2PEQA

Crystal structure of rbcx, crystal form ii
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
109
structure length
109
Chain Sequence
MEFKKVAKETAITLQSYLTYQAVRLISQQLSETNPGQAIWLGEFSKRHPIQESDLYLEAMMLENKELVLRILTVRENLAEGVLEFLPEMVLSQIKQSNGNHRRSLLERL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords ORF134
publication title Structure and Function of RbcX, an Assembly Chaperone for Hexadecameric Rubisco.
pubmed doi rcsb
source organism Synechococcus sp.
total genus 49
structure length 109
sequence length 109
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02341 RcbX RbcX protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.210 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2peqA00
5BS2A 5BS1A 2PENA 2PY8A 3HYBA 2PEOA 2PEMA 3Q20A 2Z45A 2Z44A 4GR2A 2PEQA 2PEKA 2PEJA 4GR6A 2PEIA 3RG6C 2Z46A
chains in the Genus database with same CATH superfamily
3E2DA 1IMQA 2KGDA 2AF8A 1S72P 2KR5A 2PY8A 3NTEA 4DG9A 1ACPA 2KGEA 1FR2A 4XRQA 3OW2O 2X2BA 2CGQA 2DGYA 1D1DA 2P9XA 1GXGA 1VQ9P 2KG6A 3P05A 1EOQA 3EJEA 1GPJA 3CPWO 2GZJA 1EMVA 3GZLA 5HV8A 3CCLP 5DCKA 4U0EA 2KG9A 2XZ0D 2PEJA 1VQPP 4PXHB 1VQKP 3DPHA 3EJBA 2KOPA 2KORA 3M1MA 1A43A 4COCA 1RO0A 4XFZA 3CMAP 1IUQA 2PEQA 2E1MA 3EJDA 5HGMA 1VHNA 2GDWA 1HY8A 3CCEP 2N98A 2KWLA 4R0MA 3CCRP 1VQ8P 2QEXP 5KP6B 4M0IA 2JBGA 2CG5B 2EIAA 2LOLA 3DS3A 1RNIA 2JU2A 1KD1Q 3G28A 3RG6C 3CC4P 2QA4P 2EG5A 3VRLC 1VQ5P 2PENA 4QKOA 4U0BA 1Q86Q 1BXIA 1AYIA 2QNWA 3LRYA 2PEMA 1VKUA 2LF4A 3RG2A 2LIUA 2XT1A 2K93A 2K0DX 2JGPA 2JO0A 1ZNVA 1M6EX 1IMPA 5I4TG 1A8OA 3CCQP 3MGEA 2AVAA 4NEOA 2KGCA 2GZIA 1F80D 2M8PA 1K8AQ 1L0HA 4GR2A 1L0IA 2KOOA 5HGLA 2M8NA 1K30A 5F2OA 3G26A 4H2YC 1QVFO 5F2KA 4XROA 2LKIA 3G6EP 1M1KQ 1AUMA 5HGOA 2MVVA 3DS1A 2EFJA 2JU1A 7CEIA 1VQOP 2K2QA 3CCMP 2MY5A 2OTLP 1YITP 1YJ9P 4WYMA 4XFYA 2PEIA 2WPTA 3DS4A 1E0HA 2L6EA 2VLOA 4H2XC 4XFXA 2MD9A 4UHPB 3GKLC 2KGAA 2GYKA 3CD6P 2GZFA 2KOSA 3NY7B 2CQ8A 2GDXA 2MR7A 3CXCO 3CCJP 1JJ2O 2N5HA 1GXHA 3G29A 2ROQA 3I56P 3CC7P 2L0QA 2N5IA 1RO2A 1W2BO 1BAJA 3GJNA 2K94A 4COPA 2FQ0A 2LMLA 4PWVB 2JB0A 1VQNP 4CA3A 4GR6A 2AFEA 2VSQA 3DS0A 4MRTC 2FQ2A 2FAEA 3LMOA 2L9FA 3B5IA 3CCUP 2L22A 1Q81Q 3CC2P 3CMEP 2LTEA 5BS1A 1ZMBA 2LPKA 3G21A 5BS2A 2XXMA 3H4EA 1YI2P 3DS5A 2FACA 3Q20A 1YJNP 2GDYA 5CZDB 2FQ1A 3DTJA 2CNRA 2ONTA 1YIJP 3G1IA 5F2NA 2PEOA 1KQSO 4H2WC 2MVUA 1KC8Q 2LIWA 1K73Q 2OTJP 4IPYA 2VLNA 1VQ4P 5HGNA 3CE7A 2KODA 1X3OA 2JQ4A 4QNBA 1QVGO 2M5RA 2VLPA 2NO8A 2BHVA 1K9MQ 1AF8A 1Z6MA 1YJWP 2N6YA 2PEKA 2FVFA 2EHSA 1Q82Q 5JPAA 5HVCA 1CEIA 2N50A 2KW2A 1NJIQ 1VQLP 1DNYA 4PH0A 1M90Q 2JAZA 2JYGA 2Z46A 4U0DA 1M74A 3H0DA 1EIAA 5KP7B 1NQ4A 3CCVP 2JYLA 1OR5A 4HKGA 2MF4A 1VQ7P 2M8LA 2KOQA 1MZ8A 3G1GA 2CWOA 2K92A 3HYBA 4BPGA 2MR8A 3G71P 4BPHA 2XZ1C 3GZMA 4BPFA 3I55P 2FVAA 3H47A 3U43A 1DV5A 2GZEA 1N8RQ 2DNWA 3DS2A 3WBHA 2FVEA 2FHSC 1UJZA 1HQBA 1M6NA 2L4BA 2K0XA 5EW5E 2ERHA 2OARA 2LL8A 2XV6A 4IZ6A 1VQ6P 2K5XA 1QRJA 2AFDA 5KP8B 3CCSP 3HZQA 2GZGA 2FADA 2VLQA 1E6JP 2KG8A 1UNKA 2Z45A 1KLPA 4F37A 4U0AA 3G4SP 1VQMP 2N6ZA 2PNGA 4U0CA 3B4QA 1T8KA 5EJDA 1Q7YQ 2Z44A 4PH1A 2EHTA 3G0VA 2BUOA 4U0FA 2K0YA 1YHQP
chains in the Genus database with same CATH topology
2LF4A 1RO2A 3E2DA 1W2BO 1BAJA 1M90Q 2XT1A 4COPA 2JYGA 2Z46A 4U0DA 1M74A 1S72P 2PY8A 2JO0A 3H0DA 1EIAA 3NTEA 1VQNP 1M6EX 4GR6A 5I4TG 1A8OA 3CCVP 3DS0A 3CC4P 3CCQP 3MGEA 2JYLA 4XRQA 3OW2O 3B5IA 3CCUP 1VQ7P 1Q81Q 2M8LA 2M8PA 2DGYA 4GR2A 1K8AQ 3CC2P 3CMEP 1D1DA 2P9XA 1VQ9P 5BS1A 1ZMBA 3P05A 5HGLA 1EOQA 3G1GA 2CWOA 2M8NA 1K30A 3CPWO 3G21A 3HYBA 5BS2A 5F2OA 3G26A 3G71P 2XXMA 3H4EA 1YI2P 3DS5A 3I55P 3H47A 1N8RQ 1QVFO 3CCLP 3DS2A 3Q20A 5F2KA 5DCKA 3WBHA 4U0EA 4XROA 1YJNP 3G6EP 2PEJA 1VQPP 1M1KQ 1AUMA 5HGOA 3DTJA 1VQKP 3DPHA 2ONTA 3DS1A 1M6NA 2EFJA 3M1MA 1VQOP 1A43A 1YIJP 4COCA 3G1IA 3CCMP 5F2NA 2PEOA 1KQSO 2OARA 2XV6A 1RO0A 1KC8Q 2OTLP 1YITP 1YJ9P 4XFZA 1K73Q 4WYMA 1VQ6P 2OTJP 4IPYA 3CMAP 1QRJA 4XFYA 1IUQA 2PEQA 2E1MA 2PEIA 5HGMA 3DS4A 3CCSP 3HZQA 3CCEP 2L6EA 1VQ4P 3CCRP 1VQ8P 2QEXP 1E6JP 4XFXA 2Z45A 4M0IA 5HGNA 2KODA 4U0AA 3G4SP 1VQMP 2EIAA 4U0CA 3DS3A 4QNBA 1RNIA 1QVGO 3CD6P 2BHVA 1Q7YQ 1K9MQ 1KD1Q 3G28A 1YJWP 2Z44A 2PEKA 3RG6C 3CXCO 3CCJP 2QA4P 1Q82Q 1JJ2O 2EG5A 3VRLC 3G29A 2PENA 4PH1A 4U0BA 1VQ5P 1Q86Q 3G0VA 3I56P 3CC7P 2BUOA 3LRYA 5JPAA 4U0FA 2PEMA 1NJIQ 1VQLP 4PH0A 1YHQP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BS2 A;  5BS1 A;  2PEN A;  2PY8 A;  3HYB A;  2PEO A;  2PEM A;  3Q20 A;  2Z45 A;  2Z44 A;  4GR2 A;  2PEQ A;  2PEK A;  2PEJ A;  4GR6 A;  2PEI A;  3RG6 C;  2Z46 A; 
#chains in the Genus database with same CATH topology
 3E2D A;  1IMQ A;  2KGD A;  2AF8 A;  1S72 P;  2KR5 A;  2PY8 A;  3NTE A;  4DG9 A;  1ACP A;  2KGE A;  1FR2 A;  4XRQ A;  3OW2 O;  2X2B A;  2CGQ A;  2DGY A;  1D1D A;  2P9X A;  1GXG A;  1VQ9 P;  2KG6 A;  3P05 A;  1EOQ A;  3EJE A;  1GPJ A;  3CPW O;  2GZJ A;  1EMV A;  3GZL A;  5HV8 A;  3CCL P;  5DCK A;  4U0E A;  2KG9 A;  2XZ0 D;  2PEJ A;  1VQP P;  4PXH B;  1VQK P;  3DPH A;  3EJB A;  2KOP A;  2KOR A;  3M1M A;  1A43 A;  4COC A;  1RO0 A;  4XFZ A;  3CMA P;  1IUQ A;  2PEQ A;  2E1M A;  3EJD A;  5HGM A;  1VHN A;  2GDW A;  1HY8 A;  3CCE P;  2N98 A;  2KWL A;  4R0M A;  3CCR P;  1VQ8 P;  2QEX P;  5KP6 B;  4M0I A;  2JBG A;  2CG5 B;  2EIA A;  2LOL A;  3DS3 A;  1RNI A;  2JU2 A;  1KD1 Q;  3G28 A;  3RG6 C;  3CC4 P;  2QA4 P;  2EG5 A;  3VRL C;  1VQ5 P;  2PEN A;  4QKO A;  4U0B A;  1Q86 Q;  1BXI A;  1AYI A;  2QNW A;  3LRY A;  2PEM A;  1VKU A;  2LF4 A;  3RG2 A;  2LIU A;  2XT1 A;  2K93 A;  2K0D X;  2JGP A;  2JO0 A;  1ZNV A;  1M6E X;  1IMP A;  5I4T G;  1A8O A;  3CCQ P;  3MGE A;  2AVA A;  4NEO A;  2KGC A;  2GZI A;  1F80 D;  2M8P A;  1K8A Q;  1L0H A;  4GR2 A;  1L0I A;  2KOO A;  5HGL A;  2M8N A;  1K30 A;  5F2O A;  3G26 A;  4H2Y C;  1QVF O;  5F2K A;  4XRO A;  2LKI A;  3G6E P;  1M1K Q;  1AUM A;  5HGO A;  2MVV A;  3DS1 A;  2EFJ A;  2JU1 A;  7CEI A;  1VQO P;  2K2Q A;  3CCM P;  2MY5 A;  2OTL P;  1YIT P;  1YJ9 P;  4WYM A;  4XFY A;  2PEI A;  2WPT A;  3DS4 A;  1E0H A;  2L6E A;  2VLO A;  4H2X C;  4XFX A;  2MD9 A;  4UHP B;  3GKL C;  2KGA A;  2GYK A;  3CD6 P;  2GZF A;  2KOS A;  3NY7 B;  2CQ8 A;  2GDX A;  2MR7 A;  3CXC O;  3CCJ P;  1JJ2 O;  2N5H A;  1GXH A;  3G29 A;  2ROQ A;  3I56 P;  3CC7 P;  2L0Q A;  2N5I A;  1RO2 A;  1W2B O;  1BAJ A;  3GJN A;  2K94 A;  4COP A;  2FQ0 A;  2LML A;  4PWV B;  2JB0 A;  1VQN P;  4CA3 A;  4GR6 A;  2AFE A;  2VSQ A;  3DS0 A;  4MRT C;  2FQ2 A;  2FAE A;  3LMO A;  2L9F A;  3B5I A;  3CCU P;  2L22 A;  1Q81 Q;  3CC2 P;  3CME P;  2LTE A;  5BS1 A;  1ZMB A;  2LPK A;  3G21 A;  5BS2 A;  2XXM A;  3H4E A;  1YI2 P;  3DS5 A;  2FAC A;  3Q20 A;  1YJN P;  2GDY A;  5CZD B;  2FQ1 A;  3DTJ A;  2CNR A;  2ONT A;  1YIJ P;  3G1I A;  5F2N A;  2PEO A;  1KQS O;  4H2W C;  2MVU A;  1KC8 Q;  2LIW A;  1K73 Q;  2OTJ P;  4IPY A;  2VLN A;  1VQ4 P;  5HGN A;  3CE7 A;  2KOD A;  1X3O A;  2JQ4 A;  4QNB A;  1QVG O;  2M5R A;  2VLP A;  2NO8 A;  2BHV A;  1K9M Q;  1AF8 A;  1Z6M A;  1YJW P;  2N6Y A;  2PEK A;  2FVF A;  2EHS A;  1Q82 Q;  5JPA A;  5HVC A;  1CEI A;  2N50 A;  2KW2 A;  1NJI Q;  1VQL P;  1DNY A;  4PH0 A;  1M90 Q;  2JAZ A;  2JYG A;  2Z46 A;  4U0D A;  1M74 A;  3H0D A;  1EIA A;  5KP7 B;  1NQ4 A;  3CCV P;  2JYL A;  1OR5 A;  4HKG A;  2MF4 A;  1VQ7 P;  2M8L A;  2KOQ A;  1MZ8 A;  3G1G A;  2CWO A;  2K92 A;  3HYB A;  4BPG A;  2MR8 A;  3G71 P;  4BPH A;  2XZ1 C;  3GZM A;  4BPF A;  3I55 P;  2FVA A;  3H47 A;  3U43 A;  1DV5 A;  2GZE A;  1N8R Q;  2DNW A;  3DS2 A;  3WBH A;  2FVE A;  2FHS C;  1UJZ A;  1HQB A;  1M6N A;  2L4B A;  2K0X A;  5EW5 E;  2ERH A;  2OAR A;  2LL8 A;  2XV6 A;  4IZ6 A;  1VQ6 P;  2K5X A;  1QRJ A;  2AFD A;  5KP8 B;  3CCS P;  3HZQ A;  2GZG A;  2FAD A;  2VLQ A;  1E6J P;  2KG8 A;  1UNK A;  2Z45 A;  1KLP A;  4F37 A;  4U0A A;  3G4S P;  1VQM P;  2N6Z A;  2PNG A;  4U0C A;  3B4Q A;  1T8K A;  5EJD A;  1Q7Y Q;  2Z44 A;  4PH1 A;  2EHT A;  3G0V A;  2BUO A;  4U0F A;  2K0Y A;  1YHQ P; 
#chains in the Genus database with same CATH homology
 2LF4 A;  1RO2 A;  3E2D A;  1W2B O;  1BAJ A;  1M90 Q;  2XT1 A;  4COP A;  2JYG A;  2Z46 A;  4U0D A;  1M74 A;  1S72 P;  2PY8 A;  2JO0 A;  3H0D A;  1EIA A;  3NTE A;  1VQN P;  1M6E X;  4GR6 A;  5I4T G;  1A8O A;  3CCV P;  3DS0 A;  3CC4 P;  3CCQ P;  3MGE A;  2JYL A;  4XRQ A;  3OW2 O;  3B5I A;  3CCU P;  1VQ7 P;  1Q81 Q;  2M8L A;  2M8P A;  2DGY A;  4GR2 A;  1K8A Q;  3CC2 P;  3CME P;  1D1D A;  2P9X A;  1VQ9 P;  5BS1 A;  1ZMB A;  3P05 A;  5HGL A;  1EOQ A;  3G1G A;  2CWO A;  2M8N A;  1K30 A;  3CPW O;  3G21 A;  3HYB A;  5BS2 A;  5F2O A;  3G26 A;  3G71 P;  2XXM A;  3H4E A;  1YI2 P;  3DS5 A;  3I55 P;  3H47 A;  1N8R Q;  1QVF O;  3CCL P;  3DS2 A;  3Q20 A;  5F2K A;  5DCK A;  3WBH A;  4U0E A;  4XRO A;  1YJN P;  3G6E P;  2PEJ A;  1VQP P;  1M1K Q;  1AUM A;  5HGO A;  3DTJ A;  1VQK P;  3DPH A;  2ONT A;  3DS1 A;  1M6N A;  2EFJ A;  3M1M A;  1VQO P;  1A43 A;  1YIJ P;  4COC A;  3G1I A;  3CCM P;  5F2N A;  2PEO A;  1KQS O;  2OAR A;  2XV6 A;  1RO0 A;  1KC8 Q;  2OTL P;  1YIT P;  1YJ9 P;  4XFZ A;  1K73 Q;  4WYM A;  1VQ6 P;  2OTJ P;  4IPY A;  3CMA P;  1QRJ A;  4XFY A;  1IUQ A;  2PEQ A;  2E1M A;  2PEI A;  5HGM A;  3DS4 A;  3CCS P;  3HZQ A;  3CCE P;  2L6E A;  1VQ4 P;  3CCR P;  1VQ8 P;  2QEX P;  1E6J P;  4XFX A;  2Z45 A;  4M0I A;  5HGN A;  2KOD A;  4U0A A;  3G4S P;  1VQM P;  2EIA A;  4U0C A;  3DS3 A;  4QNB A;  1RNI A;  1QVG O;  3CD6 P;  2BHV A;  1Q7Y Q;  1K9M Q;  1KD1 Q;  3G28 A;  1YJW P;  2Z44 A;  2PEK A;  3RG6 C;  3CXC O;  3CCJ P;  2QA4 P;  1Q82 Q;  1JJ2 O;  2EG5 A;  3VRL C;  3G29 A;  2PEN A;  4PH1 A;  4U0B A;  1VQ5 P;  1Q86 Q;  3G0V A;  3I56 P;  3CC7 P;  2BUO A;  3LRY A;  5JPA A;  4U0F A;  2PEM A;  1NJI Q;  1VQL P;  4PH0 A;  1YHQ P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...