3CXCO

The structure of an enhanced oxazolidinone inhibitor bound to the 50s ribosomal subunit of h. marismortui
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAKGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design at the atomic level: design of biaryloxazolidinones as potent orally active antibiotics.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S RIBOSOMAL RNA
total genus 50
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2008-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3cxcO02
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 3cxcO01
3CCUP 2OTLP 1JJ2O 1YJ9P 3CD6P 1KD1Q 3CCJP 1YJWP 1Q81Q 1M1KQ 3CCLP 1M90Q 1VQKP 3I55P 1K8AQ 1VQMP 3G4SP 1YI2P 2OTJP 1KQSO 1Q7YQ 1VQ9P 3CPWO 3CCRP 1QVFO 1VQ7P 1VQNP 1KC8Q 1YIJP 3OW2O 1NJIQ 1YHQP 1VQ4P 3G6EP 1Q82Q 1VQ5P 1K9MQ 3G71P 3CC4P 3CXCO 3CCSP 1VQOP 3CC7P 1VQ6P 3CCQP 1QVGO 1VQ8P 3CMAP 1K73Q 3CCVP 3CC2P 3CMEP 1N8RQ 1YITP 1S72P 3CCEP 1W2BO 3I56P 1VQPP 3CCMP 1Q86Q 2QA4P 2QEXP 1YJNP 1VQLP
chains in the Genus database with same CATH superfamily
1ZNVA 2JYLA 1D1DA 1RO2A 1QVFO 2K93A 5HGMA 3E2DA 4M0IA 2JU1A 3CMAP 2BHVA 2CQ8A 2LMLA 3HYBA 1QRJA 1AF8A 3G26A 3GJNA 4F37A 4NEOA 3CCUP 4PWVB 1BAJA 1MZ8A 2PEJA 3VRLC 3CCLP 1PEMA 2X2BA 3RG6C 2OTJP 2FACA 2K0DX 1UJZA 2GZGA 4GR2A 4HKGA 2PEIA 3B5IA 1A8OA 1VKUA 2BQ1E 2KWLA 3I55P 3G29A 3NY7B 2GDXA 5I4TG 2EIAA 2K94A 3GZLA 3OW2O 2N5IA 4BPHA 4U0FA 3DS3A 2K92A 4XFXA 3I56P 2OARA 5KP7B 2LIWA 2EG5A 2VSQA 2EFJA 2N6ZA 1X3OA 4UHPB 2GDWA 2MF4A 3G0VA 1RO0A 1KC8Q 2XT1A 3H4EA 2M8LA 2MD9A 3G6EP 1VQ5P 2BUOA 2FQ0A 3CCQP 2KOQA 2VLOA 1PEQA 1L0HA 2KG8A 2KORA 1UNKA 2Z46A 1ACPA 2N98A 3G4SP 1VQ9P 2LIUA 1YIJP 2L6EA 1OR5A 2PEKA 2CG5B 1VQ8P 2GDYA 2NO8A 2L0QA 4COPA 3CCEP 3DS1A 2JB0A 4IPYA 2JQ4A 2P9XA 2PEOA 2FVFA 2JAZA 1KD1Q 5HV8A 2MY5A 2E1MA 2GZIA 2Z44A 7CEIA 2KOSA 1VQ7P 4U0AA 2AFDA 1HY8A 2AFEA 2M8PA 3EJEA 2XZ0D 2FVEA 4H2WC 2GYKA 2LOLA 1YI2P 5JPAA 1DNYA 3CCRP 2N5HA 5EW5E 4H2YC 4PH0A 1IMPA 2K0YA 3NTEA 2CGQA 2L22A 1VQ6P 2PNGA 2JGPA 4QKOA 4XFYA 3DS0A 1M74A 2M8NA 2PENA 2WPTA 2LPKA 4BPGA 2VLPA 2QA4P 4PXHB 4R0MA 1GPJA 1K30A 1M6NA 2MVVA 2MVUA 3G28A 2GZFA 2KGDA 3B4QA 2JU2A 2KGAA 3LMOA 1M6EX 1W2BO 5CZDB 2QEXP 1YJNP 5KP6B 3H47A 2MR8A 1HQBA 3G21A 4H2XC 4BPFA 2GZEA 5HVCA 1VQKP 2GZJA 1K8AQ 3HZQA 1VQNP 3WBHA 2KOPA 1CEIA 1K9MQ 2JYGA 4CA3A 3CC7P 1DV5A 3RG2A 5HGOA 1Q86Q 2PY8A 1Q82Q 4U0EA 3EJBA 2KOOA 2PEMA 1YJ9P 2ROQA 3U43A 5HGLA 2M5RA 1IMQA 4PH1A 1AUMA 2FVAA 1GXHA 3CPWO 4MRTC 5EJDA 3M1MA 2KW2A 2XXMA 4IZ6A 3DS4A 3GZMA 4COCA 2N6YA 2XZ1C 1VQPP 2L4BA 2K5XA 4U0DA 2QNWA 1VQLP 2Z45A 2ERHA 2MR7A 3P05A 1KLPA 2CWOA 3Q20A 1Q7YQ 1GXGA 1VQ4P 2ONTA 1VQOP 1IUQA 3CCVP 1N8RQ 1YITP 4U0CA 4WYMA 1F80D 4XFZA 2OTLP 2AF8A 1Z6MA 3CE7A 4DG9A 2PEQA 2KGEA 3G71P 2LL8A 3EJDA 3CMEP 5HGNA 2FQ1A 3CCMP 2KG6A 5F2NA 3LRYA 1EOQA 1JJ2O 2CNRA 1KQSO 4XRQA 3G1IA 3MGEA 2DGYA 1E0HA 1K73Q 3CC2P 2JBGA 4GR6A 1PEOA 2KG9A 2FAEA 1RNIA 2K0XA 1L0IA 1YJWP 2JO0A 1VQMP 5F2KA 2KODA 5BS1A 1NJIQ 3CC4P 3CCSP 2DNWA 4QNBA 5DCKA 1EIAA 1QVGO 2KGCA 1S72P 2N50A 2L9FA 2FHSC 1T8KA 2VLQA 1NQ4A 1VHNA 3CD6P 3DS5A 3CCJP 2EHTA 1M1KQ 1M90Q 4U0BA 5BS2A 1ZMBA 3H0DA 5F2OA 3CXCO 1EMVA 1BXIA 1FR2A 3DS2A 2KR5A 1Q81Q 2FADA 2EHSA 3GKLC 2K2QA 3DPHA 2LTEA 2AVAA 5KP8B 3DTJA 3G1GA 1AYIA 4XROA 1YHQP 1PEUA 2FQ2A 1A43A 2LKIA 2VLNA 2XV6A 1E6JP 2LF4A
chains in the Genus database with same CATH topology
1EOQA 3G21A 2Z46A 1JJ2O 2JYLA 1D1DA 1VQKP 1K8AQ 3G4SP 1RO2A 1KQSO 1VQ9P 1QVFO 3HZQA 4XRQA 1VQNP 3WBHA 1YIJP 5HGMA 3G1IA 3E2DA 2QEXP 2L6EA 3MGEA 4M0IA 1K9MQ 2JYGA 2DGYA 2PEKA 3CC7P 1VQ8P 3CMAP 1K73Q 3CC2P 5HGOA 2BHVA 4GR6A 1PEOA 3HYBA 1QRJA 4COPA 3CCEP 3G26A 3DS1A 1Q86Q 2PY8A 4IPYA 1RNIA 1Q82Q 4U0EA 3CCUP 2P9XA 2PEMA 2PEOA 1YJ9P 1KD1Q 5HGLA 1BAJA 2PEJA 1YJWP 3VRLC 3CCLP 2E1MA 2JO0A 4PH1A 2Z44A 1PEMA 1AUMA 3RG6C 1VQMP 2OTJP 3CPWO 1VQ7P 5F2KA 2KODA 5BS1A 1NJIQ 4U0AA 3M1MA 3CC4P 2XXMA 3DS4A 4QNBA 3CCSP 5DCKA 1EIAA 4COCA 1QVGO 4GR2A 2PEIA 1S72P 1VQPP 3B5IA 1A8OA 4U0DA 1VQLP 2Z45A 2M8PA 3P05A 3CD6P 3DS5A 3CCJP 2BQ1E 1M1KQ 1M90Q 3I55P 3G29A 1YI2P 2CWOA 2EIAA 3Q20A 5I4TG 5JPAA 1Q7YQ 3CCRP 4U0BA 5BS2A 3OW2O 1ZMBA 3H0DA 1VQ4P 5F2OA 4PH0A 2ONTA 3NTEA 3CXCO 1VQ6P 4U0FA 1VQOP 1IUQA 4XFYA 3DS3A 3CCVP 1N8RQ 1YITP 3DS2A 3DS0A 1M74A 2M8NA 2PENA 4XFXA 4U0CA 3I56P 4WYMA 2OARA 2QA4P 4XFZA 1Q81Q 2EG5A 2EFJA 2OTLP 1K30A 1M6NA 3DPHA 3G0VA 3G28A 3DTJA 3G1GA 1RO0A 1KC8Q 4XROA 2PEQA 2XT1A 3H4EA 2M8LA 1YHQP 1PEUA 3G6EP 1VQ5P 3G71P 2BUOA 3CCQP 1A43A 3CMEP 1M6EX 5HGNA 1PEQA 1W2BO 2XV6A 1E6JP 3CCMP 5F2NA 2LF4A 1YJNP 3LRYA 3H47A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCU P;  2OTL P;  1JJ2 O;  1YJ9 P;  3CD6 P;  1KD1 Q;  3CCJ P;  1YJW P;  1Q81 Q;  1M1K Q;  3CCL P;  1M90 Q;  1VQK P;  3I55 P;  1K8A Q;  1VQM P;  3G4S P;  1YI2 P;  2OTJ P;  1KQS O;  1Q7Y Q;  1VQ9 P;  3CPW O;  3CCR P;  1QVF O;  1VQ7 P;  1VQN P;  1KC8 Q;  1YIJ P;  3OW2 O;  1NJI Q;  1YHQ P;  1VQ4 P;  3G6E P;  1Q82 Q;  1VQ5 P;  1K9M Q;  3G71 P;  3CC4 P;  3CXC O;  3CCS P;  1VQO P;  3CC7 P;  1VQ6 P;  3CCQ P;  1QVG O;  1VQ8 P;  3CMA P;  1K73 Q;  3CCV P;  3CC2 P;  3CME P;  1N8R Q;  1YIT P;  1S72 P;  3CCE P;  1W2B O;  3I56 P;  1VQP P;  3CCM P;  1Q86 Q;  2QA4 P;  2QEX P;  1YJN P;  1VQL P; 
#chains in the Genus database with same CATH topology
 1ZNV A;  2JYL A;  1D1D A;  1RO2 A;  1QVF O;  2K93 A;  5HGM A;  3E2D A;  4M0I A;  2JU1 A;  3CMA P;  2BHV A;  2CQ8 A;  2LML A;  3HYB A;  1QRJ A;  1AF8 A;  3G26 A;  3GJN A;  4F37 A;  4NEO A;  3CCU P;  4PWV B;  1BAJ A;  1MZ8 A;  2PEJ A;  3VRL C;  3CCL P;  1PEM A;  2X2B A;  3RG6 C;  2OTJ P;  2FAC A;  2K0D X;  1UJZ A;  2GZG A;  4GR2 A;  4HKG A;  2PEI A;  3B5I A;  1A8O A;  1VKU A;  2BQ1 E;  2KWL A;  3I55 P;  3G29 A;  3NY7 B;  2GDX A;  5I4T G;  2EIA A;  2K94 A;  3GZL A;  3OW2 O;  2N5I A;  4BPH A;  4U0F A;  3DS3 A;  2K92 A;  4XFX A;  3I56 P;  2OAR A;  5KP7 B;  2LIW A;  2EG5 A;  2VSQ A;  2EFJ A;  2N6Z A;  1X3O A;  4UHP B;  2GDW A;  2MF4 A;  3G0V A;  1RO0 A;  1KC8 Q;  2XT1 A;  3H4E A;  2M8L A;  2MD9 A;  3G6E P;  1VQ5 P;  2BUO A;  2FQ0 A;  3CCQ P;  2KOQ A;  2VLO A;  1PEQ A;  1L0H A;  2KG8 A;  2KOR A;  1UNK A;  2Z46 A;  1ACP A;  2N98 A;  3G4S P;  1VQ9 P;  2LIU A;  1YIJ P;  2L6E A;  1OR5 A;  2PEK A;  2CG5 B;  1VQ8 P;  2GDY A;  2NO8 A;  2L0Q A;  4COP A;  3CCE P;  3DS1 A;  2JB0 A;  4IPY A;  2JQ4 A;  2P9X A;  2PEO A;  2FVF A;  2JAZ A;  1KD1 Q;  5HV8 A;  2MY5 A;  2E1M A;  2GZI A;  2Z44 A;  7CEI A;  2KOS A;  1VQ7 P;  4U0A A;  2AFD A;  1HY8 A;  2AFE A;  2M8P A;  3EJE A;  2XZ0 D;  2FVE A;  4H2W C;  2GYK A;  2LOL A;  1YI2 P;  5JPA A;  1DNY A;  3CCR P;  2N5H A;  5EW5 E;  4H2Y C;  4PH0 A;  1IMP A;  2K0Y A;  3NTE A;  2CGQ A;  2L22 A;  1VQ6 P;  2PNG A;  2JGP A;  4QKO A;  4XFY A;  3DS0 A;  1M74 A;  2M8N A;  2PEN A;  2WPT A;  2LPK A;  4BPG A;  2VLP A;  2QA4 P;  4PXH B;  4R0M A;  1GPJ A;  1K30 A;  1M6N A;  2MVV A;  2MVU A;  3G28 A;  2GZF A;  2KGD A;  3B4Q A;  2JU2 A;  2KGA A;  3LMO A;  1M6E X;  1W2B O;  5CZD B;  2QEX P;  1YJN P;  5KP6 B;  3H47 A;  2MR8 A;  1HQB A;  3G21 A;  4H2X C;  4BPF A;  2GZE A;  5HVC A;  1VQK P;  2GZJ A;  1K8A Q;  3HZQ A;  1VQN P;  3WBH A;  2KOP A;  1CEI A;  1K9M Q;  2JYG A;  4CA3 A;  3CC7 P;  1DV5 A;  3RG2 A;  5HGO A;  1Q86 Q;  2PY8 A;  1Q82 Q;  4U0E A;  3EJB A;  2KOO A;  2PEM A;  1YJ9 P;  2ROQ A;  3U43 A;  5HGL A;  2M5R A;  1IMQ A;  4PH1 A;  1AUM A;  2FVA A;  1GXH A;  3CPW O;  4MRT C;  5EJD A;  3M1M A;  2KW2 A;  2XXM A;  4IZ6 A;  3DS4 A;  3GZM A;  4COC A;  2N6Y A;  2XZ1 C;  1VQP P;  2L4B A;  2K5X A;  4U0D A;  2QNW A;  1VQL P;  2Z45 A;  2ERH A;  2MR7 A;  3P05 A;  1KLP A;  2CWO A;  3Q20 A;  1Q7Y Q;  1GXG A;  1VQ4 P;  2ONT A;  1VQO P;  1IUQ A;  3CCV P;  1N8R Q;  1YIT P;  4U0C A;  4WYM A;  1F80 D;  4XFZ A;  2OTL P;  2AF8 A;  1Z6M A;  3CE7 A;  4DG9 A;  2PEQ A;  2KGE A;  3G71 P;  2LL8 A;  3EJD A;  3CME P;  5HGN A;  2FQ1 A;  3CCM P;  2KG6 A;  5F2N A;  3LRY A;  1EOQ A;  1JJ2 O;  2CNR A;  1KQS O;  4XRQ A;  3G1I A;  3MGE A;  2DGY A;  1E0H A;  1K73 Q;  3CC2 P;  2JBG A;  4GR6 A;  1PEO A;  2KG9 A;  2FAE A;  1RNI A;  2K0X A;  1L0I A;  1YJW P;  2JO0 A;  1VQM P;  5F2K A;  2KOD A;  5BS1 A;  1NJI Q;  3CC4 P;  3CCS P;  2DNW A;  4QNB A;  5DCK A;  1EIA A;  1QVG O;  2KGC A;  1S72 P;  2N50 A;  2L9F A;  2FHS C;  1T8K A;  2VLQ A;  1NQ4 A;  1VHN A;  3CD6 P;  3DS5 A;  3CCJ P;  2EHT A;  1M1K Q;  1M90 Q;  4U0B A;  5BS2 A;  1ZMB A;  3H0D A;  5F2O A;  3CXC O;  1EMV A;  1BXI A;  1FR2 A;  3DS2 A;  2KR5 A;  1Q81 Q;  2FAD A;  2EHS A;  3GKL C;  2K2Q A;  3DPH A;  2LTE A;  2AVA A;  5KP8 B;  3DTJ A;  3G1G A;  1AYI A;  4XRO A;  1YHQ P;  1PEU A;  2FQ2 A;  1A43 A;  2LKI A;  2VLN A;  2XV6 A;  1E6J P;  2LF4 A; 
#chains in the Genus database with same CATH homology
 1EOQ A;  3G21 A;  2Z46 A;  1JJ2 O;  2JYL A;  1D1D A;  1VQK P;  1K8A Q;  3G4S P;  1RO2 A;  1KQS O;  1VQ9 P;  1QVF O;  3HZQ A;  4XRQ A;  1VQN P;  3WBH A;  1YIJ P;  5HGM A;  3G1I A;  3E2D A;  2QEX P;  2L6E A;  3MGE A;  4M0I A;  1K9M Q;  2JYG A;  2DGY A;  2PEK A;  3CC7 P;  1VQ8 P;  3CMA P;  1K73 Q;  3CC2 P;  5HGO A;  2BHV A;  4GR6 A;  1PEO A;  3HYB A;  1QRJ A;  4COP A;  3CCE P;  3G26 A;  3DS1 A;  1Q86 Q;  2PY8 A;  4IPY A;  1RNI A;  1Q82 Q;  4U0E A;  3CCU P;  2P9X A;  2PEM A;  2PEO A;  1YJ9 P;  1KD1 Q;  5HGL A;  1BAJ A;  2PEJ A;  1YJW P;  3VRL C;  3CCL P;  2E1M A;  2JO0 A;  4PH1 A;  2Z44 A;  1PEM A;  1AUM A;  3RG6 C;  1VQM P;  2OTJ P;  3CPW O;  1VQ7 P;  5F2K A;  2KOD A;  5BS1 A;  1NJI Q;  4U0A A;  3M1M A;  3CC4 P;  2XXM A;  3DS4 A;  4QNB A;  3CCS P;  5DCK A;  1EIA A;  4COC A;  1QVG O;  4GR2 A;  2PEI A;  1S72 P;  1VQP P;  3B5I A;  1A8O A;  4U0D A;  1VQL P;  2Z45 A;  2M8P A;  3P05 A;  3CD6 P;  3DS5 A;  3CCJ P;  2BQ1 E;  1M1K Q;  1M90 Q;  3I55 P;  3G29 A;  1YI2 P;  2CWO A;  2EIA A;  3Q20 A;  5I4T G;  5JPA A;  1Q7Y Q;  3CCR P;  4U0B A;  5BS2 A;  3OW2 O;  1ZMB A;  3H0D A;  1VQ4 P;  5F2O A;  4PH0 A;  2ONT A;  3NTE A;  3CXC O;  1VQ6 P;  4U0F A;  1VQO P;  1IUQ A;  4XFY A;  3DS3 A;  3CCV P;  1N8R Q;  1YIT P;  3DS2 A;  3DS0 A;  1M74 A;  2M8N A;  2PEN A;  4XFX A;  4U0C A;  3I56 P;  4WYM A;  2OAR A;  2QA4 P;  4XFZ A;  1Q81 Q;  2EG5 A;  2EFJ A;  2OTL P;  1K30 A;  1M6N A;  3DPH A;  3G0V A;  3G28 A;  3DTJ A;  3G1G A;  1RO0 A;  1KC8 Q;  4XRO A;  2PEQ A;  2XT1 A;  3H4E A;  2M8L A;  1YHQ P;  1PEU A;  3G6E P;  1VQ5 P;  3G71 P;  2BUO A;  3CCQ P;  1A43 A;  3CME P;  1M6E X;  5HGN A;  1PEQ A;  1W2B O;  2XV6 A;  1E6J P;  3CCM P;  5F2N A;  2LF4 A;  1YJN P;  3LRY A;  3H47 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...