3G29A

Crystal structure of the c-terminal domain of the rous sarcoma virus capsid protein: d179n mutant, neutral ph
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
77
structure length
77
Chain Sequence
AGPWADIMQGPSESFVDFANRLIKAVEGSNLPPSARAPVIIDCFRQKSQPDIQQLIRTAPSTLTTPGEIIKYVLDRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Gag polyprotein
publication title Proton-linked dimerization of a retroviral capsid protein initiates capsid assembly
pubmed doi rcsb
source organism Rous sarcoma virus
molecule tags Viral protein
total genus 24
structure length 77
sequence length 77
chains with identical sequence B
ec nomenclature ec 3.4.23.-:
pdb deposition date 2009-01-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3g29A00
1A8OA 3G21A 4U0BA 2M8NA 4QNBA 5HGNA 1D1DA 1QRJA 1EOQA 2XXMA 4COPA 3NTEA 2BUOA 2XV6A 4XFYA 3VRLC 3P05A 1BAJA 3G0VA 5HGMA 2JO0A 3DTJA 3G1GA 3H4EA 5HGLA 1AUMA 2EIAA 4U0FA 3LRYA 3DS1A 4XFZA 4PH0A 3G26A 3DS3A 2M8LA 3G29A 2JYGA 4XFXA 4PH1A 3H47A 4COCA 2JYLA 3DS0A 3DS4A 3G28A 4IPYA 3G1IA 4U0CA 2L6EA 4XRQA 4U0AA 4U0EA 3DS5A 2ONTA 4XROA 1E6JP 2XT1A 3DPHA 2LF4A 3DS2A 2M8PA 5DCKA 4M0IA 2KODA 1EIAA 4WYMA 3MGEA 5HGOA 5JPAA 1A43A 4U0DA 5I4TG
chains in the Genus database with same CATH superfamily
2FADA 1OR5A 1RO0A 1ACPA 3CCSP 4UHPB 5BS1A 4PH1A 1KLPA 4IPYA 2L6EA 2PNGA 1L0HA 4U0AA 1CEIA 2EHSA 1GXGA 2M8NA 3I56P 2N50A 4PH0A 3CC4P 2KR5A 2FVAA 4PWVB 1L0IA 2K2QA 3I55P 4M0IA 1EMVA 2X2BA 5JPAA 3CCVP 3Q20A 1IMPA 5CZDB 1M6EX 1E0HA 1QRJA 2L9FA 2CNRA 2QEXP 2GDYA 2MR8A 3GKLC 2OTJP 2VLPA 1MZ8A 4XFZA 2GZGA 2M8LA 1M74A 3DS0A 4XRQA 1GPJA 2FQ0A 2GDWA 2GDXA 2K0XA 1E6JP 3DPHA 3EJDA 2N98A 2JU2A 4NEOA 3CPWO 2KOSA 4QNBA 5KP7B 2KGCA 3LMOA 3B4QA 3CMEP 2AF8A 1Q86Q 1JJ2O 1NJIQ 1UNKA 2K0DX 3CC7P 5HV8A 4CA3A 2FQ2A 4GR2A 3G6EP 1W2BO 5BS2A 2GYKA 2XXMA 1KQSO 2XV6A 5HGMA 3DTJA 1X3OA 2MF4A 1YJWP 3HYBA 4MRTC 3EJBA 3B5IA 4U0EA 5EJDA 4H2XC 2PENA 1BXIA 2BHVA 2EFJA 1EOQA 2N5HA 3P05A 3GZLA 2PEKA 3CE7A 3G26A 1UJZA 2CWOA 1M1KQ 2JYGA 2LKIA 3GZMA 1YJNP 5HVCA 4IZ6A 3CCLP 2EG5A 1A43A 2PEQA 1T8KA 3WBHA 5I4TG 2EHTA 2MVVA 2JO0A 2XZ0D 5F2OA 1Z6MA 4H2WC 1K9MQ 2Z45A 4XFXA 2L22A 1ZMBA 2E1MA 2FACA 2K94A 3CCUP 1YJ9P 4PXHB 2AFDA 1AF8A 3DS1A 2KOOA 2K92A 1YITP 4U0CA 3DS4A 3G28A 1KD1Q 2GZFA 4GR6A 2K5XA 1K30A 2OTLP 1VQ9P 1KC8Q 2OARA 2KODA 3H0DA 3EJEA 2QNWA 2FQ1A 2EIAA 2PEMA 3LRYA 2MY5A 2NO8A 1DV5A 1VQOP 2JU1A 1Q7YQ 4XROA 2N6ZA 1ZNVA 3CD6P 5HGNA 2LMLA 3U43A 1K8AQ 2LIUA 3CXCO 1IMQA 1FR2A 2CGQA 2KGAA 2LL8A 2LOLA 2KG8A 1YI2P 3G1IA 2VLQA 1RNIA 2JBGA 3E2DA 3NY7B 1GXHA 5DCKA 2PEOA 1VQNP 4U0BA 3CCRP 3RG2A 2VLOA 2DNWA 1D1DA 2KW2A 2BUOA 1YHQP 1VQ4P 1AUMA 1VQ6P 2M5RA 5F2NA 2L0QA 3CC2P 4BPFA 3OW2O 3DS5A 2ONTA 1N8RQ 2PY8A 2K93A 4WYMA 1M90Q 1QVFO 2MVUA 4U0DA 2AVAA 1K73Q 2KG6A 2KWLA 4COPA 3NTEA 4XFYA 2XZ1C 1VQKP 3G1GA 2KOPA 1HQBA 2PEJA 2GZIA 2MD9A 3CCEP 4BPHA 2Z46A 2KG9A 5KP8B 2FHSC 1YIJP 3CCQP 3VRLC 3H4EA 2FVFA 2FVEA 2Z44A 4U0FA 3DS3A 3GJNA 1QVGO 3G71P 1AYIA 2CQ8A 2PEIA 4QKOA 5HGOA 2LPKA 1VQMP 3G21A 2KOQA 2VSQA 7CEIA 3G0VA 3HZQA 4DG9A 2KGEA 2ERHA 1RO2A 2CG5B 2JYLA 4H2YC 2N5IA 2VLNA 1IUQA 1EIAA 2LIWA 1Q81Q 1A8OA 1F80D 2GZJA 3G4SP 2L4BA 2JGPA 1BAJA 2K0YA 1VKUA 2WPTA 2JQ4A 1VHNA 1VQLP 5EW5E 1M6NA 3H47A 3CCMP 4F37A 2KGDA 3CMAP 4R0MA 3M1MA 1VQPP 2ROQA 3DS2A 2AFEA 1S72P 1DNYA 2MR7A 2KORA 5KP6B 2JB0A 2N6YA 2DGYA 2FAEA 1VQ5P 1VQ8P 5HGLA 3RG6C 5F2KA 4BPGA 3CCJP 4HKGA 2LTEA 4COCA 3G29A 1NQ4A 2GZEA 1HY8A 2XT1A 2LF4A 1VQ7P 2M8PA 3MGEA 2JAZA 2P9XA 2QA4P 1Q82Q
chains in the Genus database with same CATH topology
1YIJP 5BS2A 2XXMA 3CCQP 1RO0A 3CCSP 1KQSO 2XV6A 3VRLC 5HGMA 3DTJA 3H4EA 1YJWP 2Z44A 2EIAA 2PEMA 3LRYA 4U0FA 5BS1A 3HYBA 3DS3A 4PH1A 4IPYA 2L6EA 3B5IA 1VQOP 1QVGO 4U0AA 4U0EA 3G71P 1Q7YQ 4XROA 2PEIA 5HGOA 2PENA 1VQMP 2BHVA 3G21A 3CD6P 2M8NA 3I56P 3H0DA 2EFJA 5HGNA 1EOQA 1K8AQ 3P05A 3CXCO 3G0VA 2PEKA 3HZQA 4PH0A 3CC4P 3G26A 2CWOA 1M1KQ 2JYGA 1RO2A 2JYLA 1YI2P 3G1IA 1YJNP 1RNIA 3I55P 3E2DA 5DCKA 2PEOA 1IUQA 4M0IA 3CCLP 1EIAA 5JPAA 2EG5A 2PEQA 1A43A 3WBHA 1Q81Q 5I4TG 1VQNP 1A8OA 3CCVP 3Q20A 4U0BA 3CCRP 3G4SP 1D1DA 1M6EX 1QRJA 2BUOA 2QEXP 1YHQP 1VQ4P 1BAJA 2JO0A 5F2OA 2OTJP 1AUMA 4XFZA 1VQ6P 1K9MQ 5F2NA 2Z45A 1VQLP 2M8LA 3CC2P 4XFXA 1M74A 1M6NA 3H47A 3CCMP 3DS0A 3CMAP 4XRQA 3OW2O 3DS5A 3M1MA 2ONTA 1VQPP 1N8RQ 1ZMBA 3DS2A 1E6JP 2E1MA 3DPHA 2PY8A 1S72P 4WYMA 1M90Q 1QVFO 4U0DA 3CPWO 3CCUP 1YJ9P 4QNBA 1K73Q 2DGYA 4COPA 3NTEA 1VQ5P 4XFYA 1VQ8P 1VQKP 3G1GA 5HGLA 3RG6C 5F2KA 3CMEP 3DS1A 3CCJP 1Q86Q 4COCA 3G29A 1JJ2O 1YITP 2PEJA 4U0CA 3DS4A 3G28A 3CCEP 1NJIQ 1KD1Q 4GR6A 3CC7P 1K30A 2OTLP 2XT1A 2LF4A 1KC8Q 2M8PA 2OARA 2Z46A 4GR2A 3G6EP 1VQ7P 1VQ9P 2KODA 1W2BO 3MGEA 2P9XA 2QA4P 1Q82Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A8O A;  3G21 A;  4U0B A;  2M8N A;  4QNB A;  5HGN A;  1D1D A;  1QRJ A;  1EOQ A;  2XXM A;  4COP A;  3NTE A;  2BUO A;  2XV6 A;  4XFY A;  3VRL C;  3P05 A;  1BAJ A;  3G0V A;  5HGM A;  2JO0 A;  3DTJ A;  3G1G A;  3H4E A;  5HGL A;  1AUM A;  2EIA A;  4U0F A;  3LRY A;  3DS1 A;  4XFZ A;  4PH0 A;  3G26 A;  3DS3 A;  2M8L A;  3G29 A;  2JYG A;  4XFX A;  4PH1 A;  3H47 A;  4COC A;  2JYL A;  3DS0 A;  3DS4 A;  3G28 A;  4IPY A;  3G1I A;  4U0C A;  2L6E A;  4XRQ A;  4U0A A;  4U0E A;  3DS5 A;  2ONT A;  4XRO A;  1E6J P;  2XT1 A;  3DPH A;  2LF4 A;  3DS2 A;  2M8P A;  5DCK A;  4M0I A;  2KOD A;  1EIA A;  4WYM A;  3MGE A;  5HGO A;  5JPA A;  1A43 A;  4U0D A;  5I4T G; 
#chains in the Genus database with same CATH topology
 2FAD A;  1OR5 A;  1RO0 A;  1ACP A;  3CCS P;  4UHP B;  5BS1 A;  4PH1 A;  1KLP A;  4IPY A;  2L6E A;  2PNG A;  1L0H A;  4U0A A;  1CEI A;  2EHS A;  1GXG A;  2M8N A;  3I56 P;  2N50 A;  4PH0 A;  3CC4 P;  2KR5 A;  2FVA A;  4PWV B;  1L0I A;  2K2Q A;  3I55 P;  4M0I A;  1EMV A;  2X2B A;  5JPA A;  3CCV P;  3Q20 A;  1IMP A;  5CZD B;  1M6E X;  1E0H A;  1QRJ A;  2L9F A;  2CNR A;  2QEX P;  2GDY A;  2MR8 A;  3GKL C;  2OTJ P;  2VLP A;  1MZ8 A;  4XFZ A;  2GZG A;  2M8L A;  1M74 A;  3DS0 A;  4XRQ A;  1GPJ A;  2FQ0 A;  2GDW A;  2GDX A;  2K0X A;  1E6J P;  3DPH A;  3EJD A;  2N98 A;  2JU2 A;  4NEO A;  3CPW O;  2KOS A;  4QNB A;  5KP7 B;  2KGC A;  3LMO A;  3B4Q A;  3CME P;  2AF8 A;  1Q86 Q;  1JJ2 O;  1NJI Q;  1UNK A;  2K0D X;  3CC7 P;  5HV8 A;  4CA3 A;  2FQ2 A;  4GR2 A;  3G6E P;  1W2B O;  5BS2 A;  2GYK A;  2XXM A;  1KQS O;  2XV6 A;  5HGM A;  3DTJ A;  1X3O A;  2MF4 A;  1YJW P;  3HYB A;  4MRT C;  3EJB A;  3B5I A;  4U0E A;  5EJD A;  4H2X C;  2PEN A;  1BXI A;  2BHV A;  2EFJ A;  1EOQ A;  2N5H A;  3P05 A;  3GZL A;  2PEK A;  3CE7 A;  3G26 A;  1UJZ A;  2CWO A;  1M1K Q;  2JYG A;  2LKI A;  3GZM A;  1YJN P;  5HVC A;  4IZ6 A;  3CCL P;  2EG5 A;  1A43 A;  2PEQ A;  1T8K A;  3WBH A;  5I4T G;  2EHT A;  2MVV A;  2JO0 A;  2XZ0 D;  5F2O A;  1Z6M A;  4H2W C;  1K9M Q;  2Z45 A;  4XFX A;  2L22 A;  1ZMB A;  2E1M A;  2FAC A;  2K94 A;  3CCU P;  1YJ9 P;  4PXH B;  2AFD A;  1AF8 A;  3DS1 A;  2KOO A;  2K92 A;  1YIT P;  4U0C A;  3DS4 A;  3G28 A;  1KD1 Q;  2GZF A;  4GR6 A;  2K5X A;  1K30 A;  2OTL P;  1VQ9 P;  1KC8 Q;  2OAR A;  2KOD A;  3H0D A;  3EJE A;  2QNW A;  2FQ1 A;  2EIA A;  2PEM A;  3LRY A;  2MY5 A;  2NO8 A;  1DV5 A;  1VQO P;  2JU1 A;  1Q7Y Q;  4XRO A;  2N6Z A;  1ZNV A;  3CD6 P;  5HGN A;  2LML A;  3U43 A;  1K8A Q;  2LIU A;  3CXC O;  1IMQ A;  1FR2 A;  2CGQ A;  2KGA A;  2LL8 A;  2LOL A;  2KG8 A;  1YI2 P;  3G1I A;  2VLQ A;  1RNI A;  2JBG A;  3E2D A;  3NY7 B;  1GXH A;  5DCK A;  2PEO A;  1VQN P;  4U0B A;  3CCR P;  3RG2 A;  2VLO A;  2DNW A;  1D1D A;  2KW2 A;  2BUO A;  1YHQ P;  1VQ4 P;  1AUM A;  1VQ6 P;  2M5R A;  5F2N A;  2L0Q A;  3CC2 P;  4BPF A;  3OW2 O;  3DS5 A;  2ONT A;  1N8R Q;  2PY8 A;  2K93 A;  4WYM A;  1M90 Q;  1QVF O;  2MVU A;  4U0D A;  2AVA A;  1K73 Q;  2KG6 A;  2KWL A;  4COP A;  3NTE A;  4XFY A;  2XZ1 C;  1VQK P;  3G1G A;  2KOP A;  1HQB A;  2PEJ A;  2GZI A;  2MD9 A;  3CCE P;  4BPH A;  2Z46 A;  2KG9 A;  5KP8 B;  2FHS C;  1YIJ P;  3CCQ P;  3VRL C;  3H4E A;  2FVF A;  2FVE A;  2Z44 A;  4U0F A;  3DS3 A;  3GJN A;  1QVG O;  3G71 P;  1AYI A;  2CQ8 A;  2PEI A;  4QKO A;  5HGO A;  2LPK A;  1VQM P;  3G21 A;  2KOQ A;  2VSQ A;  7CEI A;  3G0V A;  3HZQ A;  4DG9 A;  2KGE A;  2ERH A;  1RO2 A;  2CG5 B;  2JYL A;  4H2Y C;  2N5I A;  2VLN A;  1IUQ A;  1EIA A;  2LIW A;  1Q81 Q;  1A8O A;  1F80 D;  2GZJ A;  3G4S P;  2L4B A;  2JGP A;  1BAJ A;  2K0Y A;  1VKU A;  2WPT A;  2JQ4 A;  1VHN A;  1VQL P;  5EW5 E;  1M6N A;  3H47 A;  3CCM P;  4F37 A;  2KGD A;  3CMA P;  4R0M A;  3M1M A;  1VQP P;  2ROQ A;  3DS2 A;  2AFE A;  1S72 P;  1DNY A;  2MR7 A;  2KOR A;  5KP6 B;  2JB0 A;  2N6Y A;  2DGY A;  2FAE A;  1VQ5 P;  1VQ8 P;  5HGL A;  3RG6 C;  5F2K A;  4BPG A;  3CCJ P;  4HKG A;  2LTE A;  4COC A;  3G29 A;  1NQ4 A;  2GZE A;  1HY8 A;  2XT1 A;  2LF4 A;  1VQ7 P;  2M8P A;  3MGE A;  2JAZ A;  2P9X A;  2QA4 P;  1Q82 Q; 
#chains in the Genus database with same CATH homology
 1YIJ P;  5BS2 A;  2XXM A;  3CCQ P;  1RO0 A;  3CCS P;  1KQS O;  2XV6 A;  3VRL C;  5HGM A;  3DTJ A;  3H4E A;  1YJW P;  2Z44 A;  2EIA A;  2PEM A;  3LRY A;  4U0F A;  5BS1 A;  3HYB A;  3DS3 A;  4PH1 A;  4IPY A;  2L6E A;  3B5I A;  1VQO P;  1QVG O;  4U0A A;  4U0E A;  3G71 P;  1Q7Y Q;  4XRO A;  2PEI A;  5HGO A;  2PEN A;  1VQM P;  2BHV A;  3G21 A;  3CD6 P;  2M8N A;  3I56 P;  3H0D A;  2EFJ A;  5HGN A;  1EOQ A;  1K8A Q;  3P05 A;  3CXC O;  3G0V A;  2PEK A;  3HZQ A;  4PH0 A;  3CC4 P;  3G26 A;  2CWO A;  1M1K Q;  2JYG A;  1RO2 A;  2JYL A;  1YI2 P;  3G1I A;  1YJN P;  1RNI A;  3I55 P;  3E2D A;  5DCK A;  2PEO A;  1IUQ A;  4M0I A;  3CCL P;  1EIA A;  5JPA A;  2EG5 A;  2PEQ A;  1A43 A;  3WBH A;  1Q81 Q;  5I4T G;  1VQN P;  1A8O A;  3CCV P;  3Q20 A;  4U0B A;  3CCR P;  3G4S P;  1D1D A;  1M6E X;  1QRJ A;  2BUO A;  2QEX P;  1YHQ P;  1VQ4 P;  1BAJ A;  2JO0 A;  5F2O A;  2OTJ P;  1AUM A;  4XFZ A;  1VQ6 P;  1K9M Q;  5F2N A;  2Z45 A;  1VQL P;  2M8L A;  3CC2 P;  4XFX A;  1M74 A;  1M6N A;  3H47 A;  3CCM P;  3DS0 A;  3CMA P;  4XRQ A;  3OW2 O;  3DS5 A;  3M1M A;  2ONT A;  1VQP P;  1N8R Q;  1ZMB A;  3DS2 A;  1E6J P;  2E1M A;  3DPH A;  2PY8 A;  1S72 P;  4WYM A;  1M90 Q;  1QVF O;  4U0D A;  3CPW O;  3CCU P;  1YJ9 P;  4QNB A;  1K73 Q;  2DGY A;  4COP A;  3NTE A;  1VQ5 P;  4XFY A;  1VQ8 P;  1VQK P;  3G1G A;  5HGL A;  3RG6 C;  5F2K A;  3CME P;  3DS1 A;  3CCJ P;  1Q86 Q;  4COC A;  3G29 A;  1JJ2 O;  1YIT P;  2PEJ A;  4U0C A;  3DS4 A;  3G28 A;  3CCE P;  1NJI Q;  1KD1 Q;  4GR6 A;  3CC7 P;  1K30 A;  2OTL P;  2XT1 A;  2LF4 A;  1KC8 Q;  2M8P A;  2OAR A;  2Z46 A;  4GR2 A;  3G6E P;  1VQ7 P;  1VQ9 P;  2KOD A;  1W2B O;  3MGE A;  2P9X A;  2QA4 P;  1Q82 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...