2PEQA

Crystal structure of rbcx, crystal form ii
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
109
structure length
109
Chain Sequence
MEFKKVAKETAITLQSYLTYQAVRLISQQLSETNPGQAIWLGEFSKRHPIQESDLYLEAMMLENKELVLRILTVRENLAEGVLEFLPEMVLSQIKQSNGNHRRSLLERL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Function of RbcX, an Assembly Chaperone for Hexadecameric Rubisco.
pubmed doi rcsb
source organism Synechococcus sp.
molecule tags Chaperone
molecule keywords ORF134
total genus 49
structure length 109
sequence length 109
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02341 RcbX RbcX protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.210 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2peqA00
3Q20A 5BS2A 4GR6A 2Z45A 2Z44A 2PEKA 2PEOA 2Z46A 5BS1A 2PEQA 2PENA 2PEJA 2PEIA 3HYBA 4GR2A 2PEMA 2PY8A 3RG6C
chains in the Genus database with same CATH superfamily
3GJNA 1QVGO 2VLNA 5EW5E 2KGDA 5F2KA 2KGAA 2ROQA 2K0DX 2AF8A 2CG5B 2CWOA 2K5XA 3DS4A 5JPAA 2GZGA 1Z6MA 3H0DA 3B4QA 3I55P 4CA3A 1VQPP 5I4TG 2KOQA 1M74A 1EMVA 1AUMA 1IMQA 2GZJA 2L0QA 2LKIA 2GDXA 1IMPA 1E0HA 1HY8A 3P05A 2XZ1C 3G28A 4XRQA 1A8OA 2M8NA 2PNGA 3CC4P 1VQLP 2FQ0A 2KORA 4U0DA 1HQBA 2GDYA 2PEOA 2VLOA 1S72P 1IUQA 4PXHB 2Z46A 1KQSO 2K93A 2PENA 3DS5A 1L0IA 3I56P 1ZNVA 4BPFA 2GYKA 2L6EA 1OR5A 5BS2A 2MR7A 1VQ7P 2QNWA 4M0IA 1GXGA 3DS3A 3HYBA 3EJDA 3NTEA 1BAJA 3CCUP 3CD6P 3CXCO 2LL8A 5HGMA 5KP8B 2KGCA 2KWLA 2AVAA 1DV5A 2LMLA 2MVUA 1K8AQ 4IZ6A 2P9XA 4R0MA 4U0CA 3CC2P 4QKOA 4IPYA 2K0YA 3DPHA 5F2NA 1KC8Q 2JQ4A 2L4BA 5BS1A 3LMOA 1EIAA 4WYMA 5HGLA 1VQ4P 3VRLC 2PEMA 2NO8A 1CEIA 1W2BO 4PH1A 2FQ1A 2JAZA 5F2OA 2MF4A 2LTEA 1M90Q 2M8PA 2XT1A 2JU1A 3CCRP 2E1MA 2OTJP 3E2DA 2BHVA 4XROA 4H2YC 5CZDB 3CMEP 3CCVP 3CE7A 4GR2A 5DCKA 4DG9A 1GXHA 2JU2A 3HZQA 1YHQP 3OW2O 4COCA 1Q86Q 5HGOA 2AFEA 1FR2A 4F37A 2K2QA 3DS0A 5KP7B 3G21A 2EIAA 1ACPA 1E6JP 4U0EA 3G1GA 2DGYA 1YIJP 4U0FA 2N5IA 3DS1A 1ZMBA 2FADA 5HVCA 2VSQA 3G1IA 2M8LA 1MZ8A 1VKUA 2KGEA 4GR6A 3U43A 3CCQP 4H2WC 2JYGA 1Q82Q 2MR8A 3G4SP 2N5HA 1VQ5P 2MY5A 3G6EP 2LOLA 1BXIA 1M1KQ 3CCMP 2PEJA 4XFZA 2X2BA 4XFXA 2Z44A 5HGNA 1QVFO 1RNIA 1QRJA 4MRTC 1RO0A 3CMAP 2FVAA 4NEOA 2KOOA 4PH0A 3CCJP 2XV6A 3GKLC 2QEXP 3CCEP 1N8RQ 2ERHA 2KODA 1L0HA 4BPHA 2LF4A 2JO0A 4QNBA 1VQOP 3MGEA 5KP6B 2FAEA 2K94A 3GZLA 3DS2A 2MVVA 2FACA 2KR5A 2GDWA 2CGQA 1M6EX 2CNRA 2PEIA 3RG6C 1M6NA 1YI2P 3B5IA 2WPTA 2GZIA 4UHPB 1NQ4A 1AF8A 2GZEA 1KD1Q 3CCSP 2M5RA 1VQ9P 2MD9A 2Z45A 1AYIA 2FHSC 1VQMP 2ONTA 2BUOA 2CQ8A 2KG9A 2LPKA 2OTLP 2L22A 2FVEA 1DNYA 1X3OA 4COPA 1VHNA 2OARA 1UNKA 2K92A 4U0AA 2N6YA 2VLQA 1VQKP 3WBHA 3G26A 1YJNP 4HKGA 2PEQA 1K73Q 1A43A 3NY7B 3RG2A 2K0XA 2N50A 2L9FA 4BPGA 1EOQA 4XFYA 1YJ9P 2GZFA 2EHTA 2LIUA 4U0BA 5HV8A 7CEIA 2JYLA 1F80D 3H47A 1RO2A 2N98A 1VQNP 2QA4P 1JJ2O 2FVFA 3CPWO 1K30A 3CCLP 2LIWA 2EG5A 2N6ZA 2XXMA 5EJDA 2JBGA 3M1MA 3G71P 2EFJA 3G0VA 1D1DA 4H2XC 2KOSA 3GZMA 3CC7P 2JB0A 2EHSA 4PWVB 3G29A 2XZ0D 2JGPA 2FQ2A 1VQ6P 1UJZA 1T8KA 1Q7YQ 2DNWA 2KW2A 3DTJA 2KG8A 3H4EA 2VLPA 3LRYA 1YJWP 1KLPA 3Q20A 1VQ8P 2KOPA 1K9MQ 1GPJA 2PEKA 1Q81Q 1YITP 2AFDA 3EJBA 3EJEA 1NJIQ 2KG6A 2PY8A
chains in the Genus database with same CATH topology
1RO0A 3CMAP 1QVGO 5BS1A 1EIAA 1EOQA 4XFYA 4WYMA 1YJ9P 5F2KA 4PH0A 5HGLA 1VQ4P 4U0BA 3VRLC 3CCJP 2CWOA 2JYLA 2PEMA 3DS4A 5JPAA 1W2BO 2XV6A 4PH1A 2QEXP 3H0DA 5F2OA 3CCEP 3H47A 1M90Q 1N8RQ 1RO2A 2KODA 2M8PA 2XT1A 3I55P 2LF4A 2JO0A 3CCRP 1VQNP 2QA4P 1JJ2O 1VQPP 5I4TG 2E1MA 4QNBA 1M74A 2OTJP 1AUMA 3E2DA 1VQOP 3MGEA 2BHVA 4XROA 3CMEP 3CCVP 3CPWO 1K30A 3DS2A 3P05A 3CCLP 3G28A 4XRQA 4GR2A 5DCKA 1A8OA 2M8NA 1M6EX 2EG5A 2XXMA 3M1MA 2PEIA 3HZQA 3RG6C 1YHQP 1VQLP 3CC4P 1M6NA 1YI2P 3G71P 3B5IA 4COCA 3OW2O 4U0DA 2PEOA 1Q86Q 5HGOA 2EFJA 3G0VA 1D1DA 1S72P 1IUQA 3DS0A 3CC7P 2Z46A 3G21A 2EIAA 1KQSO 1KD1Q 2PENA 3DS5A 1E6JP 4U0EA 3CCSP 3G29A 3I56P 3G1GA 2Z45A 1VQ9P 2DGYA 1YIJP 1VQ6P 4U0FA 3DS1A 1ZMBA 2ONTA 2L6EA 1VQMP 1Q7YQ 2BUOA 5BS2A 3G1IA 2M8LA 1VQ7P 4M0IA 3DTJA 3DS3A 3HYBA 4GR6A 3NTEA 3CCQP 3H4EA 1BAJA 3CCUP 2OTLP 3CD6P 3CXCO 2JYGA 1Q82Q 4COPA 3LRYA 5HGMA 3G4SP 2OARA 1YJWP 3Q20A 1VQ5P 4U0AA 1VQ8P 1VQKP 3WBHA 1K9MQ 1K8AQ 3G6EP 3G26A 2P9XA 4U0CA 1YJNP 3CC2P 1M1KQ 2PEKA 3CCMP 1Q81Q 2PEQA 1YITP 2PEJA 4IPYA 4XFZA 1K73Q 4XFXA 1A43A 2Z44A 5HGNA 1QVFO 3DPHA 5F2NA 1RNIA 1NJIQ 1KC8Q 1QRJA 2PY8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q20 A;  5BS2 A;  4GR6 A;  2Z45 A;  2Z44 A;  2PEK A;  2PEO A;  2Z46 A;  5BS1 A;  2PEQ A;  2PEN A;  2PEJ A;  2PEI A;  3HYB A;  4GR2 A;  2PEM A;  2PY8 A;  3RG6 C; 
#chains in the Genus database with same CATH topology
 3GJN A;  1QVG O;  2VLN A;  5EW5 E;  2KGD A;  5F2K A;  2KGA A;  2ROQ A;  2K0D X;  2AF8 A;  2CG5 B;  2CWO A;  2K5X A;  3DS4 A;  5JPA A;  2GZG A;  1Z6M A;  3H0D A;  3B4Q A;  3I55 P;  4CA3 A;  1VQP P;  5I4T G;  2KOQ A;  1M74 A;  1EMV A;  1AUM A;  1IMQ A;  2GZJ A;  2L0Q A;  2LKI A;  2GDX A;  1IMP A;  1E0H A;  1HY8 A;  3P05 A;  2XZ1 C;  3G28 A;  4XRQ A;  1A8O A;  2M8N A;  2PNG A;  3CC4 P;  1VQL P;  2FQ0 A;  2KOR A;  4U0D A;  1HQB A;  2GDY A;  2PEO A;  2VLO A;  1S72 P;  1IUQ A;  4PXH B;  2Z46 A;  1KQS O;  2K93 A;  2PEN A;  3DS5 A;  1L0I A;  3I56 P;  1ZNV A;  4BPF A;  2GYK A;  2L6E A;  1OR5 A;  5BS2 A;  2MR7 A;  1VQ7 P;  2QNW A;  4M0I A;  1GXG A;  3DS3 A;  3HYB A;  3EJD A;  3NTE A;  1BAJ A;  3CCU P;  3CD6 P;  3CXC O;  2LL8 A;  5HGM A;  5KP8 B;  2KGC A;  2KWL A;  2AVA A;  1DV5 A;  2LML A;  2MVU A;  1K8A Q;  4IZ6 A;  2P9X A;  4R0M A;  4U0C A;  3CC2 P;  4QKO A;  4IPY A;  2K0Y A;  3DPH A;  5F2N A;  1KC8 Q;  2JQ4 A;  2L4B A;  5BS1 A;  3LMO A;  1EIA A;  4WYM A;  5HGL A;  1VQ4 P;  3VRL C;  2PEM A;  2NO8 A;  1CEI A;  1W2B O;  4PH1 A;  2FQ1 A;  2JAZ A;  5F2O A;  2MF4 A;  2LTE A;  1M90 Q;  2M8P A;  2XT1 A;  2JU1 A;  3CCR P;  2E1M A;  2OTJ P;  3E2D A;  2BHV A;  4XRO A;  4H2Y C;  5CZD B;  3CME P;  3CCV P;  3CE7 A;  4GR2 A;  5DCK A;  4DG9 A;  1GXH A;  2JU2 A;  3HZQ A;  1YHQ P;  3OW2 O;  4COC A;  1Q86 Q;  5HGO A;  2AFE A;  1FR2 A;  4F37 A;  2K2Q A;  3DS0 A;  5KP7 B;  3G21 A;  2EIA A;  1ACP A;  1E6J P;  4U0E A;  3G1G A;  2DGY A;  1YIJ P;  4U0F A;  2N5I A;  3DS1 A;  1ZMB A;  2FAD A;  5HVC A;  2VSQ A;  3G1I A;  2M8L A;  1MZ8 A;  1VKU A;  2KGE A;  4GR6 A;  3U43 A;  3CCQ P;  4H2W C;  2JYG A;  1Q82 Q;  2MR8 A;  3G4S P;  2N5H A;  1VQ5 P;  2MY5 A;  3G6E P;  2LOL A;  1BXI A;  1M1K Q;  3CCM P;  2PEJ A;  4XFZ A;  2X2B A;  4XFX A;  2Z44 A;  5HGN A;  1QVF O;  1RNI A;  1QRJ A;  4MRT C;  1RO0 A;  3CMA P;  2FVA A;  4NEO A;  2KOO A;  4PH0 A;  3CCJ P;  2XV6 A;  3GKL C;  2QEX P;  3CCE P;  1N8R Q;  2ERH A;  2KOD A;  1L0H A;  4BPH A;  2LF4 A;  2JO0 A;  4QNB A;  1VQO P;  3MGE A;  5KP6 B;  2FAE A;  2K94 A;  3GZL A;  3DS2 A;  2MVV A;  2FAC A;  2KR5 A;  2GDW A;  2CGQ A;  1M6E X;  2CNR A;  2PEI A;  3RG6 C;  1M6N A;  1YI2 P;  3B5I A;  2WPT A;  2GZI A;  4UHP B;  1NQ4 A;  1AF8 A;  2GZE A;  1KD1 Q;  3CCS P;  2M5R A;  1VQ9 P;  2MD9 A;  2Z45 A;  1AYI A;  2FHS C;  1VQM P;  2ONT A;  2BUO A;  2CQ8 A;  2KG9 A;  2LPK A;  2OTL P;  2L22 A;  2FVE A;  1DNY A;  1X3O A;  4COP A;  1VHN A;  2OAR A;  1UNK A;  2K92 A;  4U0A A;  2N6Y A;  2VLQ A;  1VQK P;  3WBH A;  3G26 A;  1YJN P;  4HKG A;  2PEQ A;  1K73 Q;  1A43 A;  3NY7 B;  3RG2 A;  2K0X A;  2N50 A;  2L9F A;  4BPG A;  1EOQ A;  4XFY A;  1YJ9 P;  2GZF A;  2EHT A;  2LIU A;  4U0B A;  5HV8 A;  7CEI A;  2JYL A;  1F80 D;  3H47 A;  1RO2 A;  2N98 A;  1VQN P;  2QA4 P;  1JJ2 O;  2FVF A;  3CPW O;  1K30 A;  3CCL P;  2LIW A;  2EG5 A;  2N6Z A;  2XXM A;  5EJD A;  2JBG A;  3M1M A;  3G71 P;  2EFJ A;  3G0V A;  1D1D A;  4H2X C;  2KOS A;  3GZM A;  3CC7 P;  2JB0 A;  2EHS A;  4PWV B;  3G29 A;  2XZ0 D;  2JGP A;  2FQ2 A;  1VQ6 P;  1UJZ A;  1T8K A;  1Q7Y Q;  2DNW A;  2KW2 A;  3DTJ A;  2KG8 A;  3H4E A;  2VLP A;  3LRY A;  1YJW P;  1KLP A;  3Q20 A;  1VQ8 P;  2KOP A;  1K9M Q;  1GPJ A;  2PEK A;  1Q81 Q;  1YIT P;  2AFD A;  3EJB A;  3EJE A;  1NJI Q;  2KG6 A;  2PY8 A; 
#chains in the Genus database with same CATH homology
 1RO0 A;  3CMA P;  1QVG O;  5BS1 A;  1EIA A;  1EOQ A;  4XFY A;  4WYM A;  1YJ9 P;  5F2K A;  4PH0 A;  5HGL A;  1VQ4 P;  4U0B A;  3VRL C;  3CCJ P;  2CWO A;  2JYL A;  2PEM A;  3DS4 A;  5JPA A;  1W2B O;  2XV6 A;  4PH1 A;  2QEX P;  3H0D A;  5F2O A;  3CCE P;  3H47 A;  1M90 Q;  1N8R Q;  1RO2 A;  2KOD A;  2M8P A;  2XT1 A;  3I55 P;  2LF4 A;  2JO0 A;  3CCR P;  1VQN P;  2QA4 P;  1JJ2 O;  1VQP P;  5I4T G;  2E1M A;  4QNB A;  1M74 A;  2OTJ P;  1AUM A;  3E2D A;  1VQO P;  3MGE A;  2BHV A;  4XRO A;  3CME P;  3CCV P;  3CPW O;  1K30 A;  3DS2 A;  3P05 A;  3CCL P;  3G28 A;  4XRQ A;  4GR2 A;  5DCK A;  1A8O A;  2M8N A;  1M6E X;  2EG5 A;  2XXM A;  3M1M A;  2PEI A;  3HZQ A;  3RG6 C;  1YHQ P;  1VQL P;  3CC4 P;  1M6N A;  1YI2 P;  3G71 P;  3B5I A;  4COC A;  3OW2 O;  4U0D A;  2PEO A;  1Q86 Q;  5HGO A;  2EFJ A;  3G0V A;  1D1D A;  1S72 P;  1IUQ A;  3DS0 A;  3CC7 P;  2Z46 A;  3G21 A;  2EIA A;  1KQS O;  1KD1 Q;  2PEN A;  3DS5 A;  1E6J P;  4U0E A;  3CCS P;  3G29 A;  3I56 P;  3G1G A;  2Z45 A;  1VQ9 P;  2DGY A;  1YIJ P;  1VQ6 P;  4U0F A;  3DS1 A;  1ZMB A;  2ONT A;  2L6E A;  1VQM P;  1Q7Y Q;  2BUO A;  5BS2 A;  3G1I A;  2M8L A;  1VQ7 P;  4M0I A;  3DTJ A;  3DS3 A;  3HYB A;  4GR6 A;  3NTE A;  3CCQ P;  3H4E A;  1BAJ A;  3CCU P;  2OTL P;  3CD6 P;  3CXC O;  2JYG A;  1Q82 Q;  4COP A;  3LRY A;  5HGM A;  3G4S P;  2OAR A;  1YJW P;  3Q20 A;  1VQ5 P;  4U0A A;  1VQ8 P;  1VQK P;  3WBH A;  1K9M Q;  1K8A Q;  3G6E P;  3G26 A;  2P9X A;  4U0C A;  1YJN P;  3CC2 P;  1M1K Q;  2PEK A;  3CCM P;  1Q81 Q;  2PEQ A;  1YIT P;  2PEJ A;  4IPY A;  4XFZ A;  1K73 Q;  4XFX A;  1A43 A;  2Z44 A;  5HGN A;  1QVF O;  3DPH A;  5F2N A;  1RNI A;  1NJI Q;  1KC8 Q;  1QRJ A;  2PY8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...