA 1ACPA 2GDWA 2CQ8A 3LMOA 2KOSA 2JU2A 2M5RA 2N5HA 4H2XC 5HVCA 1HQBA 2PNGA 2MVUA 2FADA 2CG5B 2FVAA 2VSQA 2AF8A 2EHSA 2KORA 2FVFA 3GZMA 2CGQA 2K92A 3CE7A 1X3OA 5EJDA 1HY8A 2LIUA 2K2QA 4H2YC 2N6YA 4BPFA 5KP6B 2EHTA 2FQ2A 2MR7A 1OR5A 2JGPA 4HKGA 2KGAA 2KOOA 2N50A 2L4BA 3NY7B 2KOPA 2CNRA 2KGCA 2LTEA 4NEOA 2LOLA 2L9FA 1KLPA 2MR8A 3GZLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DNW A;  2JU1 A;  1DNY A;  2FQ1 A;  2AVA A;  2LKI A;  2L0Q A;  3EJE A;  2KG8 A;  3RG2 A;  4H2W C;  2KR5 A;  1T8K A;  4DG9 A;  2N6Z A;  2K0X A;  2MF4 A;  2X2B A;  4MRT C;  2FHS C;  2ROQ A;  2AFE A;  2LML A;  2LL8 A;  3EJB A;  2KGE A;  2JQ4 A;  2FAE A;  1L0H A;  1AF8 A;  1NQ4 A;  2L22 A;  2MVV A;  1L0I A;  4PWV B;  3EJD A;  4CA3 A;  5KP8 B;  1DV5 A;  2K94 A;  4IZ6 A;  2XZ0 D;  2LPK A;  2KGD A;  5CZD B;  2XZ1 C;  2AFD A;  1F80 D;  2KW2 A;  2FQ0 A;  2K93 A;  4PXH B;  2KOQ A;  2QNW A;  2GDX A;  5KP7 B;  2FAC A;  2KG9 A;  1VKU A;  4R0M A;  2KWL A;  2LIW A;  2MD9 A;  2K0Y A;  2MY5 A;  2N98 A;  2FVE A;  2KG6 A;  4BPG A;  2GDY A;  5HV8 A;  4BPH A;  2N5I A;  1ACP A;  2GDW A;  2CQ8 A;  3LMO A;  2KOS A;  2JU2 A;  2M5R A;  2N5H A;  4H2X C;  5HVC A;  1HQB A;  2PNG A;  2MVU A;  2FAD A;  2CG5 B;  2FVA A;  2VSQ A;  2AF8 A;  2EHS A;  2KOR A;  2FVF A;  3GZM A;  2CGQ A;  2K92 A;  3CE7 A;  1X3O A;  5EJD A;  1HY8 A;  2LIU A;  2K2Q A;  4H2Y C;  2N6Y A;  4BPF A;  5KP6 B;  2EHT A;  2FQ2 A;  2MR7 A;  1OR5 A;  2JGP A;  4HKG A;  2KGA A;  2KOO A;  2N50 A;  2L4B A;  3NY7 B;  2KOP A;  2CNR A;  2KGC A;  2LTE A;  4NEO A;  2LOL A;  2L9F A;  1KLP A;  2MR8 A;  3GZL A; 
#chains in the Genus database with same CATH topology
 1DNY A;  2FQ1 A;  1NJI Q;  1VQN P;  2KG8 A;  1K8A Q;  2KR5 A;  1T8K A;  1VQL P;  1VQ9 P;  4U0A A;  1M6N A;  3E2D A;  2M8P A;  2MF4 A;  2X2B A;  2LML A;  4U0D A;  2LL8 A;  1Q86 Q;  1VQ4 P;  2GZG A;  2MVV A;  3EJD A;  4CA3 A;  3G71 P;  1YIT P;  4IZ6 A;  2XZ0 D;  3DS0 A;  4U0E A;  1AUM A;  2XZ1 C;  1EIA A;  2KW2 A;  2FQ0 A;  2OTJ P;  4PXH B;  1IMP A;  3OW2 O;  1W2B O;  1RO0 A;  1VQM P;  3CC7 P;  5HGN A;  2OTL P;  2PEJ A;  2LIW A;  3DS4 A;  2MD9 A;  3CCS P;  2JYL A;  2N98 A;  3H4E A;  4BPG A;  1BXI A;  4BPH A;  2CWO A;  1RNI A;  3RG6 C;  2EG5 A;  1ACP A;  3Q20 A;  1D1D A;  2L6E A;  3M1M A;  3G1G A;  2LF4 A;  1M90 Q;  1KC8 Q;  3HZQ A;  4U0B A;  1HY8 A;  2JGP A;  2ONT A;  2PEN A;  2KGA A;  3DS2 A;  1M1K Q;  2N50 A;  1KD1 Q;  2KGC A;  4NEO A;  1K73 Q;  1UNK A;  2L9F A;  1YI2 P;  3H47 A;  1E0H A;  3B5I A;  3G0V A;  2M8N A;  2L0Q A;  4PH0 A;  3RG2 A;  4U0C A;  2GZE A;  4UHP B;  2K0X A;  3CCQ P;  2FHS C;  3CMA P;  3CCR P;  2FAE A;  2KGE A;  4F37 A;  1L0H A;  4COC A;  2GYK A;  3CC4 P;  2L22 A;  2JO0 A;  4GR2 A;  4PWV B;  3LRY A;  1Q81 Q;  5KP8 B;  2JAZ A;  4XRO A;  2K94 A;  2JYG A;  1F80 D;  2K93 A;  3NTE A;  2OAR A;  3CCV P;  1EMV A;  2GDX A;  4GR6 A;  1Q7Y Q;  2FAC A;  1VKU A;  4R0M A;  1JJ2 O;  2MY5 A;  1ZNV A;  3DS5 A;  2GDW A;  2JU2 A;  3G21 A;  2M5R A;  2E1M A;  2N5H A;  4M0I A;  4H2X C;  2PY8 A;  1VQ8 P;  1YJ9 P;  2MVU A;  2FAD A;  1QVG O;  2VLQ A;  2VLP A;  2CGQ A;  1IUQ A;  1A8O A;  3I55 P;  1X3O A;  2DGY A;  2Z45 A;  5EJD A;  3CCE P;  4H2Y C;  2N6Y A;  4PH1 A;  1OR5 A;  4HKG A;  2KOO A;  3P05 A;  2BUO A;  2L4B A;  3CME P;  3NY7 B;  4U0F A;  3G4S P;  2CNR A;  5HGO A;  2JB0 A;  3B4Q A;  2K0D X;  2LTE A;  2LOL A;  1VQP P;  2MR8 A;  4QKO A;  3G29 A;  1Q82 Q;  2P9X A;  2JU1 A;  1GXH A;  5HGL A;  5F2N A;  1CEI A;  3G1I A;  2Z44 A;  3GJN A;  4H2W C;  3G6E P;  5DCK A;  1UJZ A;  4MRT C;  2AFE A;  3EJB A;  2JQ4 A;  1NQ4 A;  1L0I A;  1AYI A;  1QVF O;  4QNB A;  4XFX A;  1DV5 A;  3DPH A;  3CCM P;  2LPK A;  5CZD B;  3WBH A;  2QNW A;  1FR2 A;  1YJW P;  2PEM A;  2VLO A;  5HGM A;  5KP7 B;  3CC2 P;  2KG6 A;  5HV8 A;  1YHQ P;  2N5I A;  2K5X A;  1VQ7 P;  5EW5 E;  2CQ8 A;  3LMO A;  2PEI A;  2KOS A;  1YJN P;  1GPJ A;  2PEK A;  2Z46 A;  5HVC A;  1HQB A;  3I56 P;  2PNG A;  1YIJ P;  2CG5 B;  1A43 A;  1E6J P;  2AF8 A;  3GZM A;  3G26 A;  1IMQ A;  3CE7 A;  2M8L A;  3CCJ P;  4BPF A;  5KP6 B;  2EHT A;  1EOQ A;  2MR7 A;  2QA4 P;  1N8R Q;  3DS3 A;  1M6E X;  3HYB A;  3U43 A;  3VRL C;  1KLP A;  3CCL P;  2DNW A;  1VQO P;  1MZ8 A;  3DTJ A;  2AVA A;  2LKI A;  2KOD A;  1VQK P;  1K9M Q;  2VLN A;  3EJE A;  4XFZ A;  2EIA A;  2GZF A;  2XV6 A;  4DG9 A;  2N6Z A;  4XRQ A;  1GXG A;  5F2O A;  2ROQ A;  1AF8 A;  2NO8 A;  2PEQ A;  2PEO A;  2XXM A;  1ZMB A;  3G28 A;  2BHV A;  1M74 A;  1Z6M A;  2ERH A;  4COP A;  3H0D A;  3CCU P;  4WYM A;  2KGD A;  3DS1 A;  1VQ5 P;  2AFD A;  4IPY A;  2KOQ A;  2GZI A;  3CPW O;  4XFY A;  1QRJ A;  2KG9 A;  2KWL A;  2K0Y A;  7CEI A;  2FVE A;  3CD6 P;  2GDY A;  1S72 P;  2GZJ A;  2QEX P;  3GKL C;  2JBG A;  1K30 A;  3GZL A;  1VHN A;  2FVA A;  2VSQ A;  1BAJ A;  2EHS A;  2KOR A;  2FVF A;  2K92 A;  3MGE A;  2EFJ A;  2WPT A;  2LIU A;  2K2Q A;  1VQ6 P;  5F2K A;  2FQ2 A;  5BS1 A;  5BS2 A;  2KOP A;  5I4T G;  2XT1 A;  5JPA A;  1KQS O;  1RO2 A;  3CXC O; 
#chains in the Genus database with same CATH homology
 2DNW A;  2JU1 A;  1DNY A;  2FQ1 A;  2AVA A;  2LKI A;  2L0Q A;  3EJE A;  2KG8 A;  3RG2 A;  4H2W C;  2KR5 A;  1T8K A;  4DG9 A;  2N6Z A;  2K0X A;  2MF4 A;  2X2B A;  4MRT C;  2FHS C;  2ROQ A;  2AFE A;  2LML A;  2LL8 A;  3EJB A;  2KGE A;  2JQ4 A;  2FAE A;  1L0H A;  1AF8 A;  1NQ4 A;  2L22 A;  2MVV A;  1L0I A;  4PWV B;  3EJD A;  4CA3 A;  5KP8 B;  1DV5 A;  2K94 A;  4IZ6 A;  2XZ0 D;  2LPK A;  2KGD A;  5CZD B;  2XZ1 C;  2AFD A;  1F80 D;  2KW2 A;  2FQ0 A;  2K93 A;  4PXH B;  2KOQ A;  2QNW A;  2GDX A;  5KP7 B;  2FAC A;  2KG9 A;  1VKU A;  4R0M A;  2KWL A;  2LIW A;  2MD9 A;  2K0Y A;  2MY5 A;  2N98 A;  2FVE A;  2KG6 A;  4BPG A;  2GDY A;  5HV8 A;  4BPH A;  2N5I A;  1ACP A;  2GDW A;  2CQ8 A;  3LMO A;  2KOS A;  2JU2 A;  2M5R A;  2N5H A;  4H2X C;  5HVC A;  1HQB A;  2PNG A;  2MVU A;  2FAD A;  2CG5 B;  2FVA A;  2VSQ A;  2AF8 A;  2EHS A;  2KOR A;  2FVF A;  3GZM A;  2CGQ A;  2K92 A;  3CE7 A;  1X3O A;  5EJD A;  1HY8 A;  2LIU A;  2K2Q A;  4H2Y C;  2N6Y A;  4BPF A;  5KP6 B;  2EHT A;  2FQ2 A;  2MR7 A;  1OR5 A;  2JGP A;  4HKG A;  2KGA A;  2KOO A;  2N50 A;  2L4B A;  3NY7 B;  2KOP A;  2CNR A;  2KGC A;  2LTE A;  4NEO A;  2LOL A;  2L9F A;  1KLP A;  2MR8 A;  3GZL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...