3G29A

Crystal structure of the c-terminal domain of the rous sarcoma virus capsid protein: d179n mutant, neutral ph
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
77
structure length
77
Chain Sequence
AGPWADIMQGPSESFVDFANRLIKAVEGSNLPPSARAPVIIDCFRQKSQPDIQQLIRTAPSTLTTPGEIIKYVLDRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Proton-linked dimerization of a retroviral capsid protein initiates capsid assembly
pubmed doi rcsb
source organism Rous sarcoma virus
molecule tags Viral protein
molecule keywords Gag polyprotein
total genus 24
structure length 77
sequence length 77
chains with identical sequence B
ec nomenclature ec 3.4.23.-:
pdb deposition date 2009-01-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3g29A00
3G26A 4U0AA 1BAJA 2M8LA 5HGNA 3H47A 2XXMA 2EIAA 1AUMA 2XT1A 2JO0A 2BUOA 3G0VA 3G21A 2LF4A 4PH1A 4U0EA 4XRQA 3VRLC 3DPHA 4COPA 4IPYA 4M0IA 4COCA 2M8NA 1QRJA 3G1GA 3G29A 4XFZA 4U0FA 4WYMA 3NTEA 3P05A 3LRYA 4PH0A 5HGMA 1EIAA 2L6EA 2KODA 3DS4A 4XROA 5HGOA 3DS0A 2JYGA 5DCKA 1D1DA 3DS3A 3DS5A 1A43A 3DS1A 3G1IA 4QNBA 3DTJA 5HGLA 4XFXA 5JPAA 2M8PA 2ONTA 3H4EA 3MGEA 4U0DA 4U0BA 2JYLA 2XV6A 4XFYA 4U0CA 5I4TG 1E6JP 1EOQA 3DS2A 1A8OA 3G28A
chains in the Genus database with same CATH superfamily
2KW2A 3CCRP 2GDWA 2XXMA 1ZMBA 2N6ZA 2MR7A 1M6EX 2AF8A 1Q7YQ 1K30A 3DS0A 2AFEA 5F2NA 3G1IA 1X3OA 2CWOA 1IMQA 2OTLP 3CE7A 1VQ5P 3G26A 4U0AA 1NQ4A 2KGDA 2EIAA 2CNRA 3CCSP 3G29A 4U0FA 1IMPA 2CGQA 5EJDA 2ERHA 1IUQA 2KOPA 4BPHA 3G28A 1Q82Q 1BAJA 1Z6MA 1YJWP 3CXCO 3VRLC 2BUOA 4U0EA 4IPYA 1M1KQ 1S72P 5F2KA 2VLQA 4BPGA 3WBHA 2K92A 2FQ1A 2FADA 5BS2A 1VQMP 5HGNA 1RO0A 3EJDA 5HV8A 2QA4P 2P9XA 2GZIA 2KGEA 4GR6A 2K0DX 2PENA 2KODA 1VQLP 2KOQA 1KC8Q 2KGCA 1UNKA 3EJBA 3CCEP 1VQOP 2XZ1C 1VQKP 2VSQA 4PXHB 2MR8A 3NTEA 1VHNA 2KG9A 2L6EA 3CC7P 2QNWA 2K94A 2OARA 3DTJA 2L0QA 3LMOA 2XZ0D 2GDXA 1AYIA 2PNGA 2FVAA 2N98A 2M8LA 1YITP 3Q20A 4PH0A 5F2OA 1YHQP 2L4BA 1VQ6P 2KORA 3RG2A 1K8AQ 2GYKA 2GDYA 2JYGA 1N8RQ 3HYBA 2N6YA 2M8PA 2ONTA 4XFYA 1K9MQ 2LKIA 2MVVA 2E1MA 3I55P 1CEIA 2VLPA 3U43A 1M74A 3H47A 2JU2A 2K2QA 3G6EP 4NEOA 2L9FA 2CQ8A 4COCA 3G1GA 2MF4A 3DS4A 4H2WC 1M6NA 3EJEA 5DCKA 7CEIA 3CCJP 1QVFO 2LL8A 4U0CA 5I4TG 2FAEA 2ROQA 1A8OA 3CCLP 4HKGA 5BS1A 2KOSA 3GZLA 3B4QA 1FR2A 1DV5A 3CCQP 4XFZA 2EFJA 4WYMA 2EHSA 3LRYA 2GZJA 2JU1A 2FQ2A 1A43A 3DS1A 5JPAA 3HZQA 3MGEA 2MVUA 3GKLC 1KQSO 3CMEP 2JBGA 2GZFA 2JAZA 2BHVA 2JB0A 3G21A 1VKUA 3DPHA 3CD6P 1GXGA 1UJZA 1QRJA 2LOLA 1T8KA 1MZ8A 2PEIA 2PEQA 3GZMA 5HGMA 3I56P 1NJIQ 1D1DA 2N5HA 1VQ4P 5HGLA 1AF8A 2Z46A 3E2DA 2LPKA 2CG5B 3G71P 4QNBA 2KGAA 1Q86Q 1ACPA 1AUMA 2XT1A 2JO0A 1EMVA 2L22A 4XRQA 2LIUA 5KP8B 1RO2A 2K0XA 5HGOA 1EIAA 1L0HA 2FHSC 2XV6A 2JQ4A 3DS2A 2KR5A 4QKOA 5HVCA 3GJNA 1W2BO 2M8NA 1GXHA 1M90Q 1L0IA 4XROA 2PY8A 2EHTA 2VLOA 3CCUP 1OR5A 5EW5E 2JYLA 3CC2P 1E6JP 2KG8A 5CZDB 3CCVP 4DG9A 3RG6C 2OTJP 1KD1Q 3G0VA 1VQ8P 1Q81Q 1K73Q 2JGPA 4CA3A 4H2XC 3H0DA 2EG5A 2FVFA 2GZGA 2WPTA 1QVGO 2FACA 2KG6A 4PWVB 4UHPB 1VQPP 2N5IA 3CCMP 1RNIA 2LMLA 2FVEA 4F37A 2N50A 1YIJP 1VQ7P 4U0DA 3G4SP 4XFXA 1VQNP 2AVAA 2X2BA 2PEJA 2PEKA 2LF4A 2NO8A 4M0IA 2VLNA 2LIWA 3M1MA 5KP7B 1YI2P 3CMAP 3DS3A 2DGYA 2QEXP 2KWLA 4R0MA 4GR2A 4U0BA 1EOQA 2GZEA 3B5IA 2M5RA 1KLPA 4PH1A 2K5XA 4COPA 1E0HA 3P05A 4H2YC 2PEOA 3CC4P 2MY5A 2Z45A 3OW2O 2FQ0A 1YJ9P 3H4EA 1VQ9P 1JJ2O 2LTEA 1GPJA 4MRTC 4BPFA 2PEMA 1DNYA 2K93A 1BXIA 1ZNVA 2KOOA 3NY7B 1YJNP 1HQBA 1HY8A 3DS5A 3CPWO 1F80D 2K0YA 2Z44A 5KP6B 4IZ6A 2AFDA 2DNWA 2MD9A
chains in the Genus database with same CATH topology
3CMEP 3CCRP 2XXMA 1ZMBA 2BHVA 3G21A 3CD6P 1M6EX 3DPHA 1VQPP 3CCMP 1QRJA 1K30A 1Q7YQ 1RNIA 2PEIA 3NTEA 2PEQA 5HGMA 3I56P 2L6EA 3CC7P 1NJIQ 3DS0A 1D1DA 1YIJP 1VQ4P 2OARA 5F2NA 3G1IA 3DTJA 5HGLA 1VQ7P 2CWOA 4U0DA 2OTLP 3G4SP 2Z46A 3E2DA 4XFXA 3G71P 4QNBA 1VQ5P 1VQNP 3G26A 4U0AA 2M8LA 1Q86Q 2PEJA 1YITP 2EIAA 3Q20A 1AUMA 2XT1A 2JO0A 2PEKA 2LF4A 5F2OA 4PH0A 4XRQA 1YHQP 1VQ6P 3CCSP 4M0IA 3G29A 1RO2A 4U0FA 1K8AQ 5HGOA 1EIAA 3M1MA 1YI2P 3CMAP 2JYGA 1N8RQ 3DS3A 2DGYA 3HYBA 2QEXP 4GR2A 2M8PA 2ONTA 4U0BA 4XFYA 2XV6A 1K9MQ 1IUQA 2E1MA 3I55P 1EOQA 3DS2A 3G28A 3B5IA 1Q82Q 1BAJA 1M74A 3H47A 1YJWP 3CXCO 4PH1A 2BUOA 3VRLC 4COPA 3G6EP 4U0EA 1W2BO 4IPYA 4COCA 2M8NA 3G1GA 1M1KQ 1S72P 5F2KA 3P05A 1M90Q 2PEOA 3DS4A 4XROA 1M6NA 2PY8A 3WBHA 3CC4P 5DCKA 3CCJP 2Z45A 3OW2O 3CCUP 1QVFO 1YJ9P 3H4EA 1VQ9P 2JYLA 1JJ2O 3CC2P 4U0CA 5I4TG 1E6JP 1A8OA 3CCLP 5BS2A 5BS1A 1VQMP 5HGNA 1RO0A 3CCVP 2PEMA 3RG6C 2OTJP 1KD1Q 3G0VA 2QA4P 2P9XA 3CCQP 4GR6A 4XFZA 1VQ8P 2EFJA 1Q81Q 4WYMA 1K73Q 2PENA 3LRYA 2KODA 1YJNP 1VQLP 3DS5A 1A43A 3DS1A 3CPWO 1KC8Q 5JPAA 3H0DA 2EG5A 3HZQA 3MGEA 1QVGO 3CCEP 2Z44A 1VQOP 1KQSO 1VQKP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G26 A;  4U0A A;  1BAJ A;  2M8L A;  5HGN A;  3H47 A;  2XXM A;  2EIA A;  1AUM A;  2XT1 A;  2JO0 A;  2BUO A;  3G0V A;  3G21 A;  2LF4 A;  4PH1 A;  4U0E A;  4XRQ A;  3VRL C;  3DPH A;  4COP A;  4IPY A;  4M0I A;  4COC A;  2M8N A;  1QRJ A;  3G1G A;  3G29 A;  4XFZ A;  4U0F A;  4WYM A;  3NTE A;  3P05 A;  3LRY A;  4PH0 A;  5HGM A;  1EIA A;  2L6E A;  2KOD A;  3DS4 A;  4XRO A;  5HGO A;  3DS0 A;  2JYG A;  5DCK A;  1D1D A;  3DS3 A;  3DS5 A;  1A43 A;  3DS1 A;  3G1I A;  4QNB A;  3DTJ A;  5HGL A;  4XFX A;  5JPA A;  2M8P A;  2ONT A;  3H4E A;  3MGE A;  4U0D A;  4U0B A;  2JYL A;  2XV6 A;  4XFY A;  4U0C A;  5I4T G;  1E6J P;  1EOQ A;  3DS2 A;  1A8O A;  3G28 A; 
#chains in the Genus database with same CATH topology
 2KW2 A;  3CCR P;  2GDW A;  2XXM A;  1ZMB A;  2N6Z A;  2MR7 A;  1M6E X;  2AF8 A;  1Q7Y Q;  1K30 A;  3DS0 A;  2AFE A;  5F2N A;  3G1I A;  1X3O A;  2CWO A;  1IMQ A;  2OTL P;  3CE7 A;  1VQ5 P;  3G26 A;  4U0A A;  1NQ4 A;  2KGD A;  2EIA A;  2CNR A;  3CCS P;  3G29 A;  4U0F A;  1IMP A;  2CGQ A;  5EJD A;  2ERH A;  1IUQ A;  2KOP A;  4BPH A;  3G28 A;  1Q82 Q;  1BAJ A;  1Z6M A;  1YJW P;  3CXC O;  3VRL C;  2BUO A;  4U0E A;  4IPY A;  1M1K Q;  1S72 P;  5F2K A;  2VLQ A;  4BPG A;  3WBH A;  2K92 A;  2FQ1 A;  2FAD A;  5BS2 A;  1VQM P;  5HGN A;  1RO0 A;  3EJD A;  5HV8 A;  2QA4 P;  2P9X A;  2GZI A;  2KGE A;  4GR6 A;  2K0D X;  2PEN A;  2KOD A;  1VQL P;  2KOQ A;  1KC8 Q;  2KGC A;  1UNK A;  3EJB A;  3CCE P;  1VQO P;  2XZ1 C;  1VQK P;  2VSQ A;  4PXH B;  2MR8 A;  3NTE A;  1VHN A;  2KG9 A;  2L6E A;  3CC7 P;  2QNW A;  2K94 A;  2OAR A;  3DTJ A;  2L0Q A;  3LMO A;  2XZ0 D;  2GDX A;  1AYI A;  2PNG A;  2FVA A;  2N98 A;  2M8L A;  1YIT P;  3Q20 A;  4PH0 A;  5F2O A;  1YHQ P;  2L4B A;  1VQ6 P;  2KOR A;  3RG2 A;  1K8A Q;  2GYK A;  2GDY A;  2JYG A;  1N8R Q;  3HYB A;  2N6Y A;  2M8P A;  2ONT A;  4XFY A;  1K9M Q;  2LKI A;  2MVV A;  2E1M A;  3I55 P;  1CEI A;  2VLP A;  3U43 A;  1M74 A;  3H47 A;  2JU2 A;  2K2Q A;  3G6E P;  4NEO A;  2L9F A;  2CQ8 A;  4COC A;  3G1G A;  2MF4 A;  3DS4 A;  4H2W C;  1M6N A;  3EJE A;  5DCK A;  7CEI A;  3CCJ P;  1QVF O;  2LL8 A;  4U0C A;  5I4T G;  2FAE A;  2ROQ A;  1A8O A;  3CCL P;  4HKG A;  5BS1 A;  2KOS A;  3GZL A;  3B4Q A;  1FR2 A;  1DV5 A;  3CCQ P;  4XFZ A;  2EFJ A;  4WYM A;  2EHS A;  3LRY A;  2GZJ A;  2JU1 A;  2FQ2 A;  1A43 A;  3DS1 A;  5JPA A;  3HZQ A;  3MGE A;  2MVU A;  3GKL C;  1KQS O;  3CME P;  2JBG A;  2GZF A;  2JAZ A;  2BHV A;  2JB0 A;  3G21 A;  1VKU A;  3DPH A;  3CD6 P;  1GXG A;  1UJZ A;  1QRJ A;  2LOL A;  1T8K A;  1MZ8 A;  2PEI A;  2PEQ A;  3GZM A;  5HGM A;  3I56 P;  1NJI Q;  1D1D A;  2N5H A;  1VQ4 P;  5HGL A;  1AF8 A;  2Z46 A;  3E2D A;  2LPK A;  2CG5 B;  3G71 P;  4QNB A;  2KGA A;  1Q86 Q;  1ACP A;  1AUM A;  2XT1 A;  2JO0 A;  1EMV A;  2L22 A;  4XRQ A;  2LIU A;  5KP8 B;  1RO2 A;  2K0X A;  5HGO A;  1EIA A;  1L0H A;  2FHS C;  2XV6 A;  2JQ4 A;  3DS2 A;  2KR5 A;  4QKO A;  5HVC A;  3GJN A;  1W2B O;  2M8N A;  1GXH A;  1M90 Q;  1L0I A;  4XRO A;  2PY8 A;  2EHT A;  2VLO A;  3CCU P;  1OR5 A;  5EW5 E;  2JYL A;  3CC2 P;  1E6J P;  2KG8 A;  5CZD B;  3CCV P;  4DG9 A;  3RG6 C;  2OTJ P;  1KD1 Q;  3G0V A;  1VQ8 P;  1Q81 Q;  1K73 Q;  2JGP A;  4CA3 A;  4H2X C;  3H0D A;  2EG5 A;  2FVF A;  2GZG A;  2WPT A;  1QVG O;  2FAC A;  2KG6 A;  4PWV B;  4UHP B;  1VQP P;  2N5I A;  3CCM P;  1RNI A;  2LML A;  2FVE A;  4F37 A;  2N50 A;  1YIJ P;  1VQ7 P;  4U0D A;  3G4S P;  4XFX A;  1VQN P;  2AVA A;  2X2B A;  2PEJ A;  2PEK A;  2LF4 A;  2NO8 A;  4M0I A;  2VLN A;  2LIW A;  3M1M A;  5KP7 B;  1YI2 P;  3CMA P;  3DS3 A;  2DGY A;  2QEX P;  2KWL A;  4R0M A;  4GR2 A;  4U0B A;  1EOQ A;  2GZE A;  3B5I A;  2M5R A;  1KLP A;  4PH1 A;  2K5X A;  4COP A;  1E0H A;  3P05 A;  4H2Y C;  2PEO A;  3CC4 P;  2MY5 A;  2Z45 A;  3OW2 O;  2FQ0 A;  1YJ9 P;  3H4E A;  1VQ9 P;  1JJ2 O;  2LTE A;  1GPJ A;  4MRT C;  4BPF A;  2PEM A;  1DNY A;  2K93 A;  1BXI A;  1ZNV A;  2KOO A;  3NY7 B;  1YJN P;  1HQB A;  1HY8 A;  3DS5 A;  3CPW O;  1F80 D;  2K0Y A;  2Z44 A;  5KP6 B;  4IZ6 A;  2AFD A;  2DNW A;  2MD9 A; 
#chains in the Genus database with same CATH homology
 3CME P;  3CCR P;  2XXM A;  1ZMB A;  2BHV A;  3G21 A;  3CD6 P;  1M6E X;  3DPH A;  1VQP P;  3CCM P;  1QRJ A;  1K30 A;  1Q7Y Q;  1RNI A;  2PEI A;  3NTE A;  2PEQ A;  5HGM A;  3I56 P;  2L6E A;  3CC7 P;  1NJI Q;  3DS0 A;  1D1D A;  1YIJ P;  1VQ4 P;  2OAR A;  5F2N A;  3G1I A;  3DTJ A;  5HGL A;  1VQ7 P;  2CWO A;  4U0D A;  2OTL P;  3G4S P;  2Z46 A;  3E2D A;  4XFX A;  3G71 P;  4QNB A;  1VQ5 P;  1VQN P;  3G26 A;  4U0A A;  2M8L A;  1Q86 Q;  2PEJ A;  1YIT P;  2EIA A;  3Q20 A;  1AUM A;  2XT1 A;  2JO0 A;  2PEK A;  2LF4 A;  5F2O A;  4PH0 A;  4XRQ A;  1YHQ P;  1VQ6 P;  3CCS P;  4M0I A;  3G29 A;  1RO2 A;  4U0F A;  1K8A Q;  5HGO A;  1EIA A;  3M1M A;  1YI2 P;  3CMA P;  2JYG A;  1N8R Q;  3DS3 A;  2DGY A;  3HYB A;  2QEX P;  4GR2 A;  2M8P A;  2ONT A;  4U0B A;  4XFY A;  2XV6 A;  1K9M Q;  1IUQ A;  2E1M A;  3I55 P;  1EOQ A;  3DS2 A;  3G28 A;  3B5I A;  1Q82 Q;  1BAJ A;  1M74 A;  3H47 A;  1YJW P;  3CXC O;  4PH1 A;  2BUO A;  3VRL C;  4COP A;  3G6E P;  4U0E A;  1W2B O;  4IPY A;  4COC A;  2M8N A;  3G1G A;  1M1K Q;  1S72 P;  5F2K A;  3P05 A;  1M90 Q;  2PEO A;  3DS4 A;  4XRO A;  1M6N A;  2PY8 A;  3WBH A;  3CC4 P;  5DCK A;  3CCJ P;  2Z45 A;  3OW2 O;  3CCU P;  1QVF O;  1YJ9 P;  3H4E A;  1VQ9 P;  2JYL A;  1JJ2 O;  3CC2 P;  4U0C A;  5I4T G;  1E6J P;  1A8O A;  3CCL P;  5BS2 A;  5BS1 A;  1VQM P;  5HGN A;  1RO0 A;  3CCV P;  2PEM A;  3RG6 C;  2OTJ P;  1KD1 Q;  3G0V A;  2QA4 P;  2P9X A;  3CCQ P;  4GR6 A;  4XFZ A;  1VQ8 P;  2EFJ A;  1Q81 Q;  4WYM A;  1K73 Q;  2PEN A;  3LRY A;  2KOD A;  1YJN P;  1VQL P;  3DS5 A;  1A43 A;  3DS1 A;  3CPW O;  1KC8 Q;  5JPA A;  3H0D A;  2EG5 A;  3HZQ A;  3MGE A;  1QVG O;  3CCE P;  2Z44 A;  1VQO P;  1KQS O;  1VQK P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...