2PEOA

Crystal structure of rbcx from anabaena ca
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
115
structure length
113
Chain Sequence
MNLKQIAKDTAKTLQSYLTYQALRTVLAQLGETNPPLALWLHNFSAGQDGEKYIEELFLEKPDLALRIMTVREHIAEEIAEFLPEMVVTGIQQANMEKRRQHLERMTQVSLSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RbcX protein
publication title Structure and Function of RbcX, an Assembly Chaperone for Hexadecameric Rubisco.
pubmed doi rcsb
source organism Anabaena sp.
molecule tags Chaperone
total genus 49
structure length 113
sequence length 115
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02341 RcbX RbcX protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.210 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2peoA00
2PEJA 2PEIA 2PENA 2PEQA 2PEKA 2Z45A 3Q20A 5BS1A 2PY8A 5BS2A 2PEOA 2Z46A 2Z44A 3HYBA 4GR2A 3RG6C 4GR6A 2PEMA
chains in the Genus database with same CATH superfamily
4NEOA 4U0BA 2N6ZA 7CEIA 2JU2A 2NO8A 3P05A 2L9FA 2PEIA 2PEQA 3H4EA 2M8NA 2AVAA 3CCQP 2E1MA 3GZMA 3WBHA 2QNWA 2M5RA 3G21A 3DS5A 1YJWP 1Q81Q 1HY8A 2GZJA 4COCA 3G0VA 2BUOA 2K94A 2DNWA 2Z45A 2FQ0A 2FACA 5KP8B 1K9MQ 4IZ6A 3CCEP 2M8LA 2JYGA 1YI2P 2KWLA 2MVVA 2K0DX 1EIAA 3G6EP 3CCLP 2EIAA 2KGEA 4GR2A 1VQ8P 2KGDA 2GZEA 2M8PA 4F37A 4UHPB 2PEMA 2VLOA 3E2DA 1RO0A 2GDXA 3U43A 2ONTA 2XT1A 5EW5E 4PXHB 2L4BA 1FR2A 4H2YC 1VHNA 1BXIA 1EOQA 3CPWO 1KD1Q 1VQ9P 2JYLA 2GYKA 1OR5A 5F2KA 5BS2A 2Z44A 2LOLA 1RO2A 2KG6A 2FQ1A 4XROA 1E0HA 2CG5B 5KP7B 5HGLA 1VQ4P 3CCSP 1KQSO 3EJEA 4QNBA 1YIJP 4QKOA 2KOQA 1HQBA 2OTJP 3RG2A 3DTJA 1RNIA 2PEKA 1QVFO 1ZNVA 2GDYA 2K5XA 2MR8A 1IMPA 1QRJA 3M1MA 4BPFA 1YJNP 4COPA 1M6NA 5F2OA 5BS1A 2AFEA 2PEOA 2FVAA 1Q86Q 2ERHA 3CE7A 3CXCO 1GPJA 2OTLP 2MVUA 2PEJA 4PH0A 3CCUP 3G29A 3CCJP 3DS2A 1A43A 4MRTC 2LKIA 4U0EA 1IUQA 4XFXA 4HKGA 1JJ2O 2LMLA 2JB0A 4XFZA 3GKLC 3DPHA 4U0AA 2AF8A 3OW2O 2N5HA 3EJBA 4U0FA 2LTEA 2FVEA 3RG6C 2VSQA 2EG5A 2KOSA 3EJDA 3VRLC 1NQ4A 2JBGA 2VLQA 2DGYA 2LF4A 5CZDB 2KR5A 3Q20A 3MGEA 2PY8A 1UJZA 1AYIA 2XZ0D 2MY5A 2FHSC 3CCMP 2FVFA 5HGOA 3CD6P 3DS1A 1MZ8A 2MF4A 1VQMP 5I4TG 3G4SP 4WYMA 1VQ5P 3I56P 3DS3A 1M1KQ 3I55P 1VKUA 2K0YA 2PENA 1Q82Q 3LRYA 2VLPA 1KLPA 3GJNA 2N5IA 2N98A 2KGAA 1QVGO 1GXHA 3G1GA 2N50A 4R0MA 1VQOP 2X2BA 2CWOA 2LIUA 1VQKP 1L0HA 3CCVP 3H0DA 1VQPP 5HGNA 4H2WC 2QEXP 2XV6A 4XRQA 3DS4A 2P9XA 2GZFA 2L0QA 1YITP 2LL8A 2CNRA 1M90Q 1BAJA 2WPTA 2QA4P 5HVCA 1GXGA 3CMAP 2GZIA 2ROQA 3B5IA 1ZMBA 4XFYA 1VQLP 3CMEP 1VQ7P 2GZGA 2K93A 5HGMA 2KOOA 2K2QA 1IMQA 4U0CA 2EHTA 5EJDA 1KC8Q 2AFDA 3CC2P 1X3OA 2KGCA 1AF8A 2KODA 5DCKA 1M74A 2CQ8A 2EFJA 1T8KA 2K92A 2XXMA 5HV8A 1K8AQ 2Z46A 3HYBA 4M0IA 4BPGA 2FQ2A 4PH1A 2LIWA 1UNKA 4BPHA 3CC7P 2PNGA 3GZLA 1NJIQ 1A8OA 1Z6MA 1AUMA 2KW2A 3CCRP 3NY7B 4PWVB 2N6YA 2LPKA 1DV5A 2EHSA 3G71P 2OARA 1YHQP 3G26A 1S72P 5JPAA 2KG8A 3HZQA 2JAZA 1Q7YQ 2K0XA 2L22A 2GDWA 2JGPA 1VQ6P 3H47A 1ACPA 2FADA 2BHVA 4DG9A 1VQNP 4IPYA 1F80D 1CEIA 1YJ9P 1W2BO 4H2XC 2VLNA 2XZ1C 3DS0A 4U0DA 2KG9A 1K30A 2JO0A 3G28A 3LMOA 1L0IA 2MR7A 3B4QA 2CGQA 1EMVA 3G1IA 4CA3A 1K73Q 2JQ4A 1N8RQ 1DNYA 1D1DA 4GR6A 3NTEA 2FAEA 1M6EX 5F2NA 2L6EA 3CC4P 2MD9A 1E6JP 2KORA 5KP6B 2KOPA 2JU1A
chains in the Genus database with same CATH topology
4U0BA 5F2KA 3Q20A 3MGEA 2PY8A 5BS2A 2Z44A 1K8AQ 1RO2A 3CCMP 5HGOA 4XROA 2Z46A 3HYBA 3P05A 3CD6P 4M0IA 3DS1A 2PEIA 2PEQA 5HGLA 1VQ4P 3CCSP 3H4EA 2M8NA 3CCQP 1VQMP 2E1MA 4PH1A 5I4TG 3G4SP 4WYMA 1KQSO 3WBHA 3CC7P 3G21A 4QNBA 3DS5A 1NJIQ 1VQ5P 1YJWP 1A8OA 3I56P 1YIJP 1Q81Q 3DS3A 1M1KQ 1AUMA 3I55P 4COCA 3CCRP 3G0VA 2OTJP 3DTJA 1RNIA 2BUOA 2PENA 2PEKA 1Q82Q 2Z45A 1QVFO 3LRYA 1K9MQ 3G71P 2OARA 1YHQP 1QRJA 3M1MA 3G26A 1S72P 5JPAA 1YJNP 4COPA 1M6NA 3HZQA 3CCEP 5F2OA 2M8LA 1Q7YQ 5BS1A 2PEOA 2JYGA 1QVGO 1Q86Q 1YI2P 3G1GA 1VQ6P 3CXCO 3H47A 1EIAA 3G6EP 3CCLP 2OTLP 1VQOP 2BHVA 2PEJA 2CWOA 1VQKP 2EIAA 3CCVP 1VQNP 3H0DA 4IPYA 1VQPP 4GR2A 4PH0A 3CCUP 3G29A 3CCJP 3DS2A 1YJ9P 1W2BO 5HGNA 1A43A 1VQ8P 2QEXP 2XV6A 4XRQA 2M8PA 4U0EA 1IUQA 3DS4A 4XFXA 2P9XA 1JJ2O 3DS0A 4U0DA 2PEMA 1YITP 1K30A 2JO0A 4XFZA 3G28A 1M90Q 3E2DA 1BAJA 1RO0A 3DPHA 2QA4P 2ONTA 4U0AA 2XT1A 3G1IA 3OW2O 3CMAP 3B5IA 4U0FA 1ZMBA 4XFYA 1VQLP 3CMEP 1VQ7P 1K73Q 5HGMA 3RG6C 1N8RQ 1D1DA 4GR6A 3NTEA 4U0CA 1M6EX 1KC8Q 2EG5A 3CC2P 5F2NA 2L6EA 3VRLC 3CC4P 2KODA 1EOQA 5DCKA 3CPWO 1E6JP 1M74A 1KD1Q 1VQ9P 2DGYA 2LF4A 2JYLA 2EFJA 2XXMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PEJ A;  2PEI A;  2PEN A;  2PEQ A;  2PEK A;  2Z45 A;  3Q20 A;  5BS1 A;  2PY8 A;  5BS2 A;  2PEO A;  2Z46 A;  2Z44 A;  3HYB A;  4GR2 A;  3RG6 C;  4GR6 A;  2PEM A; 
#chains in the Genus database with same CATH topology
 4NEO A;  4U0B A;  2N6Z A;  7CEI A;  2JU2 A;  2NO8 A;  3P05 A;  2L9F A;  2PEI A;  2PEQ A;  3H4E A;  2M8N A;  2AVA A;  3CCQ P;  2E1M A;  3GZM A;  3WBH A;  2QNW A;  2M5R A;  3G21 A;  3DS5 A;  1YJW P;  1Q81 Q;  1HY8 A;  2GZJ A;  4COC A;  3G0V A;  2BUO A;  2K94 A;  2DNW A;  2Z45 A;  2FQ0 A;  2FAC A;  5KP8 B;  1K9M Q;  4IZ6 A;  3CCE P;  2M8L A;  2JYG A;  1YI2 P;  2KWL A;  2MVV A;  2K0D X;  1EIA A;  3G6E P;  3CCL P;  2EIA A;  2KGE A;  4GR2 A;  1VQ8 P;  2KGD A;  2GZE A;  2M8P A;  4F37 A;  4UHP B;  2PEM A;  2VLO A;  3E2D A;  1RO0 A;  2GDX A;  3U43 A;  2ONT A;  2XT1 A;  5EW5 E;  4PXH B;  2L4B A;  1FR2 A;  4H2Y C;  1VHN A;  1BXI A;  1EOQ A;  3CPW O;  1KD1 Q;  1VQ9 P;  2JYL A;  2GYK A;  1OR5 A;  5F2K A;  5BS2 A;  2Z44 A;  2LOL A;  1RO2 A;  2KG6 A;  2FQ1 A;  4XRO A;  1E0H A;  2CG5 B;  5KP7 B;  5HGL A;  1VQ4 P;  3CCS P;  1KQS O;  3EJE A;  4QNB A;  1YIJ P;  4QKO A;  2KOQ A;  1HQB A;  2OTJ P;  3RG2 A;  3DTJ A;  1RNI A;  2PEK A;  1QVF O;  1ZNV A;  2GDY A;  2K5X A;  2MR8 A;  1IMP A;  1QRJ A;  3M1M A;  4BPF A;  1YJN P;  4COP A;  1M6N A;  5F2O A;  5BS1 A;  2AFE A;  2PEO A;  2FVA A;  1Q86 Q;  2ERH A;  3CE7 A;  3CXC O;  1GPJ A;  2OTL P;  2MVU A;  2PEJ A;  4PH0 A;  3CCU P;  3G29 A;  3CCJ P;  3DS2 A;  1A43 A;  4MRT C;  2LKI A;  4U0E A;  1IUQ A;  4XFX A;  4HKG A;  1JJ2 O;  2LML A;  2JB0 A;  4XFZ A;  3GKL C;  3DPH A;  4U0A A;  2AF8 A;  3OW2 O;  2N5H A;  3EJB A;  4U0F A;  2LTE A;  2FVE A;  3RG6 C;  2VSQ A;  2EG5 A;  2KOS A;  3EJD A;  3VRL C;  1NQ4 A;  2JBG A;  2VLQ A;  2DGY A;  2LF4 A;  5CZD B;  2KR5 A;  3Q20 A;  3MGE A;  2PY8 A;  1UJZ A;  1AYI A;  2XZ0 D;  2MY5 A;  2FHS C;  3CCM P;  2FVF A;  5HGO A;  3CD6 P;  3DS1 A;  1MZ8 A;  2MF4 A;  1VQM P;  5I4T G;  3G4S P;  4WYM A;  1VQ5 P;  3I56 P;  3DS3 A;  1M1K Q;  3I55 P;  1VKU A;  2K0Y A;  2PEN A;  1Q82 Q;  3LRY A;  2VLP A;  1KLP A;  3GJN A;  2N5I A;  2N98 A;  2KGA A;  1QVG O;  1GXH A;  3G1G A;  2N50 A;  4R0M A;  1VQO P;  2X2B A;  2CWO A;  2LIU A;  1VQK P;  1L0H A;  3CCV P;  3H0D A;  1VQP P;  5HGN A;  4H2W C;  2QEX P;  2XV6 A;  4XRQ A;  3DS4 A;  2P9X A;  2GZF A;  2L0Q A;  1YIT P;  2LL8 A;  2CNR A;  1M90 Q;  1BAJ A;  2WPT A;  2QA4 P;  5HVC A;  1GXG A;  3CMA P;  2GZI A;  2ROQ A;  3B5I A;  1ZMB A;  4XFY A;  1VQL P;  3CME P;  1VQ7 P;  2GZG A;  2K93 A;  5HGM A;  2KOO A;  2K2Q A;  1IMQ A;  4U0C A;  2EHT A;  5EJD A;  1KC8 Q;  2AFD A;  3CC2 P;  1X3O A;  2KGC A;  1AF8 A;  2KOD A;  5DCK A;  1M74 A;  2CQ8 A;  2EFJ A;  1T8K A;  2K92 A;  2XXM A;  5HV8 A;  1K8A Q;  2Z46 A;  3HYB A;  4M0I A;  4BPG A;  2FQ2 A;  4PH1 A;  2LIW A;  1UNK A;  4BPH A;  3CC7 P;  2PNG A;  3GZL A;  1NJI Q;  1A8O A;  1Z6M A;  1AUM A;  2KW2 A;  3CCR P;  3NY7 B;  4PWV B;  2N6Y A;  2LPK A;  1DV5 A;  2EHS A;  3G71 P;  2OAR A;  1YHQ P;  3G26 A;  1S72 P;  5JPA A;  2KG8 A;  3HZQ A;  2JAZ A;  1Q7Y Q;  2K0X A;  2L22 A;  2GDW A;  2JGP A;  1VQ6 P;  3H47 A;  1ACP A;  2FAD A;  2BHV A;  4DG9 A;  1VQN P;  4IPY A;  1F80 D;  1CEI A;  1YJ9 P;  1W2B O;  4H2X C;  2VLN A;  2XZ1 C;  3DS0 A;  4U0D A;  2KG9 A;  1K30 A;  2JO0 A;  3G28 A;  3LMO A;  1L0I A;  2MR7 A;  3B4Q A;  2CGQ A;  1EMV A;  3G1I A;  4CA3 A;  1K73 Q;  2JQ4 A;  1N8R Q;  1DNY A;  1D1D A;  4GR6 A;  3NTE A;  2FAE A;  1M6E X;  5F2N A;  2L6E A;  3CC4 P;  2MD9 A;  1E6J P;  2KOR A;  5KP6 B;  2KOP A;  2JU1 A; 
#chains in the Genus database with same CATH homology
 4U0B A;  5F2K A;  3Q20 A;  3MGE A;  2PY8 A;  5BS2 A;  2Z44 A;  1K8A Q;  1RO2 A;  3CCM P;  5HGO A;  4XRO A;  2Z46 A;  3HYB A;  3P05 A;  3CD6 P;  4M0I A;  3DS1 A;  2PEI A;  2PEQ A;  5HGL A;  1VQ4 P;  3CCS P;  3H4E A;  2M8N A;  3CCQ P;  1VQM P;  2E1M A;  4PH1 A;  5I4T G;  3G4S P;  4WYM A;  1KQS O;  3WBH A;  3CC7 P;  3G21 A;  4QNB A;  3DS5 A;  1NJI Q;  1VQ5 P;  1YJW P;  1A8O A;  3I56 P;  1YIJ P;  1Q81 Q;  3DS3 A;  1M1K Q;  1AUM A;  3I55 P;  4COC A;  3CCR P;  3G0V A;  2OTJ P;  3DTJ A;  1RNI A;  2BUO A;  2PEN A;  2PEK A;  1Q82 Q;  2Z45 A;  1QVF O;  3LRY A;  1K9M Q;  3G71 P;  2OAR A;  1YHQ P;  1QRJ A;  3M1M A;  3G26 A;  1S72 P;  5JPA A;  1YJN P;  4COP A;  1M6N A;  3HZQ A;  3CCE P;  5F2O A;  2M8L A;  1Q7Y Q;  5BS1 A;  2PEO A;  2JYG A;  1QVG O;  1Q86 Q;  1YI2 P;  3G1G A;  1VQ6 P;  3CXC O;  3H47 A;  1EIA A;  3G6E P;  3CCL P;  2OTL P;  1VQO P;  2BHV A;  2PEJ A;  2CWO A;  1VQK P;  2EIA A;  3CCV P;  1VQN P;  3H0D A;  4IPY A;  1VQP P;  4GR2 A;  4PH0 A;  3CCU P;  3G29 A;  3CCJ P;  3DS2 A;  1YJ9 P;  1W2B O;  5HGN A;  1A43 A;  1VQ8 P;  2QEX P;  2XV6 A;  4XRQ A;  2M8P A;  4U0E A;  1IUQ A;  3DS4 A;  4XFX A;  2P9X A;  1JJ2 O;  3DS0 A;  4U0D A;  2PEM A;  1YIT P;  1K30 A;  2JO0 A;  4XFZ A;  3G28 A;  1M90 Q;  3E2D A;  1BAJ A;  1RO0 A;  3DPH A;  2QA4 P;  2ONT A;  4U0A A;  2XT1 A;  3G1I A;  3OW2 O;  3CMA P;  3B5I A;  4U0F A;  1ZMB A;  4XFY A;  1VQL P;  3CME P;  1VQ7 P;  1K73 Q;  5HGM A;  3RG6 C;  1N8R Q;  1D1D A;  4GR6 A;  3NTE A;  4U0C A;  1M6E X;  1KC8 Q;  2EG5 A;  3CC2 P;  5F2N A;  2L6E A;  3VRL C;  3CC4 P;  2KOD A;  1EOQ A;  5DCK A;  3CPW O;  1E6J P;  1M74 A;  1KD1 Q;  1VQ9 P;  2DGY A;  2LF4 A;  2JYL A;  2EFJ A;  2XXM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...