2PEQA

Crystal structure of rbcx, crystal form ii
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
109
structure length
109
Chain Sequence
MEFKKVAKETAITLQSYLTYQAVRLISQQLSETNPGQAIWLGEFSKRHPIQESDLYLEAMMLENKELVLRILTVRENLAEGVLEFLPEMVLSQIKQSNGNHRRSLLERL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ORF134
publication title Structure and Function of RbcX, an Assembly Chaperone for Hexadecameric Rubisco.
pubmed doi rcsb
source organism Synechococcus sp.
molecule tags Chaperone
total genus 49
structure length 109
sequence length 109
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02341 RcbX RbcX protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.210 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2peqA00
2Z45A 2PEJA 2PEKA 2Z46A 3Q20A 4GR2A 2PEIA 5BS2A 4GR6A 2PY8A 2PENA 3RG6C 2PEOA 2Z44A 3HYBA 5BS1A 2PEMA 2PEQA
chains in the Genus database with same CATH superfamily
1VQPP 1VQ5P 1Q82Q 2JYGA 2M8NA 3DS2A 3NY7B 2KOOA 2XZ1C 1M6EX 1DV5A 2FADA 5F2OA 1HY8A 2KGAA 2AFDA 3HZQA 2LMLA 1VHNA 2EG5A 2L9FA 2L6EA 2OARA 1FR2A 5KP6B 1ACPA 2JU2A 1NJIQ 2VLQA 4DG9A 2N6ZA 5BS2A 2EHTA 3LRYA 5HGLA 2KGEA 2Z46A 2GZEA 2CNRA 2JB0A 3NTEA 2FHSC 2FVEA 3HYBA 5F2NA 2L0QA 4U0DA 3B5IA 7CEIA 3CCUP 1W2BO 2CG5B 1VQ6P 3Q20A 1F80D 2MD9A 1QRJA 3G1IA 2KGCA 2DNWA 2PEQA 2MR8A 2N98A 2K92A 2JQ4A 1AUMA 4PH1A 2ERHA 2GYKA 3DPHA 2GDXA 1N8RQ 2KR5A 4MRTC 1A8OA 2K0YA 1YJWP 2BUOA 4H2WC 1K73Q 1RO2A 1Q81Q 4UHPB 1KC8Q 1RO0A 1VQKP 1KLPA 1M74A 2OTJP 1QVGO 2XXMA 1AF8A 2K93A 3CCLP 4COCA 2M5RA 2GZGA 3CCMP 3I56P 1L0HA 2KODA 2VLOA 3EJDA 3G28A 3EJEA 2KOSA 4PWVB 1ZMBA 4H2XC 2MY5A 3DS1A 3CCVP 4U0AA 1GXHA 2MVVA 1VQMP 5DCKA 4COPA 3CCQP 4XFYA 5EJDA 4U0FA 1YJ9P 1VQ8P 3GJNA 1T8KA 1VKUA 2VSQA 2JGPA 2N6YA 2LPKA 1NQ4A 1EMVA 1BAJA 3H0DA 2K5XA 1E0HA 1IUQA 4GR6A 5HVCA 5HGMA 2XV6A 1UNKA 4U0EA 4U0CA 1VQ9P 3GZMA 2EFJA 3G6EP 2M8PA 4XROA 5HGOA 2K2QA 4QKOA 1Q86Q 1GXGA 1K30A 3H4EA 2K0XA 3DS5A 1UJZA 3G0VA 3G26A 2MVUA 2ROQA 1VQLP 4XFXA 3CCRP 1YITP 2LOLA 4BPHA 2VLNA 1VQ7P 2AFEA 2KGDA 3G71P 2LL8A 4WYMA 2PEOA 5BS1A 2AF8A 2LIUA 2N5IA 2X2BA 1IMQA 2K94A 5KP7B 3GZLA 5JPAA 1BXIA 5F2KA 3CPWO 1VQ4P 2OTLP 3CXCO 1JJ2O 2QNWA 3DS3A 2PEIA 3G1GA 2KG8A 4CA3A 3MGEA 2FQ0A 2EIAA 3OW2O 3G4SP 2NO8A 2XT1A 1E6JP 2PEMA 1EIAA 2FQ2A 3U43A 2GZFA 3CD6P 2EHSA 1OR5A 3M1MA 3CMEP 4R0MA 1ZNVA 2PY8A 3LMOA 2BHVA 2N5HA 1EOQA 4XRQA 1KD1Q 2QA4P 3CC4P 1VQOP 4QNBA 4F37A 2MR7A 2KORA 2JU1A 4BPFA 2GZJA 2XZ0D 2JO0A 3CC2P 2M8LA 3GKLC 4H2YC 2LKIA 3P05A 1L0IA 2FQ1A 4IZ6A 1IMPA 2FACA 2KOQA 1M6NA 2FAEA 2LIWA 5HV8A 4XFZA 2ONTA 2KG6A 3RG2A 1Z6MA 3VRLC 1VQNP 2P9XA 2Z44A 3CCSP 1QVFO 3G21A 5CZDB 2MF4A 2JAZA 2JBGA 1CEIA 2N50A 2AVAA 5KP8B 2QEXP 2WPTA 4NEOA 2PENA 1KQSO 2FVAA 2CWOA 1S72P 5I4TG 3CCJP 3CMAP 1M90Q 1K8AQ 5HGNA 1M1KQ 3B4QA 2KG9A 5EW5E 1A43A 2JYLA 3E2DA 1MZ8A 1K9MQ 2DGYA 1X3OA 4HKGA 3CCEP 2KWLA 1AYIA 2KOPA 1YIJP 1Q7YQ 4BPGA 2L22A 3DS0A 2PEKA 2L4BA 1RNIA 4M0IA 3DS4A 4U0BA 1YHQP 3CC7P 3I55P 4IPYA 2GDYA 2K0DX 4GR2A 4PXHB 2CGQA 2LTEA 3DTJA 4PH0A 2KW2A 1HQBA 1YI2P 1YJNP 2CQ8A 3RG6C 2GZIA 2E1MA 2Z45A 3WBHA 2PEJA 2PNGA 3H47A 2GDWA 1D1DA 2LF4A 1GPJA 3EJBA 3CE7A 2VLPA 2FVFA 3G29A 1DNYA
chains in the Genus database with same CATH topology
1QVGO 3CCSP 4WYMA 2XXMA 1VQPP 1VQ5P 2P9XA 1Q82Q 1QVFO 2JYGA 2M8NA 3G21A 2PEOA 3DS2A 5BS1A 3CCLP 1M6EX 4COCA 5F2OA 2QEXP 3HZQA 3CCMP 2EG5A 3I56P 2PENA 2L6EA 2OARA 1KQSO 2KODA 5JPAA 3G28A 1NJIQ 2CWOA 1S72P 1ZMBA 5I4TG 5F2KA 3DS1A 3CCVP 4U0AA 3CCJP 3CPWO 1VQ4P 5BS2A 3CMAP 2OTLP 3CXCO 1JJ2O 3LRYA 5HGLA 3DS3A 1M90Q 1VQMP 5DCKA 4COPA 3CCQP 4XFYA 2Z46A 2PEIA 1K8AQ 3G1GA 5HGNA 1M1KQ 4U0FA 1YJ9P 1VQ8P 1A43A 3NTEA 3HYBA 3MGEA 5F2NA 2JYLA 3E2DA 1K9MQ 4U0DA 2EIAA 3B5IA 3OW2O 2DGYA 3G4SP 3CCUP 2XT1A 1E6JP 2PEMA 1W2BO 3CCEP 1BAJA 1EIAA 1VQ6P 3Q20A 3H0DA 1IUQA 4GR6A 1YIJP 5HGMA 1Q7YQ 2XV6A 3CD6P 1QRJA 4U0EA 4U0CA 3G1IA 1VQ9P 3DS0A 3M1MA 2PEKA 3CMEP 1RNIA 2EFJA 3G6EP 4M0IA 2M8PA 2PY8A 2PEQA 3DS4A 4U0BA 4XROA 2BHVA 1YHQP 3CC7P 1AUMA 1EOQA 5HGOA 3I55P 4PH1A 4XRQA 1Q86Q 1KD1Q 4IPYA 2QA4P 4QNBA 1VQOP 3CC4P 4GR2A 3DPHA 1K30A 3H4EA 2JO0A 3CC2P 3DS5A 2M8LA 3DTJA 1N8RQ 3G0VA 4PH0A 3G26A 3P05A 1VQLP 4XFXA 1YI2P 1M6NA 1A8OA 3CCRP 1YJNP 4XFZA 2ONTA 1YITP 1YJWP 3RG6C 2BUOA 2E1MA 2Z45A 1VQ7P 3WBHA 2PEJA 1K73Q 1RO2A 3H47A 1Q81Q 1KC8Q 3G71P 1RO0A 1D1DA 2LF4A 1VQKP 3VRLC 1M74A 1VQNP 3G29A 2OTJP 2Z44A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z45 A;  2PEJ A;  2PEK A;  2Z46 A;  3Q20 A;  4GR2 A;  2PEI A;  5BS2 A;  4GR6 A;  2PY8 A;  2PEN A;  3RG6 C;  2PEO A;  2Z44 A;  3HYB A;  5BS1 A;  2PEM A;  2PEQ A; 
#chains in the Genus database with same CATH topology
 1VQP P;  1VQ5 P;  1Q82 Q;  2JYG A;  2M8N A;  3DS2 A;  3NY7 B;  2KOO A;  2XZ1 C;  1M6E X;  1DV5 A;  2FAD A;  5F2O A;  1HY8 A;  2KGA A;  2AFD A;  3HZQ A;  2LML A;  1VHN A;  2EG5 A;  2L9F A;  2L6E A;  2OAR A;  1FR2 A;  5KP6 B;  1ACP A;  2JU2 A;  1NJI Q;  2VLQ A;  4DG9 A;  2N6Z A;  5BS2 A;  2EHT A;  3LRY A;  5HGL A;  2KGE A;  2Z46 A;  2GZE A;  2CNR A;  2JB0 A;  3NTE A;  2FHS C;  2FVE A;  3HYB A;  5F2N A;  2L0Q A;  4U0D A;  3B5I A;  7CEI A;  3CCU P;  1W2B O;  2CG5 B;  1VQ6 P;  3Q20 A;  1F80 D;  2MD9 A;  1QRJ A;  3G1I A;  2KGC A;  2DNW A;  2PEQ A;  2MR8 A;  2N98 A;  2K92 A;  2JQ4 A;  1AUM A;  4PH1 A;  2ERH A;  2GYK A;  3DPH A;  2GDX A;  1N8R Q;  2KR5 A;  4MRT C;  1A8O A;  2K0Y A;  1YJW P;  2BUO A;  4H2W C;  1K73 Q;  1RO2 A;  1Q81 Q;  4UHP B;  1KC8 Q;  1RO0 A;  1VQK P;  1KLP A;  1M74 A;  2OTJ P;  1QVG O;  2XXM A;  1AF8 A;  2K93 A;  3CCL P;  4COC A;  2M5R A;  2GZG A;  3CCM P;  3I56 P;  1L0H A;  2KOD A;  2VLO A;  3EJD A;  3G28 A;  3EJE A;  2KOS A;  4PWV B;  1ZMB A;  4H2X C;  2MY5 A;  3DS1 A;  3CCV P;  4U0A A;  1GXH A;  2MVV A;  1VQM P;  5DCK A;  4COP A;  3CCQ P;  4XFY A;  5EJD A;  4U0F A;  1YJ9 P;  1VQ8 P;  3GJN A;  1T8K A;  1VKU A;  2VSQ A;  2JGP A;  2N6Y A;  2LPK A;  1NQ4 A;  1EMV A;  1BAJ A;  3H0D A;  2K5X A;  1E0H A;  1IUQ A;  4GR6 A;  5HVC A;  5HGM A;  2XV6 A;  1UNK A;  4U0E A;  4U0C A;  1VQ9 P;  3GZM A;  2EFJ A;  3G6E P;  2M8P A;  4XRO A;  5HGO A;  2K2Q A;  4QKO A;  1Q86 Q;  1GXG A;  1K30 A;  3H4E A;  2K0X A;  3DS5 A;  1UJZ A;  3G0V A;  3G26 A;  2MVU A;  2ROQ A;  1VQL P;  4XFX A;  3CCR P;  1YIT P;  2LOL A;  4BPH A;  2VLN A;  1VQ7 P;  2AFE A;  2KGD A;  3G71 P;  2LL8 A;  4WYM A;  2PEO A;  5BS1 A;  2AF8 A;  2LIU A;  2N5I A;  2X2B A;  1IMQ A;  2K94 A;  5KP7 B;  3GZL A;  5JPA A;  1BXI A;  5F2K A;  3CPW O;  1VQ4 P;  2OTL P;  3CXC O;  1JJ2 O;  2QNW A;  3DS3 A;  2PEI A;  3G1G A;  2KG8 A;  4CA3 A;  3MGE A;  2FQ0 A;  2EIA A;  3OW2 O;  3G4S P;  2NO8 A;  2XT1 A;  1E6J P;  2PEM A;  1EIA A;  2FQ2 A;  3U43 A;  2GZF A;  3CD6 P;  2EHS A;  1OR5 A;  3M1M A;  3CME P;  4R0M A;  1ZNV A;  2PY8 A;  3LMO A;  2BHV A;  2N5H A;  1EOQ A;  4XRQ A;  1KD1 Q;  2QA4 P;  3CC4 P;  1VQO P;  4QNB A;  4F37 A;  2MR7 A;  2KOR A;  2JU1 A;  4BPF A;  2GZJ A;  2XZ0 D;  2JO0 A;  3CC2 P;  2M8L A;  3GKL C;  4H2Y C;  2LKI A;  3P05 A;  1L0I A;  2FQ1 A;  4IZ6 A;  1IMP A;  2FAC A;  2KOQ A;  1M6N A;  2FAE A;  2LIW A;  5HV8 A;  4XFZ A;  2ONT A;  2KG6 A;  3RG2 A;  1Z6M A;  3VRL C;  1VQN P;  2P9X A;  2Z44 A;  3CCS P;  1QVF O;  3G21 A;  5CZD B;  2MF4 A;  2JAZ A;  2JBG A;  1CEI A;  2N50 A;  2AVA A;  5KP8 B;  2QEX P;  2WPT A;  4NEO A;  2PEN A;  1KQS O;  2FVA A;  2CWO A;  1S72 P;  5I4T G;  3CCJ P;  3CMA P;  1M90 Q;  1K8A Q;  5HGN A;  1M1K Q;  3B4Q A;  2KG9 A;  5EW5 E;  1A43 A;  2JYL A;  3E2D A;  1MZ8 A;  1K9M Q;  2DGY A;  1X3O A;  4HKG A;  3CCE P;  2KWL A;  1AYI A;  2KOP A;  1YIJ P;  1Q7Y Q;  4BPG A;  2L22 A;  3DS0 A;  2PEK A;  2L4B A;  1RNI A;  4M0I A;  3DS4 A;  4U0B A;  1YHQ P;  3CC7 P;  3I55 P;  4IPY A;  2GDY A;  2K0D X;  4GR2 A;  4PXH B;  2CGQ A;  2LTE A;  3DTJ A;  4PH0 A;  2KW2 A;  1HQB A;  1YI2 P;  1YJN P;  2CQ8 A;  3RG6 C;  2GZI A;  2E1M A;  2Z45 A;  3WBH A;  2PEJ A;  2PNG A;  3H47 A;  2GDW A;  1D1D A;  2LF4 A;  1GPJ A;  3EJB A;  3CE7 A;  2VLP A;  2FVF A;  3G29 A;  1DNY A; 
#chains in the Genus database with same CATH homology
 1QVG O;  3CCS P;  4WYM A;  2XXM A;  1VQP P;  1VQ5 P;  2P9X A;  1Q82 Q;  1QVF O;  2JYG A;  2M8N A;  3G21 A;  2PEO A;  3DS2 A;  5BS1 A;  3CCL P;  1M6E X;  4COC A;  5F2O A;  2QEX P;  3HZQ A;  3CCM P;  2EG5 A;  3I56 P;  2PEN A;  2L6E A;  2OAR A;  1KQS O;  2KOD A;  5JPA A;  3G28 A;  1NJI Q;  2CWO A;  1S72 P;  1ZMB A;  5I4T G;  5F2K A;  3DS1 A;  3CCV P;  4U0A A;  3CCJ P;  3CPW O;  1VQ4 P;  5BS2 A;  3CMA P;  2OTL P;  3CXC O;  1JJ2 O;  3LRY A;  5HGL A;  3DS3 A;  1M90 Q;  1VQM P;  5DCK A;  4COP A;  3CCQ P;  4XFY A;  2Z46 A;  2PEI A;  1K8A Q;  3G1G A;  5HGN A;  1M1K Q;  4U0F A;  1YJ9 P;  1VQ8 P;  1A43 A;  3NTE A;  3HYB A;  3MGE A;  5F2N A;  2JYL A;  3E2D A;  1K9M Q;  4U0D A;  2EIA A;  3B5I A;  3OW2 O;  2DGY A;  3G4S P;  3CCU P;  2XT1 A;  1E6J P;  2PEM A;  1W2B O;  3CCE P;  1BAJ A;  1EIA A;  1VQ6 P;  3Q20 A;  3H0D A;  1IUQ A;  4GR6 A;  1YIJ P;  5HGM A;  1Q7Y Q;  2XV6 A;  3CD6 P;  1QRJ A;  4U0E A;  4U0C A;  3G1I A;  1VQ9 P;  3DS0 A;  3M1M A;  2PEK A;  3CME P;  1RNI A;  2EFJ A;  3G6E P;  4M0I A;  2M8P A;  2PY8 A;  2PEQ A;  3DS4 A;  4U0B A;  4XRO A;  2BHV A;  1YHQ P;  3CC7 P;  1AUM A;  1EOQ A;  5HGO A;  3I55 P;  4PH1 A;  4XRQ A;  1Q86 Q;  1KD1 Q;  4IPY A;  2QA4 P;  4QNB A;  1VQO P;  3CC4 P;  4GR2 A;  3DPH A;  1K30 A;  3H4E A;  2JO0 A;  3CC2 P;  3DS5 A;  2M8L A;  3DTJ A;  1N8R Q;  3G0V A;  4PH0 A;  3G26 A;  3P05 A;  1VQL P;  4XFX A;  1YI2 P;  1M6N A;  1A8O A;  3CCR P;  1YJN P;  4XFZ A;  2ONT A;  1YIT P;  1YJW P;  3RG6 C;  2BUO A;  2E1M A;  2Z45 A;  1VQ7 P;  3WBH A;  2PEJ A;  1K73 Q;  1RO2 A;  3H47 A;  1Q81 Q;  1KC8 Q;  3G71 P;  1RO0 A;  1D1D A;  2LF4 A;  1VQK P;  3VRL C;  1M74 A;  1VQN P;  3G29 A;  2OTJ P;  2Z44 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...