2FQ0A

Solution structure of major conformation of holo-acyl carrier protein from malaria parasite plasmodium falciparum
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
79
structure length
79
Chain Sequence
LKSTFDDIKKIISKQLSVEEDKIQMNSNFTKDLGADSLDLVELIMALEEKFNVTISDQDALKINTVQDAIDYIEKNNKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords acyl carrier protein
publication title Solution structures of conformationally equilibrium forms of holo-acyl carrier protein (PfACP) from Plasmodium falciparum provides insight into the mechanism of activation of ACPs
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Lipid transport
total genus 18
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2006-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2fq0A00
4PWVB 2KOPA 2XZ1C 2L4BA 3GZLA 3RG2A 2FQ1A 2KOQA 2JGPA 2N5HA 2FADA 3LMOA 2EHTA 2KW2A 2KG8A 2KORA 4H2YC 2LIUA 1F80D 2KG6A 2MR7A 5CZDB 2FQ0A 2JU2A 2GDYA 3EJBA 4BPFA 4R0MA 3EJDA 3NY7B 1ACPA 1DNYA 2KR5A 2N5IA 1VKUA 2MVUA 2FAEA 2FVFA 2LIWA 2FACA 1NQ4A 2CQ8A 2LL8A 2KGDA 2M5RA 2AFEA 2K0XA 2PNGA 2KWLA 1OR5A 2LOLA 2N50A 2KG9A 2MD9A 2KOSA 4BPGA 2XZ0D 4NEOA 5HV8A 2K0YA 2FVEA 4BPHA 2FHSC 2CNRA 4DG9A 1L0IA 2MY5A 2DNWA 2JQ4A 5KP7B 2AF8A 2KGEA 2N6ZA 4HKGA 2FQ2A 2CG5B 2X2BA 2GDWA 3EJEA 2ROQA 2K94A 4H2WC 2K93A 1DV5A 5KP8B 2L22A 5KP6B 1KLPA 2AFDA 2L0QA 1AF8A 4MRTC 5EJDA 2K2QA 2KOOA 2MR8A 2QNWA 1HY8A 3CE7A 3GZMA 2KGAA 2GDXA 4PXHB 5HVCA 2N6YA 2LTEA 2CGQA 2KGCA 2JU1A 2L9FA 2FVAA 2LMLA 1T8KA 1HQBA 2AVAA 2K92A 4CA3A 2N98A 2MVVA 2EHSA 2LKIA 4IZ6A 2MF4A 1X3OA 2VSQA 2LPKA 4H2XC 1L0HA
chains in the Genus database with same CATH superfamily
2QEXP 3GZLA 2FQ1A 4U0FA 4F37A 2PEMA 1A8OA 3G0VA 1VQ6P 4XFZA 1A43A 2E1MA 2KG6A 2JAZA 2FQ0A 3OW2O 2GDYA 1M6EX 3DS5A 5F2OA 1FR2A 3HYBA 2LIWA 1YJNP 1K9MQ 3WBHA 2KWLA 1OR5A 1QVFO 2KG9A 2XZ0D 5HV8A 2FHSC 3H4EA 4U0EA 2GZJA 2P9XA 2DNWA 2JQ4A 5KP7B 2N6ZA 4HKGA 5F2NA 2FQ2A 1GXGA 4PH0A 1UNKA 2K93A 2GZIA 2EG5A 3DS4A 1KLPA 2L0QA 2DGYA 5EJDA 3VRLC 2KOOA 1RNIA 2PEIA 4GR2A 1VQNP 1NJIQ 2PEJA 3HZQA 4PXHB 1YITP 1EOQA 1W2BO 1ZMBA 2GZFA 1Z6MA 2KODA 2L9FA 2LMLA 1HQBA 2AVAA 5BS2A 2JBGA 4CA3A 2N98A 3G26A 4IZ6A 2MF4A 2VSQA 1IUQA 3G28A 3CCLP 2KOPA 2KOQA 2N5HA 2FADA 3G4SP 2EHTA 2K5XA 5EW5E 2M8PA 3CC7P 2KW2A 1CEIA 2VLPA 1F80D 3CCVP 1M1KQ 5HGNA 1D1DA 2JU2A 4BPFA 3EJDA 2M8LA 2MVUA 4COPA 3CMAP 2FVFA 1NQ4A 2CQ8A 3CC4P 1RO0A 2LL8A 1VQ4P 2OTLP 4XRQA 2MD9A 4BPGA 3MGEA 1YHQP 2FVEA 1KD1Q 4BPHA 4COCA 3CCSP 1L0IA 3G29A 2AF8A 1Q86Q 1JJ2O 2PY8A 3EJEA 1E0HA 2GYKA 5JPAA 2NO8A 1QVGO 1MZ8A 3P05A 2L22A 5KP6B 5DCKA 3I55P 4QNBA 1N8RQ 1AF8A 4MRTC 2K2QA 1UJZA 3DS3A 2QNWA 3CE7A 1GXHA 5F2KA 3GZMA 2KGAA 3G21A 3CMEP 2OARA 3DS2A 5HVCA 1YIJP 2N6YA 2CGQA 2XT1A 2BHVA 1S72P 3CCRP 4XROA 4U0BA 1YI2P 2Z44A 2EHSA 2JO0A 1VQMP 2LPKA 1L0HA 4PWVB 1IMPA 2XV6A 1KQSO 2XZ1C 3RG2A 1VQKP 3M1MA 3E2DA 1VQ8P 2KG8A 1YJ9P 2KORA 2JB0A 4H2YC 1VQPP 4QKOA 2VLNA 2MR7A 2LF4A 3DS0A 5I4TG 2M8NA 1DNYA 2KR5A 2N5IA 1VKUA 4XFYA 3CXCO 2FAEA 5HGLA 1K30A 1AYIA 2L6EA 2AFEA 2PNGA 4U0CA 3CD6P 1M6NA 3B5IA 3DS1A 3U43A 4NEOA 2EFJA 1EMVA 2K0YA 2GZEA 2GZGA 1Q81Q 1VQ7P 7CEIA 2CNRA 1ZNVA 4DG9A 1M90Q 4IPYA 1QRJA 2MY5A 2PEOA 2KGEA 1BXIA 1Q82Q 4M0IA 1KC8Q 1RO2A 2X2BA 1VQLP 3DTJA 3CCQP 2ROQA 2K94A 1DV5A 1YJWP 3NTEA 2AFDA 1VHNA 1M74A 2EIAA 3I56P 2GDXA 2XXMA 4PH1A 2VLQA 2JU1A 2FVAA 1T8KA 2K0DX 1K73Q 4U0DA 4GR6A 4UHPB 2PEQA 3Q20A 3GKLC 4H2XC 1VQ9P 3H47A 2L4BA 2CWOA 4XFXA 2JGPA 5HGOA 3LMOA 5BS1A 2LIUA 5CZDB 2OTJP 3DPHA 3EJBA 4R0MA 3NY7B 1ACPA 3CPWO 1IMQA 1E6JP 1GPJA 2FACA 3CCEP 2KGDA 2M5RA 2K0XA 2LOLA 2N50A 3H0DA 1BAJA 2KOSA 5HGMA 3LRYA 2JYGA 4WYMA 3G71P 2ERHA 3CC2P 2JYLA 3CCMP 2CG5B 3B4QA 2GDWA 3RG6C 1VQ5P 3G1IA 1EIAA 2VLOA 4H2WC 2ONTA 5KP8B 1K8AQ 3G1GA 2PENA 2MR8A 2BUOA 1HY8A 1Q7YQ 1VQOP 2Z46A 2LTEA 3CCJP 2KGCA 2WPTA 2QA4P 3GJNA 2K92A 2MVVA 3G6EP 2LKIA 2Z45A 4U0AA 2PEKA 1X3OA 3CCUP 1AUMA
chains in the Genus database with same CATH topology
4PWVB 2KOPA 2XZ1C 2L4BA 3GZLA 3RG2A 2FQ1A 2KOQA 2JGPA 2N5HA 2FADA 3LMOA 2EHTA 2KW2A 2KG8A 2KORA 4H2YC 2LIUA 1F80D 2KG6A 2MR7A 5CZDB 2FQ0A 2JU2A 2GDYA 3EJBA 4BPFA 4R0MA 3EJDA 3NY7B 1ACPA 1DNYA 2KR5A 2N5IA 1VKUA 2MVUA 2FAEA 2FVFA 2LIWA 2FACA 1NQ4A 2CQ8A 2LL8A 2KGDA 2M5RA 2AFEA 2K0XA 2PNGA 2KWLA 1OR5A 2LOLA 2N50A 2KG9A 2MD9A 2KOSA 4BPGA 2XZ0D 4NEOA 5HV8A 2K0YA 2FVEA 4BPHA 2FHSC 2CNRA 4DG9A 1L0IA 2MY5A 2DNWA 2JQ4A 5KP7B 2AF8A 2KGEA 2N6ZA 4HKGA 2FQ2A 2CG5B 2X2BA 2GDWA 3EJEA 2ROQA 2K94A 4H2WC 2K93A 1DV5A 5KP8B 2L22A 5KP6B 1KLPA 2AFDA 2L0QA 1AF8A 4MRTC 5EJDA 2K2QA 2KOOA 2MR8A 2QNWA 1HY8A 3CE7A 3GZMA 2KGAA 2GDXA 4PXHB 5HVCA 2N6YA 2LTEA 2CGQA 2KGCA 2JU1A 2L9FA 2FVAA 2LMLA 1T8KA 1HQBA 2AVAA 2K92A 4CA3A 2N98A 2MVVA 2EHSA 2LKIA 4IZ6A 2MF4A 1X3OA 2VSQA 2LPKA 4H2XC 1L0HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PWV B;  2KOP A;  2XZ1 C;  2L4B A;  3GZL A;  3RG2 A;  2FQ1 A;  2KOQ A;  2JGP A;  2N5H A;  2FAD A;  3LMO A;  2EHT A;  2KW2 A;  2KG8 A;  2KOR A;  4H2Y C;  2LIU A;  1F80 D;  2KG6 A;  2MR7 A;  5CZD B;  2FQ0 A;  2JU2 A;  2GDY A;  3EJB A;  4BPF A;  4R0M A;  3EJD A;  3NY7 B;  1ACP A;  1DNY A;  2KR5 A;  2N5I A;  1VKU A;  2MVU A;  2FAE A;  2FVF A;  2LIW A;  2FAC A;  1NQ4 A;  2CQ8 A;  2LL8 A;  2KGD A;  2M5R A;  2AFE A;  2K0X A;  2PNG A;  2KWL A;  1OR5 A;  2LOL A;  2N50 A;  2KG9 A;  2MD9 A;  2KOS A;  4BPG A;  2XZ0 D;  4NEO A;  5HV8 A;  2K0Y A;  2FVE A;  4BPH A;  2FHS C;  2CNR A;  4DG9 A;  1L0I A;  2MY5 A;  2DNW A;  2JQ4 A;  5KP7 B;  2AF8 A;  2KGE A;  2N6Z A;  4HKG A;  2FQ2 A;  2CG5 B;  2X2B A;  2GDW A;  3EJE A;  2ROQ A;  2K94 A;  4H2W C;  2K93 A;  1DV5 A;  5KP8 B;  2L22 A;  5KP6 B;  1KLP A;  2AFD A;  2L0Q A;  1AF8 A;  4MRT C;  5EJD A;  2K2Q A;  2KOO A;  2MR8 A;  2QNW A;  1HY8 A;  3CE7 A;  3GZM A;  2KGA A;  2GDX A;  4PXH B;  5HVC A;  2N6Y A;  2LTE A;  2CGQ A;  2KGC A;  2JU1 A;  2L9F A;  2FVA A;  2LML A;  1T8K A;  1HQB A;  2AVA A;  2K92 A;  4CA3 A;  2N98 A;  2MVV A;  2EHS A;  2LKI A;  4IZ6 A;  2MF4 A;  1X3O A;  2VSQ A;  2LPK A;  4H2X C;  1L0H A; 
#chains in the Genus database with same CATH topology
 2QEX P;  3GZL A;  2FQ1 A;  4U0F A;  4F37 A;  2PEM A;  1A8O A;  3G0V A;  1VQ6 P;  4XFZ A;  1A43 A;  2E1M A;  2KG6 A;  2JAZ A;  2FQ0 A;  3OW2 O;  2GDY A;  1M6E X;  3DS5 A;  5F2O A;  1FR2 A;  3HYB A;  2LIW A;  1YJN P;  1K9M Q;  3WBH A;  2KWL A;  1OR5 A;  1QVF O;  2KG9 A;  2XZ0 D;  5HV8 A;  2FHS C;  3H4E A;  4U0E A;  2GZJ A;  2P9X A;  2DNW A;  2JQ4 A;  5KP7 B;  2N6Z A;  4HKG A;  5F2N A;  2FQ2 A;  1GXG A;  4PH0 A;  1UNK A;  2K93 A;  2GZI A;  2EG5 A;  3DS4 A;  1KLP A;  2L0Q A;  2DGY A;  5EJD A;  3VRL C;  2KOO A;  1RNI A;  2PEI A;  4GR2 A;  1VQN P;  1NJI Q;  2PEJ A;  3HZQ A;  4PXH B;  1YIT P;  1EOQ A;  1W2B O;  1ZMB A;  2GZF A;  1Z6M A;  2KOD A;  2L9F A;  2LML A;  1HQB A;  2AVA A;  5BS2 A;  2JBG A;  4CA3 A;  2N98 A;  3G26 A;  4IZ6 A;  2MF4 A;  2VSQ A;  1IUQ A;  3G28 A;  3CCL P;  2KOP A;  2KOQ A;  2N5H A;  2FAD A;  3G4S P;  2EHT A;  2K5X A;  5EW5 E;  2M8P A;  3CC7 P;  2KW2 A;  1CEI A;  2VLP A;  1F80 D;  3CCV P;  1M1K Q;  5HGN A;  1D1D A;  2JU2 A;  4BPF A;  3EJD A;  2M8L A;  2MVU A;  4COP A;  3CMA P;  2FVF A;  1NQ4 A;  2CQ8 A;  3CC4 P;  1RO0 A;  2LL8 A;  1VQ4 P;  2OTL P;  4XRQ A;  2MD9 A;  4BPG A;  3MGE A;  1YHQ P;  2FVE A;  1KD1 Q;  4BPH A;  4COC A;  3CCS P;  1L0I A;  3G29 A;  2AF8 A;  1Q86 Q;  1JJ2 O;  2PY8 A;  3EJE A;  1E0H A;  2GYK A;  5JPA A;  2NO8 A;  1QVG O;  1MZ8 A;  3P05 A;  2L22 A;  5KP6 B;  5DCK A;  3I55 P;  4QNB A;  1N8R Q;  1AF8 A;  4MRT C;  2K2Q A;  1UJZ A;  3DS3 A;  2QNW A;  3CE7 A;  1GXH A;  5F2K A;  3GZM A;  2KGA A;  3G21 A;  3CME P;  2OAR A;  3DS2 A;  5HVC A;  1YIJ P;  2N6Y A;  2CGQ A;  2XT1 A;  2BHV A;  1S72 P;  3CCR P;  4XRO A;  4U0B A;  1YI2 P;  2Z44 A;  2EHS A;  2JO0 A;  1VQM P;  2LPK A;  1L0H A;  4PWV B;  1IMP A;  2XV6 A;  1KQS O;  2XZ1 C;  3RG2 A;  1VQK P;  3M1M A;  3E2D A;  1VQ8 P;  2KG8 A;  1YJ9 P;  2KOR A;  2JB0 A;  4H2Y C;  1VQP P;  4QKO A;  2VLN A;  2MR7 A;  2LF4 A;  3DS0 A;  5I4T G;  2M8N A;  1DNY A;  2KR5 A;  2N5I A;  1VKU A;  4XFY A;  3CXC O;  2FAE A;  5HGL A;  1K30 A;  1AYI A;  2L6E A;  2AFE A;  2PNG A;  4U0C A;  3CD6 P;  1M6N A;  3B5I A;  3DS1 A;  3U43 A;  4NEO A;  2EFJ A;  1EMV A;  2K0Y A;  2GZE A;  2GZG A;  1Q81 Q;  1VQ7 P;  7CEI A;  2CNR A;  1ZNV A;  4DG9 A;  1M90 Q;  4IPY A;  1QRJ A;  2MY5 A;  2PEO A;  2KGE A;  1BXI A;  1Q82 Q;  4M0I A;  1KC8 Q;  1RO2 A;  2X2B A;  1VQL P;  3DTJ A;  3CCQ P;  2ROQ A;  2K94 A;  1DV5 A;  1YJW P;  3NTE A;  2AFD A;  1VHN A;  1M74 A;  2EIA A;  3I56 P;  2GDX A;  2XXM A;  4PH1 A;  2VLQ A;  2JU1 A;  2FVA A;  1T8K A;  2K0D X;  1K73 Q;  4U0D A;  4GR6 A;  4UHP B;  2PEQ A;  3Q20 A;  3GKL C;  4H2X C;  1VQ9 P;  3H47 A;  2L4B A;  2CWO A;  4XFX A;  2JGP A;  5HGO A;  3LMO A;  5BS1 A;  2LIU A;  5CZD B;  2OTJ P;  3DPH A;  3EJB A;  4R0M A;  3NY7 B;  1ACP A;  3CPW O;  1IMQ A;  1E6J P;  1GPJ A;  2FAC A;  3CCE P;  2KGD A;  2M5R A;  2K0X A;  2LOL A;  2N50 A;  3H0D A;  1BAJ A;  2KOS A;  5HGM A;  3LRY A;  2JYG A;  4WYM A;  3G71 P;  2ERH A;  3CC2 P;  2JYL A;  3CCM P;  2CG5 B;  3B4Q A;  2GDW A;  3RG6 C;  1VQ5 P;  3G1I A;  1EIA A;  2VLO A;  4H2W C;  2ONT A;  5KP8 B;  1K8A Q;  3G1G A;  2PEN A;  2MR8 A;  2BUO A;  1HY8 A;  1Q7Y Q;  1VQO P;  2Z46 A;  2LTE A;  3CCJ P;  2KGC A;  2WPT A;  2QA4 P;  3GJN A;  2K92 A;  2MVV A;  3G6E P;  2LKI A;  2Z45 A;  4U0A A;  2PEK A;  1X3O A;  3CCU P;  1AUM A; 
#chains in the Genus database with same CATH homology
 4PWV B;  2KOP A;  2XZ1 C;  2L4B A;  3GZL A;  3RG2 A;  2FQ1 A;  2KOQ A;  2JGP A;  2N5H A;  2FAD A;  3LMO A;  2EHT A;  2KW2 A;  2KG8 A;  2KOR A;  4H2Y C;  2LIU A;  1F80 D;  2KG6 A;  2MR7 A;  5CZD B;  2FQ0 A;  2JU2 A;  2GDY A;  3EJB A;  4BPF A;  4R0M A;  3EJD A;  3NY7 B;  1ACP A;  1DNY A;  2KR5 A;  2N5I A;  1VKU A;  2MVU A;  2FAE A;  2FVF A;  2LIW A;  2FAC A;  1NQ4 A;  2CQ8 A;  2LL8 A;  2KGD A;  2M5R A;  2AFE A;  2K0X A;  2PNG A;  2KWL A;  1OR5 A;  2LOL A;  2N50 A;  2KG9 A;  2MD9 A;  2KOS A;  4BPG A;  2XZ0 D;  4NEO A;  5HV8 A;  2K0Y A;  2FVE A;  4BPH A;  2FHS C;  2CNR A;  4DG9 A;  1L0I A;  2MY5 A;  2DNW A;  2JQ4 A;  5KP7 B;  2AF8 A;  2KGE A;  2N6Z A;  4HKG A;  2FQ2 A;  2CG5 B;  2X2B A;  2GDW A;  3EJE A;  2ROQ A;  2K94 A;  4H2W C;  2K93 A;  1DV5 A;  5KP8 B;  2L22 A;  5KP6 B;  1KLP A;  2AFD A;  2L0Q A;  1AF8 A;  4MRT C;  5EJD A;  2K2Q A;  2KOO A;  2MR8 A;  2QNW A;  1HY8 A;  3CE7 A;  3GZM A;  2KGA A;  2GDX A;  4PXH B;  5HVC A;  2N6Y A;  2LTE A;  2CGQ A;  2KGC A;  2JU1 A;  2L9F A;  2FVA A;  2LML A;  1T8K A;  1HQB A;  2AVA A;  2K92 A;  4CA3 A;  2N98 A;  2MVV A;  2EHS A;  2LKI A;  4IZ6 A;  2MF4 A;  1X3O A;  2VSQ A;  2LPK A;  4H2X C;  1L0H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...