2PEOA

Crystal structure of rbcx from anabaena ca
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
115
structure length
113
Chain Sequence
MNLKQIAKDTAKTLQSYLTYQALRTVLAQLGETNPPLALWLHNFSAGQDGEKYIEELFLEKPDLALRIMTVREHIAEEIAEFLPEMVVTGIQQANMEKRRQHLERMTQVSLSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords RbcX protein
publication title Structure and Function of RbcX, an Assembly Chaperone for Hexadecameric Rubisco.
pubmed doi rcsb
source organism Anabaena sp.
total genus 49
structure length 113
sequence length 115
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02341 RcbX RbcX protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.210 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2peoA00
5BS2A 2PEJA 3Q20A 4GR6A 4GR2A 2PEKA 2PEIA 3HYBA 2PENA 3RG6C 2PY8A 2PEQA 2Z45A 5BS1A 2PEOA 2PEMA 2Z44A 2Z46A
chains in the Genus database with same CATH superfamily
3G1IA 5F2KA 3G28A 2EIAA 2L0QA 2KORA 1Q82Q 3GZMA 2XT1A 5HGOA 1VQNP 3G26A 2LOLA 2KOSA 4XFZA 1K8AQ 2ROQA 2LTEA 2VLQA 3U43A 2FHSC 1X3OA 2EFJA 1EMVA 2JO0A 4R0MA 1A8OA 2LIWA 3GKLC 5DCKA 3GZLA 5HGLA 1S72P 1DV5A 2PEQA 1AUMA 4BPFA 1RNIA 4U0AA 1MZ8A 1HQBA 3CPWO 2KODA 4HKGA 1KC8Q 2FVEA 4U0EA 2JBGA 1VQ9P 4PH1A 3CD6P 4COCA 3E2DA 1VQ7P 2JQ4A 3DS0A 2OTJP 2VSQA 1F80D 1UNKA 3EJDA 2L6EA 2QEXP 2VLNA 2MF4A 1EIAA 1JJ2O 2XZ0D 2GDWA 1VQPP 1VQ6P 5I4TG 2K93A 3Q20A 2AF8A 2PENA 2VLPA 1AYIA 4XFXA 2K0DX 4PH0A 3MGEA 2M5RA 4M0IA 2PEOA 2PEMA 1VQ4P 4COPA 2K0YA 2GDYA 1OR5A 2MVUA 1RO0A 2AVAA 1Q81Q 3OW2O 2CG5B 3H0DA 1ZMBA 2M8PA 1QVFO 2L9FA 1AF8A 2WPTA 4XROA 2XXMA 1VQOP 1EOQA 1YJNP 2ONTA 5F2NA 2VLOA 1Q86Q 3RG2A 3NTEA 2FAEA 4DG9A 2JYGA 3G4SP 4BPHA 2GYKA 1ZNVA 3G6EP 3CCJP 2P9XA 2OARA 1L0HA 1YHQP 1IMQA 1D1DA 4QKOA 3M1MA 3EJBA 3CCLP 2KOPA 3CCQP 1YIJP 2PEKA 4U0BA 3RG6C 1BXIA 2KOOA 3HZQA 2KG9A 4CA3A 3LMOA 5EJDA 2KG6A 3DS5A 2MD9A 2MVVA 2FVFA 2N6YA 1FR2A 2LPKA 2PEJA 1K9MQ 2DGYA 1NQ4A 1KD1Q 2LIUA 4PXHB 5KP8B 2EHSA 2NO8A 1UJZA 2Z44A 2CNRA 2PY8A 3CCSP 2AFEA 2FQ2A 2EG5A 4H2WC 2JAZA 3H4EA 3H47A 2FACA 3CCEP 3G1GA 2K92A 3G71P 2GZEA 1K30A 3DS4A 3WBHA 1W2BO 1VQLP 3CMEP 3LRYA 3CC4P 3DPHA 1YJWP 1RO2A 3CCMP 2KGCA 1VQKP 4NEOA 2FQ1A 2GZIA 2PEIA 2LKIA 2N98A 2LL8A 3B4QA 2GZGA 2N5IA 1L0IA 5HGNA 2K94A 2JU2A 1M6NA 3CMAP 5EW5E 2KG8A 5JPAA 2EHTA 3HYBA 2JYLA 2M8NA 1Z6MA 1M1KQ 2QA4P 5BS2A 1BAJA 2N50A 1GXGA 3P05A 2Z45A 4XRQA 3CE7A 1VQ8P 4H2XC 1CEIA 2JU1A 3DS2A 1YJ9P 2KR5A 3G0VA 2X2BA 1VHNA 3I55P 2N6ZA 2K0XA 1M6EX 5HVCA 2LMLA 2MR8A 3G21A 3CCRP 1T8KA 3DS3A 2GZJA 2OTLP 4F37A 4MRTC 1NJIQ 1HY8A 3B5IA 4IZ6A 3CCVP 2ERHA 2CWOA 1ACPA 3EJEA 1E0HA 2BHVA 5BS1A 1KQSO 4BPGA 2KW2A 1E6JP 5KP6B 1QVGO 7CEIA 2AFDA 2KOQA 2MY5A 2GDXA 4IPYA 2K2QA 1Q7YQ 4UHPB 2LF4A 2FADA 1K73Q 1A43A 2QNWA 5HV8A 2K5XA 2KWLA 1M90Q 1DNYA 4U0CA 2KGAA 1GPJA 3CCUP 2PNGA 2GZFA 4XFYA 4H2YC 2BUOA 3GJNA 3DTJA 2XV6A 1VKUA 3CC7P 2FQ0A 2KGDA 1M74A 2E1MA 4PWVB 2XZ1C 3G29A 2JGPA 1GXHA 2KGEA 1QRJA 5HGMA 2Z46A 2N5HA 3NY7B 2CGQA 2FVAA 1YI2P 2L4BA 3CXCO 2JB0A 2M8LA 2MR7A 4GR2A 5KP7B 1N8RQ 1VQMP 4U0DA 1KLPA 1VQ5P 2DNWA 3CC2P 4WYMA 5F2OA 3VRLC 3DS1A 2L22A 3I56P 5CZDB 4GR6A 1YITP 1IUQA 4QNBA 4U0FA 1IMPA 2CQ8A
chains in the Genus database with same CATH topology
3B5IA 3G1GA 1RO0A 3G71P 3CCVP 1Q81Q 3G1IA 2CWOA 3OW2O 1K30A 3DS4A 3WBHA 3H0DA 1ZMBA 5F2KA 1W2BO 3G28A 2M8PA 1VQLP 1QVFO 3CMEP 3LRYA 3CC4P 2EIAA 3DPHA 1YJWP 1RO2A 3CCMP 1Q82Q 1VQKP 2BHVA 4XROA 2XT1A 5BS1A 2XXMA 5HGOA 1VQNP 1VQOP 1KQSO 1EOQA 3G26A 1YJNP 2ONTA 5F2NA 4XFZA 2PEIA 1Q86Q 1K8AQ 1E6JP 1QVGO 4IPYA 3NTEA 2EFJA 2JO0A 1Q7YQ 2LF4A 2JYGA 3G4SP 1K73Q 1A8OA 5HGNA 1A43A 1M6NA 5DCKA 3CMAP 1M90Q 5HGLA 4U0CA 3G6EP 3CCJP 5JPAA 1S72P 3CCUP 2P9XA 2PEQA 1AUMA 2OARA 1YHQP 1RNIA 3HYBA 2JYLA 4U0AA 3CPWO 1D1DA 2KODA 2M8NA 3M1MA 1KC8Q 1M1KQ 4XFYA 4U0EA 3CCLP 2BUOA 2QA4P 3DTJA 5BS2A 1BAJA 2XV6A 1VQ9P 4PH1A 3CCQP 3CD6P 4COCA 2PEKA 3E2DA 3P05A 4U0BA 3RG6C 1YIJP 3CC7P 2Z45A 1VQ7P 4XRQA 3HZQA 2OTJP 3DS0A 1M74A 2E1MA 3G29A 1QRJA 5HGMA 1VQ8P 2Z46A 3DS5A 3DS2A 1YJ9P 1YI2P 2L6EA 2QEXP 3CXCO 2M8LA 1EIAA 3G0VA 1JJ2O 3I55P 1VQPP 1VQ6P 5I4TG 2PEJA 3Q20A 1M6EX 4GR2A 1K9MQ 2PENA 2DGYA 3G21A 3CCRP 1N8RQ 1VQMP 4U0DA 4XFXA 1KD1Q 4PH0A 3MGEA 3DS3A 1VQ5P 2Z44A 3CC2P 2PY8A 4WYMA 5F2OA 3CCSP 3VRLC 3DS1A 4M0IA 2PEOA 2PEMA 1VQ4P 4COPA 2EG5A 2OTLP 3I56P 3H4EA 3H47A 4GR6A 1IUQA 4QNBA 4U0FA 1YITP 1NJIQ 3CCEP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BS2 A;  2PEJ A;  3Q20 A;  4GR6 A;  4GR2 A;  2PEK A;  2PEI A;  3HYB A;  2PEN A;  3RG6 C;  2PY8 A;  2PEQ A;  2Z45 A;  5BS1 A;  2PEO A;  2PEM A;  2Z44 A;  2Z46 A; 
#chains in the Genus database with same CATH topology
 3G1I A;  5F2K A;  3G28 A;  2EIA A;  2L0Q A;  2KOR A;  1Q82 Q;  3GZM A;  2XT1 A;  5HGO A;  1VQN P;  3G26 A;  2LOL A;  2KOS A;  4XFZ A;  1K8A Q;  2ROQ A;  2LTE A;  2VLQ A;  3U43 A;  2FHS C;  1X3O A;  2EFJ A;  1EMV A;  2JO0 A;  4R0M A;  1A8O A;  2LIW A;  3GKL C;  5DCK A;  3GZL A;  5HGL A;  1S72 P;  1DV5 A;  2PEQ A;  1AUM A;  4BPF A;  1RNI A;  4U0A A;  1MZ8 A;  1HQB A;  3CPW O;  2KOD A;  4HKG A;  1KC8 Q;  2FVE A;  4U0E A;  2JBG A;  1VQ9 P;  4PH1 A;  3CD6 P;  4COC A;  3E2D A;  1VQ7 P;  2JQ4 A;  3DS0 A;  2OTJ P;  2VSQ A;  1F80 D;  1UNK A;  3EJD A;  2L6E A;  2QEX P;  2VLN A;  2MF4 A;  1EIA A;  1JJ2 O;  2XZ0 D;  2GDW A;  1VQP P;  1VQ6 P;  5I4T G;  2K93 A;  3Q20 A;  2AF8 A;  2PEN A;  2VLP A;  1AYI A;  4XFX A;  2K0D X;  4PH0 A;  3MGE A;  2M5R A;  4M0I A;  2PEO A;  2PEM A;  1VQ4 P;  4COP A;  2K0Y A;  2GDY A;  1OR5 A;  2MVU A;  1RO0 A;  2AVA A;  1Q81 Q;  3OW2 O;  2CG5 B;  3H0D A;  1ZMB A;  2M8P A;  1QVF O;  2L9F A;  1AF8 A;  2WPT A;  4XRO A;  2XXM A;  1VQO P;  1EOQ A;  1YJN P;  2ONT A;  5F2N A;  2VLO A;  1Q86 Q;  3RG2 A;  3NTE A;  2FAE A;  4DG9 A;  2JYG A;  3G4S P;  4BPH A;  2GYK A;  1ZNV A;  3G6E P;  3CCJ P;  2P9X A;  2OAR A;  1L0H A;  1YHQ P;  1IMQ A;  1D1D A;  4QKO A;  3M1M A;  3EJB A;  3CCL P;  2KOP A;  3CCQ P;  1YIJ P;  2PEK A;  4U0B A;  3RG6 C;  1BXI A;  2KOO A;  3HZQ A;  2KG9 A;  4CA3 A;  3LMO A;  5EJD A;  2KG6 A;  3DS5 A;  2MD9 A;  2MVV A;  2FVF A;  2N6Y A;  1FR2 A;  2LPK A;  2PEJ A;  1K9M Q;  2DGY A;  1NQ4 A;  1KD1 Q;  2LIU A;  4PXH B;  5KP8 B;  2EHS A;  2NO8 A;  1UJZ A;  2Z44 A;  2CNR A;  2PY8 A;  3CCS P;  2AFE A;  2FQ2 A;  2EG5 A;  4H2W C;  2JAZ A;  3H4E A;  3H47 A;  2FAC A;  3CCE P;  3G1G A;  2K92 A;  3G71 P;  2GZE A;  1K30 A;  3DS4 A;  3WBH A;  1W2B O;  1VQL P;  3CME P;  3LRY A;  3CC4 P;  3DPH A;  1YJW P;  1RO2 A;  3CCM P;  2KGC A;  1VQK P;  4NEO A;  2FQ1 A;  2GZI A;  2PEI A;  2LKI A;  2N98 A;  2LL8 A;  3B4Q A;  2GZG A;  2N5I A;  1L0I A;  5HGN A;  2K94 A;  2JU2 A;  1M6N A;  3CMA P;  5EW5 E;  2KG8 A;  5JPA A;  2EHT A;  3HYB A;  2JYL A;  2M8N A;  1Z6M A;  1M1K Q;  2QA4 P;  5BS2 A;  1BAJ A;  2N50 A;  1GXG A;  3P05 A;  2Z45 A;  4XRQ A;  3CE7 A;  1VQ8 P;  4H2X C;  1CEI A;  2JU1 A;  3DS2 A;  1YJ9 P;  2KR5 A;  3G0V A;  2X2B A;  1VHN A;  3I55 P;  2N6Z A;  2K0X A;  1M6E X;  5HVC A;  2LML A;  2MR8 A;  3G21 A;  3CCR P;  1T8K A;  3DS3 A;  2GZJ A;  2OTL P;  4F37 A;  4MRT C;  1NJI Q;  1HY8 A;  3B5I A;  4IZ6 A;  3CCV P;  2ERH A;  2CWO A;  1ACP A;  3EJE A;  1E0H A;  2BHV A;  5BS1 A;  1KQS O;  4BPG A;  2KW2 A;  1E6J P;  5KP6 B;  1QVG O;  7CEI A;  2AFD A;  2KOQ A;  2MY5 A;  2GDX A;  4IPY A;  2K2Q A;  1Q7Y Q;  4UHP B;  2LF4 A;  2FAD A;  1K73 Q;  1A43 A;  2QNW A;  5HV8 A;  2K5X A;  2KWL A;  1M90 Q;  1DNY A;  4U0C A;  2KGA A;  1GPJ A;  3CCU P;  2PNG A;  2GZF A;  4XFY A;  4H2Y C;  2BUO A;  3GJN A;  3DTJ A;  2XV6 A;  1VKU A;  3CC7 P;  2FQ0 A;  2KGD A;  1M74 A;  2E1M A;  4PWV B;  2XZ1 C;  3G29 A;  2JGP A;  1GXH A;  2KGE A;  1QRJ A;  5HGM A;  2Z46 A;  2N5H A;  3NY7 B;  2CGQ A;  2FVA A;  1YI2 P;  2L4B A;  3CXC O;  2JB0 A;  2M8L A;  2MR7 A;  4GR2 A;  5KP7 B;  1N8R Q;  1VQM P;  4U0D A;  1KLP A;  1VQ5 P;  2DNW A;  3CC2 P;  4WYM A;  5F2O A;  3VRL C;  3DS1 A;  2L22 A;  3I56 P;  5CZD B;  4GR6 A;  1YIT P;  1IUQ A;  4QNB A;  4U0F A;  1IMP A;  2CQ8 A; 
#chains in the Genus database with same CATH homology
 3B5I A;  3G1G A;  1RO0 A;  3G71 P;  3CCV P;  1Q81 Q;  3G1I A;  2CWO A;  3OW2 O;  1K30 A;  3DS4 A;  3WBH A;  3H0D A;  1ZMB A;  5F2K A;  1W2B O;  3G28 A;  2M8P A;  1VQL P;  1QVF O;  3CME P;  3LRY A;  3CC4 P;  2EIA A;  3DPH A;  1YJW P;  1RO2 A;  3CCM P;  1Q82 Q;  1VQK P;  2BHV A;  4XRO A;  2XT1 A;  5BS1 A;  2XXM A;  5HGO A;  1VQN P;  1VQO P;  1KQS O;  1EOQ A;  3G26 A;  1YJN P;  2ONT A;  5F2N A;  4XFZ A;  2PEI A;  1Q86 Q;  1K8A Q;  1E6J P;  1QVG O;  4IPY A;  3NTE A;  2EFJ A;  2JO0 A;  1Q7Y Q;  2LF4 A;  2JYG A;  3G4S P;  1K73 Q;  1A8O A;  5HGN A;  1A43 A;  1M6N A;  5DCK A;  3CMA P;  1M90 Q;  5HGL A;  4U0C A;  3G6E P;  3CCJ P;  5JPA A;  1S72 P;  3CCU P;  2P9X A;  2PEQ A;  1AUM A;  2OAR A;  1YHQ P;  1RNI A;  3HYB A;  2JYL A;  4U0A A;  3CPW O;  1D1D A;  2KOD A;  2M8N A;  3M1M A;  1KC8 Q;  1M1K Q;  4XFY A;  4U0E A;  3CCL P;  2BUO A;  2QA4 P;  3DTJ A;  5BS2 A;  1BAJ A;  2XV6 A;  1VQ9 P;  4PH1 A;  3CCQ P;  3CD6 P;  4COC A;  2PEK A;  3E2D A;  3P05 A;  4U0B A;  3RG6 C;  1YIJ P;  3CC7 P;  2Z45 A;  1VQ7 P;  4XRQ A;  3HZQ A;  2OTJ P;  3DS0 A;  1M74 A;  2E1M A;  3G29 A;  1QRJ A;  5HGM A;  1VQ8 P;  2Z46 A;  3DS5 A;  3DS2 A;  1YJ9 P;  1YI2 P;  2L6E A;  2QEX P;  3CXC O;  2M8L A;  1EIA A;  3G0V A;  1JJ2 O;  3I55 P;  1VQP P;  1VQ6 P;  5I4T G;  2PEJ A;  3Q20 A;  1M6E X;  4GR2 A;  1K9M Q;  2PEN A;  2DGY A;  3G21 A;  3CCR P;  1N8R Q;  1VQM P;  4U0D A;  4XFX A;  1KD1 Q;  4PH0 A;  3MGE A;  3DS3 A;  1VQ5 P;  2Z44 A;  3CC2 P;  2PY8 A;  4WYM A;  5F2O A;  3CCS P;  3VRL C;  3DS1 A;  4M0I A;  2PEO A;  2PEM A;  1VQ4 P;  4COP A;  2EG5 A;  2OTL P;  3I56 P;  3H4E A;  3H47 A;  4GR6 A;  1IUQ A;  4QNB A;  4U0F A;  1YIT P;  1NJI Q;  3CCE P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...