2PEQA

Crystal structure of rbcx, crystal form ii
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
109
structure length
109
Chain Sequence
MEFKKVAKETAITLQSYLTYQAVRLISQQLSETNPGQAIWLGEFSKRHPIQESDLYLEAMMLENKELVLRILTVRENLAEGVLEFLPEMVLSQIKQSNGNHRRSLLERL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ORF134
publication title Structure and Function of RbcX, an Assembly Chaperone for Hexadecameric Rubisco.
pubmed doi rcsb
source organism Synechococcus sp.
molecule tags Chaperone
total genus 49
structure length 109
sequence length 109
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02341 RcbX RbcX protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.210 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2peqA00
2PEOA 4GR6A 3RG6C 2PEIA 2Z44A 2PEKA 4GR2A 2Z45A 2PY8A 2PEMA 5BS1A 3Q20A 2PENA 2PEQA 2PEJA 5BS2A 2Z46A 3HYBA
chains in the Genus database with same CATH superfamily
4PXHB 1ZNVA 5HGOA 2K0DX 1EOQA 4IZ6A 2K2QA 1EMVA 1QVFO 1E0HA 2N5HA 1BXIA 2LTEA 3H0DA 2JQ4A 4IPYA 2LIWA 2KG8A 3G0VA 3P05A 1KC8Q 1VQ7P 1AF8A 3CCUP 3H4EA 2JU2A 4U0EA 1AUMA 2GZEA 7CEIA 1M74A 2N5IA 1ACPA 3G6EP 3CC7P 1Q86Q 2MR8A 2L0QA 3CCMP 2M8PA 1W2BO 2EHSA 2ONTA 5F2NA 1YJWP 1OR5A 2MF4A 1UNKA 4U0DA 4QKOA 3G28A 3Q20A 2KOSA 3DS3A 4XROA 1QRJA 1MZ8A 3OW2O 2FQ2A 3DS2A 3U43A 2JO0A 1F80D 3I56P 3G4SP 2MD9A 1S72P 1Q82Q 1VQ9P 2K0XA 3RG6C 3CXCO 1GXGA 1M6EX 3LRYA 4QNBA 2KR5A 2L6EA 1CEIA 2PEIA 2DGYA 2VLNA 3G26A 3DS0A 5F2OA 2JYGA 1YHQP 1L0IA 4NEOA 1EIAA 2Z46A 3CMEP 2AVAA 2PEKA 4XRQA 2CGQA 4CA3A 2PNGA 2GZFA 2E1MA 1M1KQ 4H2YC 2GDYA 2QEXP 2XZ0D 1K73Q 2XZ1C 3E2DA 2JU1A 4MRTC 1A8OA 2KWLA 2OARA 3CCEP 5KP6B 5BS2A 4GR6A 1Z6MA 1L0HA 2PY8A 3M1MA 1HY8A 3CD6P 1BAJA 2FVFA 1KQSO 2CWOA 2LIUA 3DPHA 4WYMA 3G1IA 1HQBA 4PH0A 3RG2A 2KG9A 3DS1A 3DS5A 1RO2A 3DS4A 3DTJA 3WBHA 2N98A 1VQ4P 2PEMA 1YITP 1JJ2O 2JAZA 4H2XC 3CC4P 2EHTA 2EIAA 2FAEA 2GYKA 3GJNA 1IUQA 2Z44A 1VQKP 2GZIA 4F37A 2JBGA 3B5IA 2EG5A 2FVAA 1NQ4A 4PH1A 3CCVP 1M6NA 1VQLP 1VQPP 2MY5A 1NJIQ 2AFDA 2KGAA 5I4TG 3EJEA 1K9MQ 4UHPB 2VLOA 2KGCA 2OTLP 1IMPA 2XV6A 2M8LA 3B4QA 2VSQA 4PWVB 3CCLP 2LMLA 1QVGO 4BPGA 4BPFA 3CCSP 2L22A 3CCRP 2JB0A 1E6JP 1DNYA 3EJBA 5HGNA 1GXHA 2FADA 1VQMP 3H47A 4GR2A 1VKUA 2VLQA 3G1GA 2GZGA 3VRLC 5KP7B 2AF8A 2FACA 2FVEA 3G29A 2N6YA 5KP8B 1VHNA 4HKGA 1YI2P 2LKIA 4XFYA 1RO0A 2XT1A 4DG9A 1KD1Q 5HGMA 2MVUA 2KGEA 4U0CA 1YIJP 4U0FA 2N6ZA 2X2BA 3NTEA 2AFEA 5HGLA 2KODA 2GZJA 2K93A 4XFZA 4COCA 2CNRA 2PEQA 2FQ1A 3CE7A 2GDXA 2BHVA 1K30A 2FQ0A 1VQ6P 2KOQA 4R0MA 2EFJA 1RNIA 3CPWO 1AYIA 1IMQA 1VQ8P 3MGEA 1M90Q 2WPTA 1VQ5P 1X3OA 1YJNP 3G71P 1Q81Q 1ZMBA 2FHSC 2L9FA 2KOOA 2DNWA 2MVVA 1N8RQ 1T8KA 1UJZA 2K92A 2PEJA 2QNWA 2JGPA 4U0BA 2PEOA 1GPJA 1FR2A 2KOPA 3CMAP 5HVCA 1DV5A 2Z45A 4COPA 3CC2P 2LL8A 2JYLA 4U0AA 2M8NA 2M5RA 2GDWA 2N50A 5BS1A 2KG6A 3GZLA 1D1DA 2L4BA 5CZDB 2QA4P 1VQOP 2KW2A 2OTJP 2MR7A 2ERHA 4BPHA 2BUOA 2P9XA 5DCKA 1VQNP 2CG5B 5F2KA 2XXMA 2LPKA 3HZQA 2NO8A 1Q7YQ 3CCJP 3EJDA 4H2WC 2LOLA 2LF4A 2VLPA 5EJDA 4XFXA 3I55P 1KLPA 3HYBA 5EW5E 3G21A 3GZMA 3CCQP 3GKLC 2K0YA 5HV8A 5JPAA 3NY7B 2KORA 1YJ9P 2PENA 2CQ8A 1K8AQ 3LMOA 2K94A 2ROQA 1A43A 4M0IA 2KGDA 2K5XA
chains in the Genus database with same CATH topology
4QNBA 4PH1A 3CCVP 3G71P 1M6NA 1Q81Q 1VQLP 1ZMBA 2L6EA 5HGOA 1VQPP 2PEIA 1EOQA 2DGYA 1NJIQ 5I4TG 3G26A 3DS0A 1QVFO 1N8RQ 1K9MQ 5F2OA 2JYGA 2PEJA 1YHQP 2OTLP 4U0BA 2PEOA 2XV6A 2M8LA 1EIAA 3H0DA 2Z46A 3CMAP 3CCLP 3CMEP 4IPYA 1QVGO 3G0VA 2PEKA 4XRQA 2Z45A 4COPA 3CCSP 3P05A 3CCRP 3CC2P 2E1MA 1E6JP 2JYLA 4U0AA 1KC8Q 1M1KQ 1VQ7P 3CCUP 3H4EA 2M8NA 5HGNA 1VQMP 3H47A 2QEXP 1K73Q 4U0EA 1AUMA 4GR2A 3E2DA 5BS1A 1A8OA 3G1GA 3VRLC 1D1DA 1M74A 2OARA 2QA4P 3CCEP 1VQOP 3G6EP 5BS2A 3CC7P 1Q86Q 2OTJP 4GR6A 2BUOA 2P9XA 3G29A 2PY8A 2M8PA 3M1MA 5DCKA 3CCMP 1VQNP 1YI2P 5F2KA 2XXMA 1W2BO 3CD6P 2ONTA 4XFYA 1BAJA 5F2NA 3HZQA 1RO0A 2XT1A 1YJWP 1Q7YQ 3CCJP 1KQSO 2CWOA 3DPHA 4U0DA 4WYMA 1KD1Q 5HGMA 3G1IA 4PH0A 3G28A 3Q20A 4U0CA 1YIJP 3DS1A 3DS3A 4U0FA 4XROA 1QRJA 2LF4A 3NTEA 4XFXA 3I55P 3OW2O 3DS5A 1RO2A 3DS4A 3DTJA 3HYBA 5HGLA 3WBHA 2KODA 3G21A 1VQ4P 4XFZA 4COCA 3CCQP 2PEMA 1YITP 1JJ2O 2PEQA 3DS2A 2JO0A 3CC4P 2EIAA 2BHVA 1K30A 3I56P 3G4SP 1S72P 1IUQA 1Q82Q 5JPAA 1VQ9P 2Z44A 1YJ9P 1VQ6P 2PENA 2EFJA 1VQKP 1YJNP 1RNIA 3CPWO 1K8AQ 1VQ8P 3MGEA 3RG6C 1A43A 3CXCO 1M90Q 3B5IA 4M0IA 1M6EX 3LRYA 2EG5A 1VQ5P
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PEO A;  4GR6 A;  3RG6 C;  2PEI A;  2Z44 A;  2PEK A;  4GR2 A;  2Z45 A;  2PY8 A;  2PEM A;  5BS1 A;  3Q20 A;  2PEN A;  2PEQ A;  2PEJ A;  5BS2 A;  2Z46 A;  3HYB A; 
#chains in the Genus database with same CATH topology
 4PXH B;  1ZNV A;  5HGO A;  2K0D X;  1EOQ A;  4IZ6 A;  2K2Q A;  1EMV A;  1QVF O;  1E0H A;  2N5H A;  1BXI A;  2LTE A;  3H0D A;  2JQ4 A;  4IPY A;  2LIW A;  2KG8 A;  3G0V A;  3P05 A;  1KC8 Q;  1VQ7 P;  1AF8 A;  3CCU P;  3H4E A;  2JU2 A;  4U0E A;  1AUM A;  2GZE A;  7CEI A;  1M74 A;  2N5I A;  1ACP A;  3G6E P;  3CC7 P;  1Q86 Q;  2MR8 A;  2L0Q A;  3CCM P;  2M8P A;  1W2B O;  2EHS A;  2ONT A;  5F2N A;  1YJW P;  1OR5 A;  2MF4 A;  1UNK A;  4U0D A;  4QKO A;  3G28 A;  3Q20 A;  2KOS A;  3DS3 A;  4XRO A;  1QRJ A;  1MZ8 A;  3OW2 O;  2FQ2 A;  3DS2 A;  3U43 A;  2JO0 A;  1F80 D;  3I56 P;  3G4S P;  2MD9 A;  1S72 P;  1Q82 Q;  1VQ9 P;  2K0X A;  3RG6 C;  3CXC O;  1GXG A;  1M6E X;  3LRY A;  4QNB A;  2KR5 A;  2L6E A;  1CEI A;  2PEI A;  2DGY A;  2VLN A;  3G26 A;  3DS0 A;  5F2O A;  2JYG A;  1YHQ P;  1L0I A;  4NEO A;  1EIA A;  2Z46 A;  3CME P;  2AVA A;  2PEK A;  4XRQ A;  2CGQ A;  4CA3 A;  2PNG A;  2GZF A;  2E1M A;  1M1K Q;  4H2Y C;  2GDY A;  2QEX P;  2XZ0 D;  1K73 Q;  2XZ1 C;  3E2D A;  2JU1 A;  4MRT C;  1A8O A;  2KWL A;  2OAR A;  3CCE P;  5KP6 B;  5BS2 A;  4GR6 A;  1Z6M A;  1L0H A;  2PY8 A;  3M1M A;  1HY8 A;  3CD6 P;  1BAJ A;  2FVF A;  1KQS O;  2CWO A;  2LIU A;  3DPH A;  4WYM A;  3G1I A;  1HQB A;  4PH0 A;  3RG2 A;  2KG9 A;  3DS1 A;  3DS5 A;  1RO2 A;  3DS4 A;  3DTJ A;  3WBH A;  2N98 A;  1VQ4 P;  2PEM A;  1YIT P;  1JJ2 O;  2JAZ A;  4H2X C;  3CC4 P;  2EHT A;  2EIA A;  2FAE A;  2GYK A;  3GJN A;  1IUQ A;  2Z44 A;  1VQK P;  2GZI A;  4F37 A;  2JBG A;  3B5I A;  2EG5 A;  2FVA A;  1NQ4 A;  4PH1 A;  3CCV P;  1M6N A;  1VQL P;  1VQP P;  2MY5 A;  1NJI Q;  2AFD A;  2KGA A;  5I4T G;  3EJE A;  1K9M Q;  4UHP B;  2VLO A;  2KGC A;  2OTL P;  1IMP A;  2XV6 A;  2M8L A;  3B4Q A;  2VSQ A;  4PWV B;  3CCL P;  2LML A;  1QVG O;  4BPG A;  4BPF A;  3CCS P;  2L22 A;  3CCR P;  2JB0 A;  1E6J P;  1DNY A;  3EJB A;  5HGN A;  1GXH A;  2FAD A;  1VQM P;  3H47 A;  4GR2 A;  1VKU A;  2VLQ A;  3G1G A;  2GZG A;  3VRL C;  5KP7 B;  2AF8 A;  2FAC A;  2FVE A;  3G29 A;  2N6Y A;  5KP8 B;  1VHN A;  4HKG A;  1YI2 P;  2LKI A;  4XFY A;  1RO0 A;  2XT1 A;  4DG9 A;  1KD1 Q;  5HGM A;  2MVU A;  2KGE A;  4U0C A;  1YIJ P;  4U0F A;  2N6Z A;  2X2B A;  3NTE A;  2AFE A;  5HGL A;  2KOD A;  2GZJ A;  2K93 A;  4XFZ A;  4COC A;  2CNR A;  2PEQ A;  2FQ1 A;  3CE7 A;  2GDX A;  2BHV A;  1K30 A;  2FQ0 A;  1VQ6 P;  2KOQ A;  4R0M A;  2EFJ A;  1RNI A;  3CPW O;  1AYI A;  1IMQ A;  1VQ8 P;  3MGE A;  1M90 Q;  2WPT A;  1VQ5 P;  1X3O A;  1YJN P;  3G71 P;  1Q81 Q;  1ZMB A;  2FHS C;  2L9F A;  2KOO A;  2DNW A;  2MVV A;  1N8R Q;  1T8K A;  1UJZ A;  2K92 A;  2PEJ A;  2QNW A;  2JGP A;  4U0B A;  2PEO A;  1GPJ A;  1FR2 A;  2KOP A;  3CMA P;  5HVC A;  1DV5 A;  2Z45 A;  4COP A;  3CC2 P;  2LL8 A;  2JYL A;  4U0A A;  2M8N A;  2M5R A;  2GDW A;  2N50 A;  5BS1 A;  2KG6 A;  3GZL A;  1D1D A;  2L4B A;  5CZD B;  2QA4 P;  1VQO P;  2KW2 A;  2OTJ P;  2MR7 A;  2ERH A;  4BPH A;  2BUO A;  2P9X A;  5DCK A;  1VQN P;  2CG5 B;  5F2K A;  2XXM A;  2LPK A;  3HZQ A;  2NO8 A;  1Q7Y Q;  3CCJ P;  3EJD A;  4H2W C;  2LOL A;  2LF4 A;  2VLP A;  5EJD A;  4XFX A;  3I55 P;  1KLP A;  3HYB A;  5EW5 E;  3G21 A;  3GZM A;  3CCQ P;  3GKL C;  2K0Y A;  5HV8 A;  5JPA A;  3NY7 B;  2KOR A;  1YJ9 P;  2PEN A;  2CQ8 A;  1K8A Q;  3LMO A;  2K94 A;  2ROQ A;  1A43 A;  4M0I A;  2KGD A;  2K5X A; 
#chains in the Genus database with same CATH homology
 4QNB A;  4PH1 A;  3CCV P;  3G71 P;  1M6N A;  1Q81 Q;  1VQL P;  1ZMB A;  2L6E A;  5HGO A;  1VQP P;  2PEI A;  1EOQ A;  2DGY A;  1NJI Q;  5I4T G;  3G26 A;  3DS0 A;  1QVF O;  1N8R Q;  1K9M Q;  5F2O A;  2JYG A;  2PEJ A;  1YHQ P;  2OTL P;  4U0B A;  2PEO A;  2XV6 A;  2M8L A;  1EIA A;  3H0D A;  2Z46 A;  3CMA P;  3CCL P;  3CME P;  4IPY A;  1QVG O;  3G0V A;  2PEK A;  4XRQ A;  2Z45 A;  4COP A;  3CCS P;  3P05 A;  3CCR P;  3CC2 P;  2E1M A;  1E6J P;  2JYL A;  4U0A A;  1KC8 Q;  1M1K Q;  1VQ7 P;  3CCU P;  3H4E A;  2M8N A;  5HGN A;  1VQM P;  3H47 A;  2QEX P;  1K73 Q;  4U0E A;  1AUM A;  4GR2 A;  3E2D A;  5BS1 A;  1A8O A;  3G1G A;  3VRL C;  1D1D A;  1M74 A;  2OAR A;  2QA4 P;  3CCE P;  1VQO P;  3G6E P;  5BS2 A;  3CC7 P;  1Q86 Q;  2OTJ P;  4GR6 A;  2BUO A;  2P9X A;  3G29 A;  2PY8 A;  2M8P A;  3M1M A;  5DCK A;  3CCM P;  1VQN P;  1YI2 P;  5F2K A;  2XXM A;  1W2B O;  3CD6 P;  2ONT A;  4XFY A;  1BAJ A;  5F2N A;  3HZQ A;  1RO0 A;  2XT1 A;  1YJW P;  1Q7Y Q;  3CCJ P;  1KQS O;  2CWO A;  3DPH A;  4U0D A;  4WYM A;  1KD1 Q;  5HGM A;  3G1I A;  4PH0 A;  3G28 A;  3Q20 A;  4U0C A;  1YIJ P;  3DS1 A;  3DS3 A;  4U0F A;  4XRO A;  1QRJ A;  2LF4 A;  3NTE A;  4XFX A;  3I55 P;  3OW2 O;  3DS5 A;  1RO2 A;  3DS4 A;  3DTJ A;  3HYB A;  5HGL A;  3WBH A;  2KOD A;  3G21 A;  1VQ4 P;  4XFZ A;  4COC A;  3CCQ P;  2PEM A;  1YIT P;  1JJ2 O;  2PEQ A;  3DS2 A;  2JO0 A;  3CC4 P;  2EIA A;  2BHV A;  1K30 A;  3I56 P;  3G4S P;  1S72 P;  1IUQ A;  1Q82 Q;  5JPA A;  1VQ9 P;  2Z44 A;  1YJ9 P;  1VQ6 P;  2PEN A;  2EFJ A;  1VQK P;  1YJN P;  1RNI A;  3CPW O;  1K8A Q;  1VQ8 P;  3MGE A;  3RG6 C;  1A43 A;  3CXC O;  1M90 Q;  3B5I A;  4M0I A;  1M6E X;  3LRY A;  2EG5 A;  1VQ5 P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...