3CXCO

The structure of an enhanced oxazolidinone inhibitor bound to the 50s ribosomal subunit of h. marismortui
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAKGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RIBOSOMAL RNA
publication title Design at the atomic level: design of biaryloxazolidinones as potent orally active antibiotics.
pubmed doi rcsb
molecule tags Ribosome
total genus 50
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2008-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3cxcO02
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 3cxcO01
3CMAP 1VQ9P 3CCQP 1VQMP 1N8RQ 3CCUP 1YITP 3I56P 3OW2O 1KD1Q 3CMEP 1VQ6P 3CC4P 1YI2P 1VQ4P 1YHQP 1Q86Q 3CCLP 1QVGO 1NJIQ 1YJWP 3CCJP 1Q7YQ 1K73Q 1VQLP 1QVFO 3G4SP 1VQKP 1VQPP 2QA4P 1YIJP 1S72P 1VQNP 1VQOP 3CCMP 3CCRP 1VQ8P 1VQ5P 3CPWO 3CXCO 3CC2P 3CCEP 1VQ7P 3I55P 1YJ9P 2OTJP 1Q81Q 1KC8Q 3CC7P 3G6EP 1M1KQ 2OTLP 3G71P 1YJNP 1KQSO 1W2BO 1K9MQ 1K8AQ 3CCSP 1M90Q 3CCVP 2QEXP 3CD6P 1JJ2O 1Q82Q
chains in the Genus database with same CATH superfamily
2EG5A 1IMQA 1UJZA 3CCJP 2MD9A 1VQLP 1RO2A 1M74A 2EIAA 1EIAA 2PEOA 1BAJA 1A43A 2NO8A 3CC4P 2FQ1A 1QRJA 2EHTA 4BPHA 4BPGA 1VQPP 4QKOA 3EJBA 1X3OA 2GZGA 4U0EA 2JBGA 4U0CA 2FADA 2Z46A 2KGDA 3G21A 2FHSC 2GZFA 3DPHA 2LKIA 3CMAP 3DTJA 2X2BA 3CCUP 5BS1A 2AFEA 2FACA 2XV6A 2KGCA 2GDXA 2P9XA 5EW5E 1VQ8P 1E0HA 4PWVB 3EJEA 2LL8A 1FR2A 2KGEA 1VQ9P 4MRTC 3CCQP 2GDYA 2KORA 2FVFA 1KLPA 4XFXA 1YIJP 1S72P 4U0FA 3NTEA 2LIUA 2FAEA 4U0BA 3GZMA 2EFJA 1K8AQ 1K73Q 2PEKA 2MVVA 2JYLA 2KGAA 4U0DA 4XROA 1VQ4P 1VHNA 3HZQA 1Q86Q 3CCLP 1ACPA 2LTEA 2KW2A 3G4SP 4UHPB 3G28A 3GKLC 2PY8A 1HQBA 3CC7P 3CCVP 4WYMA 3CC2P 5BS2A 2M8LA 2FVAA 2N6ZA 5I4TG 2LOLA 2KOPA 2N50A 1T8KA 2EHSA 3G1IA 2PEMA 2OTLP 2N5IA 1OR5A 2KOQA 1PEUA 1L0HA 3E2DA 2OARA 2MR7A 2ONTA 1Q82Q 1K30A 2VLNA 1JJ2O 3M1MA 5F2OA 3EJDA 1M6NA 2L4BA 2N5HA 5F2NA 1E6JP 1PEOA 2K0YA 3DS2A 1Q7YQ 2ROQA 1QVFO 2K0XA 1VQKP 5KP7B 2QA4P 2AVAA 2CQ8A 2AFDA 2WPTA 2KOSA 2VLQA 1MZ8A 2GDWA 3G0VA 1M90Q 2GZJA 3CD6P 2AF8A 1D1DA 2Z45A 2PEQA 3U43A 1YITP 1A8OA 3RG2A 4QNBA 2VSQA 1RNIA 1GPJA 2K94A 1DNYA 1ZMBA 3RG6C 2KR5A 3GZLA 3H47A 1VQ7P 2CWOA 2BUOA 4HKGA 1YJNP 1KQSO 5HGNA 2MF4A 4PH0A 4H2XC 2PEIA 4PXHB 2CGQA 5KP6B 1VQ6P 2M5RA 1YHQP 3G29A 1VKUA 3WBHA 3HYBA 5CZDB 4GR2A 4XRQA 5DCKA 5HVCA 1VQNP 3G1GA 2OTJP 2Z44A 2K0DX 2MR8A 4BPFA 1UNKA 2L0QA 1L0IA 1PEMA 2K2QA 2XZ0D 2FQ2A 4IPYA 4COCA 2PENA 2QNWA 1PEQA 2VLOA 1GXGA 2N98A 3DS4A 1YJ9P 4F37A 2M8NA 2MVUA 1M1KQ 2GYKA 5F2KA 3LMOA 2KODA 1K9MQ 2VLPA 1QVGO 3DS1A 4IZ6A 1HY8A 2N6YA 3LRYA 2KG6A 5HV8A 1VQOP 4XFZA 3I55P 4H2WC 1IMPA 2JO0A 2K5XA 4CA3A 1N8RQ 7CEIA 2BHVA 3CMEP 1F80D 4NEOA 2JQ4A 2K92A 2M8PA 3G26A 2BQ1E 4GR6A 2KOOA 1AYIA 2CG5B 2K93A 3P05A 2FVEA 1RO0A 3H0DA 2XXMA 2XZ1C 5HGMA 1YI2P 3DS0A 2LIWA 2FQ0A 3H4EA 5EJDA 3VRLC 2LMLA 2LF4A 2JYGA 4R0MA 1KC8Q 5HGLA 1DV5A 2JB0A 2QEXP 4M0IA 1Z6MA 1KD1Q 4H2YC 3CE7A 2JAZA 1ZNVA 3MGEA 3B4QA 2LPKA 3GJNA 2JU2A 3CPWO 3CXCO 1IUQA 3NY7B 3DS5A 1BXIA 2DNWA 1Q81Q 3G6EP 1GXHA 5KP8B 2PNGA 1W2BO 4DG9A 3B5IA 2KG8A 1VQMP 3I56P 1NJIQ 4XFYA 5JPAA 2GZEA 1M6EX 3Q20A 2L6EA 3CCMP 3CCRP 1VQ5P 2DGYA 1NQ4A 2KWLA 2CNRA 5HGOA 2PEJA 3CCSP 2L9FA 2E1MA 2MY5A 4COPA 3OW2O 2GZIA 1AUMA 1CEIA 2L22A 1YJWP 1EMVA 2KG9A 4PH1A 1EOQA 1AF8A 3CCEP 3DS3A 3G71P 2XT1A 2JU1A 4U0AA 2ERHA 2JGPA
chains in the Genus database with same CATH topology
2PEKA 4PH0A 2XXMA 2JYLA 2PEIA 2EG5A 5HGMA 4U0DA 4XROA 1VQ6P 1YI2P 3DS0A 1VQ4P 1YHQP 3G29A 3HZQA 1Q86Q 3CCLP 3H4EA 3HYBA 3WBHA 3CCJP 1VQLP 1RO2A 1M74A 3G4SP 2EIAA 4GR2A 3G28A 4XRQA 5DCKA 2PY8A 3VRLC 1VQNP 2LF4A 3G1GA 2JYGA 2OTJP 1KC8Q 3CC7P 5HGLA 1EIAA 2Z44A 2PEOA 3CCVP 2QEXP 4WYMA 3CC2P 1PEMA 1BAJA 1A43A 5BS2A 2M8LA 4M0IA 1KD1Q 3CC4P 4IPYA 1QRJA 4COCA 3MGEA 5I4TG 2PENA 1PEQA 1VQPP 4U0EA 3CPWO 3CXCO 1IUQA 3DS4A 3DS5A 1YJ9P 3G1IA 2PEMA 4U0CA 1Q81Q 3G6EP 2M8NA 2Z46A 1M1KQ 2OTLP 3G21A 5F2KA 1PEUA 2KODA 1W2BO 3E2DA 2OARA 1K9MQ 2ONTA 1Q82Q 3B5IA 3DPHA 1K30A 1QVGO 1JJ2O 3CMAP 3M1MA 3DS1A 5F2OA 1VQMP 1M6NA 3DTJA 3CCUP 5F2NA 1E6JP 3I56P 5BS1A 1PEOA 1NJIQ 4XFYA 3DS2A 5JPAA 1Q7YQ 1K73Q 3LRYA 1QVFO 1M6EX 1VQKP 2XV6A 3Q20A 2QA4P 2L6EA 1VQOP 3CCMP 3CCRP 2P9XA 1VQ5P 2DGYA 1VQ8P 4XFZA 3I55P 5HGOA 2JO0A 2PEJA 3G0VA 1M90Q 3CCSP 3CD6P 1VQ9P 1D1DA 3CCQP 1N8RQ 2Z45A 2E1MA 4COPA 2PEQA 2BHVA 1YITP 3OW2O 3CMEP 1AUMA 1YJWP 1A8OA 4QNBA 1RNIA 2M8PA 4XFXA 3G26A 4PH1A 2BQ1E 1ZMBA 1EOQA 3RG6C 1YIJP 1S72P 3H47A 4U0FA 4GR6A 3NTEA 3CCEP 1VQ7P 3DS3A 4U0BA 2CWOA 2BUOA 3G71P 2XT1A 3P05A 2EFJA 1RO0A 4U0AA 1YJNP 1K8AQ 1KQSO 5HGNA 3H0DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CMA P;  1VQ9 P;  3CCQ P;  1VQM P;  1N8R Q;  3CCU P;  1YIT P;  3I56 P;  3OW2 O;  1KD1 Q;  3CME P;  1VQ6 P;  3CC4 P;  1YI2 P;  1VQ4 P;  1YHQ P;  1Q86 Q;  3CCL P;  1QVG O;  1NJI Q;  1YJW P;  3CCJ P;  1Q7Y Q;  1K73 Q;  1VQL P;  1QVF O;  3G4S P;  1VQK P;  1VQP P;  2QA4 P;  1YIJ P;  1S72 P;  1VQN P;  1VQO P;  3CCM P;  3CCR P;  1VQ8 P;  1VQ5 P;  3CPW O;  3CXC O;  3CC2 P;  3CCE P;  1VQ7 P;  3I55 P;  1YJ9 P;  2OTJ P;  1Q81 Q;  1KC8 Q;  3CC7 P;  3G6E P;  1M1K Q;  2OTL P;  3G71 P;  1YJN P;  1KQS O;  1W2B O;  1K9M Q;  1K8A Q;  3CCS P;  1M90 Q;  3CCV P;  2QEX P;  3CD6 P;  1JJ2 O;  1Q82 Q; 
#chains in the Genus database with same CATH topology
 2EG5 A;  1IMQ A;  1UJZ A;  3CCJ P;  2MD9 A;  1VQL P;  1RO2 A;  1M74 A;  2EIA A;  1EIA A;  2PEO A;  1BAJ A;  1A43 A;  2NO8 A;  3CC4 P;  2FQ1 A;  1QRJ A;  2EHT A;  4BPH A;  4BPG A;  1VQP P;  4QKO A;  3EJB A;  1X3O A;  2GZG A;  4U0E A;  2JBG A;  4U0C A;  2FAD A;  2Z46 A;  2KGD A;  3G21 A;  2FHS C;  2GZF A;  3DPH A;  2LKI A;  3CMA P;  3DTJ A;  2X2B A;  3CCU P;  5BS1 A;  2AFE A;  2FAC A;  2XV6 A;  2KGC A;  2GDX A;  2P9X A;  5EW5 E;  1VQ8 P;  1E0H A;  4PWV B;  3EJE A;  2LL8 A;  1FR2 A;  2KGE A;  1VQ9 P;  4MRT C;  3CCQ P;  2GDY A;  2KOR A;  2FVF A;  1KLP A;  4XFX A;  1YIJ P;  1S72 P;  4U0F A;  3NTE A;  2LIU A;  2FAE A;  4U0B A;  3GZM A;  2EFJ A;  1K8A Q;  1K73 Q;  2PEK A;  2MVV A;  2JYL A;  2KGA A;  4U0D A;  4XRO A;  1VQ4 P;  1VHN A;  3HZQ A;  1Q86 Q;  3CCL P;  1ACP A;  2LTE A;  2KW2 A;  3G4S P;  4UHP B;  3G28 A;  3GKL C;  2PY8 A;  1HQB A;  3CC7 P;  3CCV P;  4WYM A;  3CC2 P;  5BS2 A;  2M8L A;  2FVA A;  2N6Z A;  5I4T G;  2LOL A;  2KOP A;  2N50 A;  1T8K A;  2EHS A;  3G1I A;  2PEM A;  2OTL P;  2N5I A;  1OR5 A;  2KOQ A;  1PEU A;  1L0H A;  3E2D A;  2OAR A;  2MR7 A;  2ONT A;  1Q82 Q;  1K30 A;  2VLN A;  1JJ2 O;  3M1M A;  5F2O A;  3EJD A;  1M6N A;  2L4B A;  2N5H A;  5F2N A;  1E6J P;  1PEO A;  2K0Y A;  3DS2 A;  1Q7Y Q;  2ROQ A;  1QVF O;  2K0X A;  1VQK P;  5KP7 B;  2QA4 P;  2AVA A;  2CQ8 A;  2AFD A;  2WPT A;  2KOS A;  2VLQ A;  1MZ8 A;  2GDW A;  3G0V A;  1M90 Q;  2GZJ A;  3CD6 P;  2AF8 A;  1D1D A;  2Z45 A;  2PEQ A;  3U43 A;  1YIT P;  1A8O A;  3RG2 A;  4QNB A;  2VSQ A;  1RNI A;  1GPJ A;  2K94 A;  1DNY A;  1ZMB A;  3RG6 C;  2KR5 A;  3GZL A;  3H47 A;  1VQ7 P;  2CWO A;  2BUO A;  4HKG A;  1YJN P;  1KQS O;  5HGN A;  2MF4 A;  4PH0 A;  4H2X C;  2PEI A;  4PXH B;  2CGQ A;  5KP6 B;  1VQ6 P;  2M5R A;  1YHQ P;  3G29 A;  1VKU A;  3WBH A;  3HYB A;  5CZD B;  4GR2 A;  4XRQ A;  5DCK A;  5HVC A;  1VQN P;  3G1G A;  2OTJ P;  2Z44 A;  2K0D X;  2MR8 A;  4BPF A;  1UNK A;  2L0Q A;  1L0I A;  1PEM A;  2K2Q A;  2XZ0 D;  2FQ2 A;  4IPY A;  4COC A;  2PEN A;  2QNW A;  1PEQ A;  2VLO A;  1GXG A;  2N98 A;  3DS4 A;  1YJ9 P;  4F37 A;  2M8N A;  2MVU A;  1M1K Q;  2GYK A;  5F2K A;  3LMO A;  2KOD A;  1K9M Q;  2VLP A;  1QVG O;  3DS1 A;  4IZ6 A;  1HY8 A;  2N6Y A;  3LRY A;  2KG6 A;  5HV8 A;  1VQO P;  4XFZ A;  3I55 P;  4H2W C;  1IMP A;  2JO0 A;  2K5X A;  4CA3 A;  1N8R Q;  7CEI A;  2BHV A;  3CME P;  1F80 D;  4NEO A;  2JQ4 A;  2K92 A;  2M8P A;  3G26 A;  2BQ1 E;  4GR6 A;  2KOO A;  1AYI A;  2CG5 B;  2K93 A;  3P05 A;  2FVE A;  1RO0 A;  3H0D A;  2XXM A;  2XZ1 C;  5HGM A;  1YI2 P;  3DS0 A;  2LIW A;  2FQ0 A;  3H4E A;  5EJD A;  3VRL C;  2LML A;  2LF4 A;  2JYG A;  4R0M A;  1KC8 Q;  5HGL A;  1DV5 A;  2JB0 A;  2QEX P;  4M0I A;  1Z6M A;  1KD1 Q;  4H2Y C;  3CE7 A;  2JAZ A;  1ZNV A;  3MGE A;  3B4Q A;  2LPK A;  3GJN A;  2JU2 A;  3CPW O;  3CXC O;  1IUQ A;  3NY7 B;  3DS5 A;  1BXI A;  2DNW A;  1Q81 Q;  3G6E P;  1GXH A;  5KP8 B;  2PNG A;  1W2B O;  4DG9 A;  3B5I A;  2KG8 A;  1VQM P;  3I56 P;  1NJI Q;  4XFY A;  5JPA A;  2GZE A;  1M6E X;  3Q20 A;  2L6E A;  3CCM P;  3CCR P;  1VQ5 P;  2DGY A;  1NQ4 A;  2KWL A;  2CNR A;  5HGO A;  2PEJ A;  3CCS P;  2L9F A;  2E1M A;  2MY5 A;  4COP A;  3OW2 O;  2GZI A;  1AUM A;  1CEI A;  2L22 A;  1YJW P;  1EMV A;  2KG9 A;  4PH1 A;  1EOQ A;  1AF8 A;  3CCE P;  3DS3 A;  3G71 P;  2XT1 A;  2JU1 A;  4U0A A;  2ERH A;  2JGP A; 
#chains in the Genus database with same CATH homology
 2PEK A;  4PH0 A;  2XXM A;  2JYL A;  2PEI A;  2EG5 A;  5HGM A;  4U0D A;  4XRO A;  1VQ6 P;  1YI2 P;  3DS0 A;  1VQ4 P;  1YHQ P;  3G29 A;  3HZQ A;  1Q86 Q;  3CCL P;  3H4E A;  3HYB A;  3WBH A;  3CCJ P;  1VQL P;  1RO2 A;  1M74 A;  3G4S P;  2EIA A;  4GR2 A;  3G28 A;  4XRQ A;  5DCK A;  2PY8 A;  3VRL C;  1VQN P;  2LF4 A;  3G1G A;  2JYG A;  2OTJ P;  1KC8 Q;  3CC7 P;  5HGL A;  1EIA A;  2Z44 A;  2PEO A;  3CCV P;  2QEX P;  4WYM A;  3CC2 P;  1PEM A;  1BAJ A;  1A43 A;  5BS2 A;  2M8L A;  4M0I A;  1KD1 Q;  3CC4 P;  4IPY A;  1QRJ A;  4COC A;  3MGE A;  5I4T G;  2PEN A;  1PEQ A;  1VQP P;  4U0E A;  3CPW O;  3CXC O;  1IUQ A;  3DS4 A;  3DS5 A;  1YJ9 P;  3G1I A;  2PEM A;  4U0C A;  1Q81 Q;  3G6E P;  2M8N A;  2Z46 A;  1M1K Q;  2OTL P;  3G21 A;  5F2K A;  1PEU A;  2KOD A;  1W2B O;  3E2D A;  2OAR A;  1K9M Q;  2ONT A;  1Q82 Q;  3B5I A;  3DPH A;  1K30 A;  1QVG O;  1JJ2 O;  3CMA P;  3M1M A;  3DS1 A;  5F2O A;  1VQM P;  1M6N A;  3DTJ A;  3CCU P;  5F2N A;  1E6J P;  3I56 P;  5BS1 A;  1PEO A;  1NJI Q;  4XFY A;  3DS2 A;  5JPA A;  1Q7Y Q;  1K73 Q;  3LRY A;  1QVF O;  1M6E X;  1VQK P;  2XV6 A;  3Q20 A;  2QA4 P;  2L6E A;  1VQO P;  3CCM P;  3CCR P;  2P9X A;  1VQ5 P;  2DGY A;  1VQ8 P;  4XFZ A;  3I55 P;  5HGO A;  2JO0 A;  2PEJ A;  3G0V A;  1M90 Q;  3CCS P;  3CD6 P;  1VQ9 P;  1D1D A;  3CCQ P;  1N8R Q;  2Z45 A;  2E1M A;  4COP A;  2PEQ A;  2BHV A;  1YIT P;  3OW2 O;  3CME P;  1AUM A;  1YJW P;  1A8O A;  4QNB A;  1RNI A;  2M8P A;  4XFX A;  3G26 A;  4PH1 A;  2BQ1 E;  1ZMB A;  1EOQ A;  3RG6 C;  1YIJ P;  1S72 P;  3H47 A;  4U0F A;  4GR6 A;  3NTE A;  3CCE P;  1VQ7 P;  3DS3 A;  4U0B A;  2CWO A;  2BUO A;  3G71 P;  2XT1 A;  3P05 A;  2EFJ A;  1RO0 A;  4U0A A;  1YJN P;  1K8A Q;  1KQS O;  5HGN A;  3H0D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...