3G29A

Crystal structure of the c-terminal domain of the rous sarcoma virus capsid protein: d179n mutant, neutral ph
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
77
structure length
77
Chain Sequence
AGPWADIMQGPSESFVDFANRLIKAVEGSNLPPSARAPVIIDCFRQKSQPDIQQLIRTAPSTLTTPGEIIKYVLDRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein
molecule keywords Gag polyprotein
publication title Proton-linked dimerization of a retroviral capsid protein initiates capsid assembly
pubmed doi rcsb
source organism Rous sarcoma virus
total genus 24
structure length 77
sequence length 77
chains with identical sequence B
ec nomenclature ec 3.4.23.-:
pdb deposition date 2009-01-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3g29A00
1AUMA 3H47A 3G29A 2XT1A 4XFXA 3G1GA 4U0EA 5HGOA 5I4TG 5JPAA 3P05A 2XXMA 5HGMA 1D1DA 2KODA 4IPYA 2L6EA 2JYLA 1BAJA 2XV6A 3DTJA 1QRJA 4WYMA 4XROA 4U0FA 4COCA 4U0AA 3VRLC 3G21A 4U0CA 2EIAA 4XFZA 1E6JP 3LRYA 4PH1A 1EIAA 5HGLA 1EOQA 3DS4A 4XFYA 5DCKA 2M8LA 4COPA 4PH0A 4U0DA 3DS3A 3G28A 4QNBA 2LF4A 1A43A 3DPHA 2JO0A 3DS1A 2JYGA 2BUOA 4M0IA 3DS5A 3G26A 3DS0A 3MGEA 2M8PA 5HGNA 1A8OA 3H4EA 3G0VA 3G1IA 4U0BA 2M8NA 4XRQA 2ONTA 3DS2A 3NTEA
chains in the Genus database with same CATH superfamily
1GXGA 3H47A 1Q82Q 4H2WC 5HGOA 5EJDA 2MR7A 1Q81Q 1OR5A 2KG6A 2AF8A 1YIJP 2CWOA 2AFEA 4NEOA 3CMEP 1KD1Q 1EOQA 4XFYA 5CZDB 1F80D 1EMVA 1RO0A 2BUOA 3CE7A 3EJBA 3I55P 2AFDA 1A8OA 3GKLC 2PEIA 2PNGA 5HGMA 3CCVP 2KODA 2L6EA 2JYLA 2PEQA 2MR8A 1IMQA 3LRYA 3GZMA 4PH0A 2ERHA 1HQBA 2JQ4A 3MGEA 2Z44A 1QVGO 2VSQA 2K0YA 3HYBA 1T8KA 1K9MQ 1VQKP 1BAJA 1M74A 1EIAA 3DS4A 2FQ1A 1JJ2O 3LMOA 3G26A 2LPKA 3DS0A 1VQ5P 3CCJP 3E2DA 3H0DA 2FHSC 4XRQA 2VLNA 5BS1A 1VQLP 2Z45A 3RG6C 2MD9A 2CQ8A 4MRTC 5F2NA 3NY7B 2KOPA 2EHTA 1YJNP 2X2BA 2GDWA 2FQ2A 1M6EX 1GPJA 3G71P 1YITP 3DS2A 2VLOA 1VQ4P 4XFXA 5JPAA 3G1GA 4GR2A 2OTJP 2GDXA 1Z6MA 4U0FA 3VRLC 3B4QA 1UJZA 2EG5A 1AF8A 2FVAA 2L4BA 4U0DA 1VKUA 4F37A 2MVUA 2N98A 4R0MA 1Q7YQ 2K93A 2M8NA 4U0EA 3CC2P 3CCEP 2GYKA 2WPTA 4IPYA 3RG2A 1KC8Q 4XFZA 1E6JP 4PXHB 3U43A 4IZ6A 4BPFA 3WBHA 2K92A 2FAEA 2JB0A 2ONTA 2Z46A 1Q86Q 2LIUA 2KR5A 3P05A 1UNKA 2KWLA 2GZJA 4COCA 4BPGA 4U0AA 2EIAA 2JGPA 2L22A 5HV8A 1ZMBA 2LF4A 3DPHA 2OTLP 5BS2A 2CG5B 2JU2A 2XXMA 4QKOA 1VQ6P 4PH1A 5F2OA 3DS3A 1VQNP 4CA3A 1K73Q 2MF4A 2E1MA 2MY5A 3CPWO 2FQ0A 1KLPA 2P9XA 2K5XA 3GJNA 2GZIA 3CMAP 2LIWA 3OW2O 2KG8A 1K8AQ 2QEXP 1VQOP 3CCQP 2PEKA 2LTEA 1QVFO 3G0VA 2FVEA 4HKGA 2FVFA 3NTEA 5KP7B 1W2BO 5EW5E 5KP8B 2KGDA 3G6EP 2K94A 2KW2A 3Q20A 4XROA 4WYMA 2EFJA 5KP6B 2N5IA 2KOQA 2KGCA 5F2KA 2CNRA 2N5HA 4QNBA 1A43A 2DGYA 2K0XA 1IUQA 2M8PA 3HZQA 5HGNA 3CCMP 1K30A 3EJDA 2L0QA 2XZ0D 2QNWA 2JAZA 1M90Q 3CCLP 1RO2A 1GXHA 2N6ZA 3DTJA 2AVAA 2LKIA 3M1MA 1E0HA 2QA4P 1RNIA 2JO0A 2JYGA 2PEMA 4H2YC 3CXCO 1VHNA 1AUMA 5I4TG 2KGEA 2N50A 1QRJA 1MZ8A 4GR6A 2VLPA 3CCUP 2JU1A 5HGLA 3CC4P 5DCKA 4H2XC 4COPA 2K2QA 3CD6P 2GZGA 3GZLA 2GZEA 2CGQA 3G4SP 2KG9A 1VQ9P 3B5IA 2LL8A 2ROQA 2BHVA 2EHSA 3CCSP 1KQSO 3G28A 3DS1A 4M0IA 2KORA 1IMPA 2FACA 1HY8A 3G1IA 4PWVB 5HVCA 2VLQA 4DG9A 2KOOA 2GDYA 2LOLA 2PENA 3CCRP 2XZ1C 4UHPB 4BPHA 2PY8A 1CEIA 3H4EA 3DS5A 2NO8A 2FADA 1YJWP 1YHQP 2XT1A 1NJIQ 2PEOA 7CEIA 1N8RQ 2OARA 2XV6A 1NQ4A 1FR2A 1M1KQ 2L9FA 2M5RA 3CC7P 1VQMP 1L0HA 3I56P 1VQPP 1S72P 2K0DX 1VQ7P 2PEJA 1YJ9P 2KOSA 4U0BA 1D1DA 1M6NA 2N6YA 3G29A 1X3OA 1VQ8P 2JBGA 3G21A 4U0CA 2MVVA 1ZNVA 2DNWA 2M8LA 1YI2P 2GZFA 2KGAA 1L0IA 1ACPA 3EJEA 1BXIA 1AYIA 1DNYA 2LMLA 1DV5A
chains in the Genus database with same CATH topology
1VQ9P 3H47A 1Q82Q 1VQ4P 4XFXA 5HGOA 3G1GA 5JPAA 4GR2A 3B5IA 3CMAP 1Q81Q 2OTJP 2BHVA 4U0FA 3OW2O 1YIJP 2CWOA 3VRLC 2EG5A 1K8AQ 3CMEP 2QEXP 1EOQA 4XFYA 3CCSP 1KD1Q 1KQSO 4U0DA 1VQOP 3G28A 3DS1A 1RO0A 3CCQP 2BUOA 2PEKA 4M0IA 1QVFO 3I55P 1A8OA 3G0VA 1Q7YQ 3G1IA 2PEIA 2M8NA 3NTEA 1W2BO 4U0EA 3CC2P 3CCEP 5HGMA 3CCVP 2KODA 4IPYA 3G6EP 2L6EA 3Q20A 2JYLA 4XROA 2PEQA 2EFJA 4WYMA 2PENA 1KC8Q 4XFZA 3CCRP 1E6JP 3LRYA 4PH0A 5F2KA 4QNBA 1A43A 2DGYA 2PY8A 1IUQA 3MGEA 2Z44A 2M8PA 3HZQA 5HGNA 3CCMP 3H4EA 3WBHA 1QVGO 1K30A 3DS5A 2ONTA 2Z46A 1Q86Q 1YJWP 1YHQP 2XT1A 1NJIQ 1M90Q 3CCLP 3HYBA 2PEOA 3P05A 1RO2A 1N8RQ 1K9MQ 2OARA 1VQKP 1BAJA 2XV6A 3DTJA 4COCA 3M1MA 4U0AA 1M74A 2EIAA 1M1KQ 1EIAA 3CC7P 3DS4A 1ZMBA 2QA4P 1VQMP 3I56P 2LF4A 3DPHA 1VQPP 1RNIA 2JO0A 2JYGA 2PEMA 1S72P 1VQ7P 1JJ2O 2OTLP 3G26A 2PEJA 3DS0A 1YJ9P 3CXCO 5BS2A 1VQ5P 4U0BA 3CCJP 3E2DA 3H0DA 4XRQA 1D1DA 1M6NA 1AUMA 3G29A 5I4TG 5BS1A 2XXMA 1VQLP 2Z45A 1VQ8P 3RG6C 1QRJA 3G21A 4U0CA 1VQ6P 5F2NA 4GR6A 4PH1A 5HGLA 3CCUP 3CC4P 5DCKA 5F2OA 2M8LA 4COPA 1YI2P 3DS3A 1YJNP 1VQNP 3CD6P 1K73Q 2E1MA 3CPWO 1M6EX 3G4SP 3G71P 1YITP 2P9XA 3DS2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AUM A;  3H47 A;  3G29 A;  2XT1 A;  4XFX A;  3G1G A;  4U0E A;  5HGO A;  5I4T G;  5JPA A;  3P05 A;  2XXM A;  5HGM A;  1D1D A;  2KOD A;  4IPY A;  2L6E A;  2JYL A;  1BAJ A;  2XV6 A;  3DTJ A;  1QRJ A;  4WYM A;  4XRO A;  4U0F A;  4COC A;  4U0A A;  3VRL C;  3G21 A;  4U0C A;  2EIA A;  4XFZ A;  1E6J P;  3LRY A;  4PH1 A;  1EIA A;  5HGL A;  1EOQ A;  3DS4 A;  4XFY A;  5DCK A;  2M8L A;  4COP A;  4PH0 A;  4U0D A;  3DS3 A;  3G28 A;  4QNB A;  2LF4 A;  1A43 A;  3DPH A;  2JO0 A;  3DS1 A;  2JYG A;  2BUO A;  4M0I A;  3DS5 A;  3G26 A;  3DS0 A;  3MGE A;  2M8P A;  5HGN A;  1A8O A;  3H4E A;  3G0V A;  3G1I A;  4U0B A;  2M8N A;  4XRQ A;  2ONT A;  3DS2 A;  3NTE A; 
#chains in the Genus database with same CATH topology
 1GXG A;  3H47 A;  1Q82 Q;  4H2W C;  5HGO A;  5EJD A;  2MR7 A;  1Q81 Q;  1OR5 A;  2KG6 A;  2AF8 A;  1YIJ P;  2CWO A;  2AFE A;  4NEO A;  3CME P;  1KD1 Q;  1EOQ A;  4XFY A;  5CZD B;  1F80 D;  1EMV A;  1RO0 A;  2BUO A;  3CE7 A;  3EJB A;  3I55 P;  2AFD A;  1A8O A;  3GKL C;  2PEI A;  2PNG A;  5HGM A;  3CCV P;  2KOD A;  2L6E A;  2JYL A;  2PEQ A;  2MR8 A;  1IMQ A;  3LRY A;  3GZM A;  4PH0 A;  2ERH A;  1HQB A;  2JQ4 A;  3MGE A;  2Z44 A;  1QVG O;  2VSQ A;  2K0Y A;  3HYB A;  1T8K A;  1K9M Q;  1VQK P;  1BAJ A;  1M74 A;  1EIA A;  3DS4 A;  2FQ1 A;  1JJ2 O;  3LMO A;  3G26 A;  2LPK A;  3DS0 A;  1VQ5 P;  3CCJ P;  3E2D A;  3H0D A;  2FHS C;  4XRQ A;  2VLN A;  5BS1 A;  1VQL P;  2Z45 A;  3RG6 C;  2MD9 A;  2CQ8 A;  4MRT C;  5F2N A;  3NY7 B;  2KOP A;  2EHT A;  1YJN P;  2X2B A;  2GDW A;  2FQ2 A;  1M6E X;  1GPJ A;  3G71 P;  1YIT P;  3DS2 A;  2VLO A;  1VQ4 P;  4XFX A;  5JPA A;  3G1G A;  4GR2 A;  2OTJ P;  2GDX A;  1Z6M A;  4U0F A;  3VRL C;  3B4Q A;  1UJZ A;  2EG5 A;  1AF8 A;  2FVA A;  2L4B A;  4U0D A;  1VKU A;  4F37 A;  2MVU A;  2N98 A;  4R0M A;  1Q7Y Q;  2K93 A;  2M8N A;  4U0E A;  3CC2 P;  3CCE P;  2GYK A;  2WPT A;  4IPY A;  3RG2 A;  1KC8 Q;  4XFZ A;  1E6J P;  4PXH B;  3U43 A;  4IZ6 A;  4BPF A;  3WBH A;  2K92 A;  2FAE A;  2JB0 A;  2ONT A;  2Z46 A;  1Q86 Q;  2LIU A;  2KR5 A;  3P05 A;  1UNK A;  2KWL A;  2GZJ A;  4COC A;  4BPG A;  4U0A A;  2EIA A;  2JGP A;  2L22 A;  5HV8 A;  1ZMB A;  2LF4 A;  3DPH A;  2OTL P;  5BS2 A;  2CG5 B;  2JU2 A;  2XXM A;  4QKO A;  1VQ6 P;  4PH1 A;  5F2O A;  3DS3 A;  1VQN P;  4CA3 A;  1K73 Q;  2MF4 A;  2E1M A;  2MY5 A;  3CPW O;  2FQ0 A;  1KLP A;  2P9X A;  2K5X A;  3GJN A;  2GZI A;  3CMA P;  2LIW A;  3OW2 O;  2KG8 A;  1K8A Q;  2QEX P;  1VQO P;  3CCQ P;  2PEK A;  2LTE A;  1QVF O;  3G0V A;  2FVE A;  4HKG A;  2FVF A;  3NTE A;  5KP7 B;  1W2B O;  5EW5 E;  5KP8 B;  2KGD A;  3G6E P;  2K94 A;  2KW2 A;  3Q20 A;  4XRO A;  4WYM A;  2EFJ A;  5KP6 B;  2N5I A;  2KOQ A;  2KGC A;  5F2K A;  2CNR A;  2N5H A;  4QNB A;  1A43 A;  2DGY A;  2K0X A;  1IUQ A;  2M8P A;  3HZQ A;  5HGN A;  3CCM P;  1K30 A;  3EJD A;  2L0Q A;  2XZ0 D;  2QNW A;  2JAZ A;  1M90 Q;  3CCL P;  1RO2 A;  1GXH A;  2N6Z A;  3DTJ A;  2AVA A;  2LKI A;  3M1M A;  1E0H A;  2QA4 P;  1RNI A;  2JO0 A;  2JYG A;  2PEM A;  4H2Y C;  3CXC O;  1VHN A;  1AUM A;  5I4T G;  2KGE A;  2N50 A;  1QRJ A;  1MZ8 A;  4GR6 A;  2VLP A;  3CCU P;  2JU1 A;  5HGL A;  3CC4 P;  5DCK A;  4H2X C;  4COP A;  2K2Q A;  3CD6 P;  2GZG A;  3GZL A;  2GZE A;  2CGQ A;  3G4S P;  2KG9 A;  1VQ9 P;  3B5I A;  2LL8 A;  2ROQ A;  2BHV A;  2EHS A;  3CCS P;  1KQS O;  3G28 A;  3DS1 A;  4M0I A;  2KOR A;  1IMP A;  2FAC A;  1HY8 A;  3G1I A;  4PWV B;  5HVC A;  2VLQ A;  4DG9 A;  2KOO A;  2GDY A;  2LOL A;  2PEN A;  3CCR P;  2XZ1 C;  4UHP B;  4BPH A;  2PY8 A;  1CEI A;  3H4E A;  3DS5 A;  2NO8 A;  2FAD A;  1YJW P;  1YHQ P;  2XT1 A;  1NJI Q;  2PEO A;  7CEI A;  1N8R Q;  2OAR A;  2XV6 A;  1NQ4 A;  1FR2 A;  1M1K Q;  2L9F A;  2M5R A;  3CC7 P;  1VQM P;  1L0H A;  3I56 P;  1VQP P;  1S72 P;  2K0D X;  1VQ7 P;  2PEJ A;  1YJ9 P;  2KOS A;  4U0B A;  1D1D A;  1M6N A;  2N6Y A;  3G29 A;  1X3O A;  1VQ8 P;  2JBG A;  3G21 A;  4U0C A;  2MVV A;  1ZNV A;  2DNW A;  2M8L A;  1YI2 P;  2GZF A;  2KGA A;  1L0I A;  1ACP A;  3EJE A;  1BXI A;  1AYI A;  1DNY A;  2LML A;  1DV5 A; 
#chains in the Genus database with same CATH homology
 1VQ9 P;  3H47 A;  1Q82 Q;  1VQ4 P;  4XFX A;  5HGO A;  3G1G A;  5JPA A;  4GR2 A;  3B5I A;  3CMA P;  1Q81 Q;  2OTJ P;  2BHV A;  4U0F A;  3OW2 O;  1YIJ P;  2CWO A;  3VRL C;  2EG5 A;  1K8A Q;  3CME P;  2QEX P;  1EOQ A;  4XFY A;  3CCS P;  1KD1 Q;  1KQS O;  4U0D A;  1VQO P;  3G28 A;  3DS1 A;  1RO0 A;  3CCQ P;  2BUO A;  2PEK A;  4M0I A;  1QVF O;  3I55 P;  1A8O A;  3G0V A;  1Q7Y Q;  3G1I A;  2PEI A;  2M8N A;  3NTE A;  1W2B O;  4U0E A;  3CC2 P;  3CCE P;  5HGM A;  3CCV P;  2KOD A;  4IPY A;  3G6E P;  2L6E A;  3Q20 A;  2JYL A;  4XRO A;  2PEQ A;  2EFJ A;  4WYM A;  2PEN A;  1KC8 Q;  4XFZ A;  3CCR P;  1E6J P;  3LRY A;  4PH0 A;  5F2K A;  4QNB A;  1A43 A;  2DGY A;  2PY8 A;  1IUQ A;  3MGE A;  2Z44 A;  2M8P A;  3HZQ A;  5HGN A;  3CCM P;  3H4E A;  3WBH A;  1QVG O;  1K30 A;  3DS5 A;  2ONT A;  2Z46 A;  1Q86 Q;  1YJW P;  1YHQ P;  2XT1 A;  1NJI Q;  1M90 Q;  3CCL P;  3HYB A;  2PEO A;  3P05 A;  1RO2 A;  1N8R Q;  1K9M Q;  2OAR A;  1VQK P;  1BAJ A;  2XV6 A;  3DTJ A;  4COC A;  3M1M A;  4U0A A;  1M74 A;  2EIA A;  1M1K Q;  1EIA A;  3CC7 P;  3DS4 A;  1ZMB A;  2QA4 P;  1VQM P;  3I56 P;  2LF4 A;  3DPH A;  1VQP P;  1RNI A;  2JO0 A;  2JYG A;  2PEM A;  1S72 P;  1VQ7 P;  1JJ2 O;  2OTL P;  3G26 A;  2PEJ A;  3DS0 A;  1YJ9 P;  3CXC O;  5BS2 A;  1VQ5 P;  4U0B A;  3CCJ P;  3E2D A;  3H0D A;  4XRQ A;  1D1D A;  1M6N A;  1AUM A;  3G29 A;  5I4T G;  5BS1 A;  2XXM A;  1VQL P;  2Z45 A;  1VQ8 P;  3RG6 C;  1QRJ A;  3G21 A;  4U0C A;  1VQ6 P;  5F2N A;  4GR6 A;  4PH1 A;  5HGL A;  3CCU P;  3CC4 P;  5DCK A;  5F2O A;  2M8L A;  4COP A;  1YI2 P;  3DS3 A;  1YJN P;  1VQN P;  3CD6 P;  1K73 Q;  2E1M A;  3CPW O;  1M6E X;  3G4S P;  3G71 P;  1YIT P;  2P9X A;  3DS2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...