3CXCO

The structure of an enhanced oxazolidinone inhibitor bound to the 50s ribosomal subunit of h. marismortui
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAKGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S RIBOSOMAL RNA
publication title Design at the atomic level: design of biaryloxazolidinones as potent orally active antibiotics.
pubmed doi rcsb
total genus 50
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2008-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3cxcO02
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 3cxcO01
1VQ6P 3CCSP 2OTLP 2OTJP 3CXCO 1VQPP 1VQNP 3G6EP 1N8RQ 3I55P 1K8AQ 3CC4P 3CC2P 1YJNP 1W2BO 1YJ9P 1NJIQ 1KQSO 1K9MQ 1K73Q 3CMAP 3CCJP 1VQ7P 1Q86Q 1Q82Q 1YITP 1VQOP 1VQ5P 1M90Q 3CCLP 3CCMP 1M1KQ 1QVFO 3CCUP 1JJ2O 1QVGO 1VQLP 1VQ8P 3CCEP 1YJWP 1KD1Q 1VQMP 3OW2O 3G4SP 3CCQP 1KC8Q 3CMEP 1VQ4P 1Q81Q 3G71P 1VQ9P 1VQKP 3CD6P 2QA4P 1S72P 3CC7P 3CCVP 1YIJP 1Q7YQ 3I56P 1YI2P 2QEXP 3CPWO 1YHQP 3CCRP
chains in the Genus database with same CATH superfamily
4U0AA 2OARA 2MY5A 4MRTC 2Z46A 1OR5A 2KGAA 4BPHA 2VLNA 2KG9A 1BAJA 3B5IA 1AYIA 2MVUA 2FHSC 2JU1A 4HKGA 3CMEP 2LIWA 1VQKP 3CC7P 2E1MA 2M8NA 3I56P 2N98A 4COPA 3I55P 3CC4P 2PEOA 1HY8A 1KLPA 3CCJP 2K92A 1YITP 1RO2A 2EG5A 2DNWA 1QVGO 3DPHA 1VQ8P 1YJWP 1S72P 4XRQA 3CCRP 4COCA 2JGPA 4GR2A 1Z6MA 3DTJA 2PNGA 5CZDB 1M74A 4XFZA 2PEKA 4U0EA 2GZGA 4H2XC 2MF4A 2XXMA 3G4SP 3G29A 2FQ2A 2GZIA 3LRYA 7CEIA 3H0DA 3P05A 1RNIA 3Q20A 3CE7A 1GXHA 4XFYA 3G21A 1NQ4A 1KQSO 3CMAP 2Z45A 4U0CA 2K5XA 3CCEP 2AFEA 2K0YA 2FVFA 2LL8A 2L0QA 3DS0A 1UJZA 3CXCO 1HQBA 1EOQA 1K8AQ 1PEOA 1PEQA 1Q86Q 2JYGA 5EW5E 3RG2A 5KP8B 1E0HA 2KODA 1EMVA 4H2WC 1BXIA 5EJDA 1Q7YQ 4U0BA 3H47A 1DNYA 1K30A 2KGEA 1W2BO 3E2DA 3EJEA 1FR2A 1E6JP 1A43A 5BS1A 2VLOA 1IMPA 2K0XA 2KGCA 2XZ0D 2BQ1E 1F80D 1AF8A 2KWLA 4U0FA 3NY7B 1PEMA 4M0IA 1VQPP 3G6EP 2FVEA 3GJNA 1VQ7P 2N6YA 5HGNA 2VLPA 2CGQA 2PENA 2ONTA 1M1KQ 1QVFO 2N5IA 2KOOA 1ZMBA 2KG6A 2AF8A 4H2YC 3CCQP 2KORA 1YJ9P 3EJDA 2CQ8A 2GDWA 5HGMA 1VQOP 3CCLP 2KOSA 2L9FA 3CCUP 4R0MA 4XROA 1KD1Q 3G28A 1VQMP 3DS4A 3G71P 2FADA 2M8LA 2VLQA 1L0HA 1IMQA 2N5HA 1VQ6P 2BHVA 1VQNP 2KOQA 4PWVB 4BPFA 5HGLA 2GDYA 1VHNA 3G1IA 1IUQA 2EFJA 1DV5A 1VQ4P 2VSQA 1Q81Q 2XT1A 2L4BA 2QEXP 2FQ0A 3CPWO 3CCSP 5HVCA 2GYKA 1EIAA 4GR6A 3CC2P 2L22A 3WBHA 2DGYA 2NO8A 2PEIA 2QNWA 2JB0A 2PY8A 3DS5A 3M1MA 4CA3A 2MVVA 3GZLA 2QA4P 2XZ1C 2AVAA 2LMLA 3DS3A 4PH0A 3CCVP 2M5RA 2GDXA 1MZ8A 1T8KA 1YJNP 1NJIQ 1PEUA 3G1GA 1Q82Q 2EHSA 4NEOA 5HV8A 2P9XA 5JPAA 2K94A 2GZEA 1M6EX 2PEQA 3HZQA 2L6EA 1YHQP 3DS2A 1K9MQ 4QNBA 2JQ4A 1A8OA 2JU2A 3CCMP 3NTEA 4IZ6A 1JJ2O 2ROQA 2FAEA 2FACA 3DS1A 1KC8Q 3OW2O 5DCKA 3VRLC 3CD6P 2JAZA 2X2BA 5I4TG 4UHPB 5KP7B 3H4EA 1D1DA 3GKLC 5F2NA 2JO0A 2K93A 2XV6A 2CWOA 1VQLP 4XFXA 1VKUA 1GXGA 2LF4A 2Z44A 5BS2A 4WYMA 1L0IA 2CG5B 2N50A 1X3OA 3U43A 2WPTA 2N6ZA 1QRJA 3G26A 2M8PA 5KP6B 2LIUA 2GZJA 2FQ1A 2MR8A 2LPKA 3GZMA 2EIAA 2LOLA 1VQ9P 2EHTA 2MD9A 1ACPA 4PH1A 2K2QA 2KGDA 2OTLP 1UNKA 4F37A 2K0DX 2MR7A 2KG8A 1K73Q 1GPJA 2LTEA 3LMOA 3G0VA 1M90Q 4BPGA 2KR5A 2ERHA 2JYLA 2KW2A 5F2OA 2GZFA 1YIJP 1AUMA 4QKOA 3HYBA 2FVAA 1RO0A 3B4QA 4DG9A 1N8RQ 2BUOA 5HGOA 3MGEA 1VQ5P 1CEIA 4IPYA 2KOPA 2JBGA 5F2KA 4PXHB 2LKIA 1ZNVA 2OTJP 2CNRA 2PEJA 1M6NA 3RG6C 4U0DA 3EJBA 1YI2P 2AFDA 2PEMA
chains in the Genus database with same CATH topology
1VQ6P 2BHVA 5I4TG 4U0AA 3CXCO 1VQNP 1EOQA 2OARA 5HGLA 1K8AQ 3H4EA 1PEOA 1D1DA 2Z46A 5F2NA 2JO0A 1Q86Q 1PEQA 2JYGA 3G1IA 1IUQA 1BAJA 3B5IA 2XV6A 2CWOA 1VQLP 4XFXA 2EFJA 3CMEP 1VQ4P 1Q81Q 2KODA 1VQKP 2XT1A 3CC7P 2E1MA 1Q7YQ 2M8NA 2QEXP 3I56P 3CPWO 3CCSP 2LF4A 2Z44A 5BS2A 4WYMA 4COPA 1EIAA 4GR6A 4U0BA 3H47A 3I55P 1K30A 2PEOA 3CC4P 3CC2P 1W2BO 3E2DA 3WBHA 2DGYA 3CCJP 2PEIA 1QRJA 1E6JP 3G26A 1YITP 2M8PA 1RO2A 1A43A 2EG5A 2PY8A 5BS1A 3DS5A 3M1MA 1QVGO 3DPHA 1VQ8P 1YJWP 2EIAA 1VQ9P 2BQ1E 2QA4P 1S72P 4U0FA 3DS3A 4XRQA 4PH0A 3CCVP 4PH1A 3CCRP 2OTLP 1PEMA 4M0IA 4COCA 1VQPP 4GR2A 3G6EP 3DTJA 1YJNP 1NJIQ 1M74A 1PEUA 4XFZA 1K73Q 3G1GA 1VQ7P 2PEKA 5HGNA 1Q82Q 3G0VA 1M90Q 2PENA 2ONTA 4U0EA 1M1KQ 1QVFO 2JYLA 1ZMBA 3G4SP 2XXMA 5F2OA 3CCQP 2P9XA 5JPAA 3G29A 3LRYA 1M6EX 2PEQA 3HZQA 3H0DA 3P05A 1YIJP 1AUMA 3HYBA 2L6EA 1RNIA 1YHQP 3Q20A 1RO0A 1N8RQ 2BUOA 3DS2A 5HGOA 1YJ9P 4XFYA 3G21A 3MGEA 1K9MQ 1KQSO 5HGMA 3CMAP 2Z45A 4QNBA 4U0CA 1VQOP 1VQ5P 3CCLP 1A8OA 3CCMP 3NTEA 3CCUP 1JJ2O 3CCEP 4IPYA 5F2KA 4XROA 1KD1Q 3DS1A 3G28A 1VQMP 3OW2O 1KC8Q 5DCKA 3VRLC 2OTJP 3CD6P 3DS4A 3G71P 2PEJA 1M6NA 2M8LA 3RG6C 4U0DA 1YI2P 3DS0A 2PEMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ6 P;  3CCS P;  2OTL P;  2OTJ P;  3CXC O;  1VQP P;  1VQN P;  3G6E P;  1N8R Q;  3I55 P;  1K8A Q;  3CC4 P;  3CC2 P;  1YJN P;  1W2B O;  1YJ9 P;  1NJI Q;  1KQS O;  1K9M Q;  1K73 Q;  3CMA P;  3CCJ P;  1VQ7 P;  1Q86 Q;  1Q82 Q;  1YIT P;  1VQO P;  1VQ5 P;  1M90 Q;  3CCL P;  3CCM P;  1M1K Q;  1QVF O;  3CCU P;  1JJ2 O;  1QVG O;  1VQL P;  1VQ8 P;  3CCE P;  1YJW P;  1KD1 Q;  1VQM P;  3OW2 O;  3G4S P;  3CCQ P;  1KC8 Q;  3CME P;  1VQ4 P;  1Q81 Q;  3G71 P;  1VQ9 P;  1VQK P;  3CD6 P;  2QA4 P;  1S72 P;  3CC7 P;  3CCV P;  1YIJ P;  1Q7Y Q;  3I56 P;  1YI2 P;  2QEX P;  3CPW O;  1YHQ P;  3CCR P; 
#chains in the Genus database with same CATH topology
 4U0A A;  2OAR A;  2MY5 A;  4MRT C;  2Z46 A;  1OR5 A;  2KGA A;  4BPH A;  2VLN A;  2KG9 A;  1BAJ A;  3B5I A;  1AYI A;  2MVU A;  2FHS C;  2JU1 A;  4HKG A;  3CME P;  2LIW A;  1VQK P;  3CC7 P;  2E1M A;  2M8N A;  3I56 P;  2N98 A;  4COP A;  3I55 P;  3CC4 P;  2PEO A;  1HY8 A;  1KLP A;  3CCJ P;  2K92 A;  1YIT P;  1RO2 A;  2EG5 A;  2DNW A;  1QVG O;  3DPH A;  1VQ8 P;  1YJW P;  1S72 P;  4XRQ A;  3CCR P;  4COC A;  2JGP A;  4GR2 A;  1Z6M A;  3DTJ A;  2PNG A;  5CZD B;  1M74 A;  4XFZ A;  2PEK A;  4U0E A;  2GZG A;  4H2X C;  2MF4 A;  2XXM A;  3G4S P;  3G29 A;  2FQ2 A;  2GZI A;  3LRY A;  7CEI A;  3H0D A;  3P05 A;  1RNI A;  3Q20 A;  3CE7 A;  1GXH A;  4XFY A;  3G21 A;  1NQ4 A;  1KQS O;  3CMA P;  2Z45 A;  4U0C A;  2K5X A;  3CCE P;  2AFE A;  2K0Y A;  2FVF A;  2LL8 A;  2L0Q A;  3DS0 A;  1UJZ A;  3CXC O;  1HQB A;  1EOQ A;  1K8A Q;  1PEO A;  1PEQ A;  1Q86 Q;  2JYG A;  5EW5 E;  3RG2 A;  5KP8 B;  1E0H A;  2KOD A;  1EMV A;  4H2W C;  1BXI A;  5EJD A;  1Q7Y Q;  4U0B A;  3H47 A;  1DNY A;  1K30 A;  2KGE A;  1W2B O;  3E2D A;  3EJE A;  1FR2 A;  1E6J P;  1A43 A;  5BS1 A;  2VLO A;  1IMP A;  2K0X A;  2KGC A;  2XZ0 D;  2BQ1 E;  1F80 D;  1AF8 A;  2KWL A;  4U0F A;  3NY7 B;  1PEM A;  4M0I A;  1VQP P;  3G6E P;  2FVE A;  3GJN A;  1VQ7 P;  2N6Y A;  5HGN A;  2VLP A;  2CGQ A;  2PEN A;  2ONT A;  1M1K Q;  1QVF O;  2N5I A;  2KOO A;  1ZMB A;  2KG6 A;  2AF8 A;  4H2Y C;  3CCQ P;  2KOR A;  1YJ9 P;  3EJD A;  2CQ8 A;  2GDW A;  5HGM A;  1VQO P;  3CCL P;  2KOS A;  2L9F A;  3CCU P;  4R0M A;  4XRO A;  1KD1 Q;  3G28 A;  1VQM P;  3DS4 A;  3G71 P;  2FAD A;  2M8L A;  2VLQ A;  1L0H A;  1IMQ A;  2N5H A;  1VQ6 P;  2BHV A;  1VQN P;  2KOQ A;  4PWV B;  4BPF A;  5HGL A;  2GDY A;  1VHN A;  3G1I A;  1IUQ A;  2EFJ A;  1DV5 A;  1VQ4 P;  2VSQ A;  1Q81 Q;  2XT1 A;  2L4B A;  2QEX P;  2FQ0 A;  3CPW O;  3CCS P;  5HVC A;  2GYK A;  1EIA A;  4GR6 A;  3CC2 P;  2L22 A;  3WBH A;  2DGY A;  2NO8 A;  2PEI A;  2QNW A;  2JB0 A;  2PY8 A;  3DS5 A;  3M1M A;  4CA3 A;  2MVV A;  3GZL A;  2QA4 P;  2XZ1 C;  2AVA A;  2LML A;  3DS3 A;  4PH0 A;  3CCV P;  2M5R A;  2GDX A;  1MZ8 A;  1T8K A;  1YJN P;  1NJI Q;  1PEU A;  3G1G A;  1Q82 Q;  2EHS A;  4NEO A;  5HV8 A;  2P9X A;  5JPA A;  2K94 A;  2GZE A;  1M6E X;  2PEQ A;  3HZQ A;  2L6E A;  1YHQ P;  3DS2 A;  1K9M Q;  4QNB A;  2JQ4 A;  1A8O A;  2JU2 A;  3CCM P;  3NTE A;  4IZ6 A;  1JJ2 O;  2ROQ A;  2FAE A;  2FAC A;  3DS1 A;  1KC8 Q;  3OW2 O;  5DCK A;  3VRL C;  3CD6 P;  2JAZ A;  2X2B A;  5I4T G;  4UHP B;  5KP7 B;  3H4E A;  1D1D A;  3GKL C;  5F2N A;  2JO0 A;  2K93 A;  2XV6 A;  2CWO A;  1VQL P;  4XFX A;  1VKU A;  1GXG A;  2LF4 A;  2Z44 A;  5BS2 A;  4WYM A;  1L0I A;  2CG5 B;  2N50 A;  1X3O A;  3U43 A;  2WPT A;  2N6Z A;  1QRJ A;  3G26 A;  2M8P A;  5KP6 B;  2LIU A;  2GZJ A;  2FQ1 A;  2MR8 A;  2LPK A;  3GZM A;  2EIA A;  2LOL A;  1VQ9 P;  2EHT A;  2MD9 A;  1ACP A;  4PH1 A;  2K2Q A;  2KGD A;  2OTL P;  1UNK A;  4F37 A;  2K0D X;  2MR7 A;  2KG8 A;  1K73 Q;  1GPJ A;  2LTE A;  3LMO A;  3G0V A;  1M90 Q;  4BPG A;  2KR5 A;  2ERH A;  2JYL A;  2KW2 A;  5F2O A;  2GZF A;  1YIJ P;  1AUM A;  4QKO A;  3HYB A;  2FVA A;  1RO0 A;  3B4Q A;  4DG9 A;  1N8R Q;  2BUO A;  5HGO A;  3MGE A;  1VQ5 P;  1CEI A;  4IPY A;  2KOP A;  2JBG A;  5F2K A;  4PXH B;  2LKI A;  1ZNV A;  2OTJ P;  2CNR A;  2PEJ A;  1M6N A;  3RG6 C;  4U0D A;  3EJB A;  1YI2 P;  2AFD A;  2PEM A; 
#chains in the Genus database with same CATH homology
 1VQ6 P;  2BHV A;  5I4T G;  4U0A A;  3CXC O;  1VQN P;  1EOQ A;  2OAR A;  5HGL A;  1K8A Q;  3H4E A;  1PEO A;  1D1D A;  2Z46 A;  5F2N A;  2JO0 A;  1Q86 Q;  1PEQ A;  2JYG A;  3G1I A;  1IUQ A;  1BAJ A;  3B5I A;  2XV6 A;  2CWO A;  1VQL P;  4XFX A;  2EFJ A;  3CME P;  1VQ4 P;  1Q81 Q;  2KOD A;  1VQK P;  2XT1 A;  3CC7 P;  2E1M A;  1Q7Y Q;  2M8N A;  2QEX P;  3I56 P;  3CPW O;  3CCS P;  2LF4 A;  2Z44 A;  5BS2 A;  4WYM A;  4COP A;  1EIA A;  4GR6 A;  4U0B A;  3H47 A;  3I55 P;  1K30 A;  2PEO A;  3CC4 P;  3CC2 P;  1W2B O;  3E2D A;  3WBH A;  2DGY A;  3CCJ P;  2PEI A;  1QRJ A;  1E6J P;  3G26 A;  1YIT P;  2M8P A;  1RO2 A;  1A43 A;  2EG5 A;  2PY8 A;  5BS1 A;  3DS5 A;  3M1M A;  1QVG O;  3DPH A;  1VQ8 P;  1YJW P;  2EIA A;  1VQ9 P;  2BQ1 E;  2QA4 P;  1S72 P;  4U0F A;  3DS3 A;  4XRQ A;  4PH0 A;  3CCV P;  4PH1 A;  3CCR P;  2OTL P;  1PEM A;  4M0I A;  4COC A;  1VQP P;  4GR2 A;  3G6E P;  3DTJ A;  1YJN P;  1NJI Q;  1M74 A;  1PEU A;  4XFZ A;  1K73 Q;  3G1G A;  1VQ7 P;  2PEK A;  5HGN A;  1Q82 Q;  3G0V A;  1M90 Q;  2PEN A;  2ONT A;  4U0E A;  1M1K Q;  1QVF O;  2JYL A;  1ZMB A;  3G4S P;  2XXM A;  5F2O A;  3CCQ P;  2P9X A;  5JPA A;  3G29 A;  3LRY A;  1M6E X;  2PEQ A;  3HZQ A;  3H0D A;  3P05 A;  1YIJ P;  1AUM A;  3HYB A;  2L6E A;  1RNI A;  1YHQ P;  3Q20 A;  1RO0 A;  1N8R Q;  2BUO A;  3DS2 A;  5HGO A;  1YJ9 P;  4XFY A;  3G21 A;  3MGE A;  1K9M Q;  1KQS O;  5HGM A;  3CMA P;  2Z45 A;  4QNB A;  4U0C A;  1VQO P;  1VQ5 P;  3CCL P;  1A8O A;  3CCM P;  3NTE A;  3CCU P;  1JJ2 O;  3CCE P;  4IPY A;  5F2K A;  4XRO A;  1KD1 Q;  3DS1 A;  3G28 A;  1VQM P;  3OW2 O;  1KC8 Q;  5DCK A;  3VRL C;  2OTJ P;  3CD6 P;  3DS4 A;  3G71 P;  2PEJ A;  1M6N A;  2M8L A;  3RG6 C;  4U0D A;  1YI2 P;  3DS0 A;  2PEM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...