3CMAP

The structure of cca and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Peptidyl-CCA deacylation on the ribosome promoted by induced fit and the O3'-hydroxyl group of A76 of the unacylated A-site tRNA.
pubmed doi rcsb
molecule tags Ribosome
total genus 48
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2008-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3cmaP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 3cmaP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 3cmaP02
3CCJP 1YJNP 3CC4P 1QVFO 3I56P 1KQSO 1VQKP 2QA4P 1YI2P 1K8AQ 3CCEP 3G71P 1YJ9P 3CCLP 3CMEP 3CD6P 2OTJP 3CCQP 3CCMP 1Q82Q 3OW2O 3CCVP 1W2BO 3CXCO 1M90Q 1Q7YQ 1JJ2O 3CC7P 1VQ7P 1VQMP 3CCSP 3CCRP 1VQ5P 1K73Q 2QEXP 1YHQP 3G6EP 1M1KQ 1YITP 1Q81Q 1VQ4P 3CC2P 1VQOP 1QVGO 1NJIQ 1YIJP 3CPWO 3CMAP 1KC8Q 1VQNP 3CCUP 1Q86Q 1VQPP 1VQ6P 3I55P 1S72P 1K9MQ 1N8RQ 3G4SP 1YJWP 1VQ9P 1KD1Q 1VQLP 2OTLP 1VQ8P
chains in the Genus database with same CATH superfamily
5JPAA 2WVRA 3H1KD 2NPSA 3II6A 1FR2A 2YMYA 1GK4A 3U59A 2QJPB 1P84H 1NTKD 3CC7P 3TNUA 1H0TB 2N9YB 1M6NA 1SQBG 5HVCA 2E74B 3H1IE 1T2KD 4PXHB 1PP9D 2OTKE 2YKPA 3AE8C 2JYLA 3M06A 2KSEA 1GZLA 2IYPA 4PV1D 2XZ1C 5BU8B 1N8RQ 4OVNF 1E6JP 2FYNB 3A3YB 4NPDA 1FZCA 3P8CE 2BQ1E 1MV8A 2FXOA 4KHXA 4MRTC 1YHQP 3SWKA 1L0ND 1OVUA 1KFNA 2I1JA 3PLNA 2MVUA 1N73C 2PRRA 1JOCA 1SQVJ 2FFDB 2K94A 3Q5SA 5BU5A 1OR5A 2WPQA 2B9BA 1M56D 2QJYC 2PEIA 3SFDC 4Z1MH 3SWFA 2YKOA 3RL0B 3L74G 3LMOA 1G1JA 3AECC 3L37A 3RK3D 3CWBD 4HH2A 4IFMA 4ZKPA 5GTHH 4C46A 2NO8A 2M0BA 1BGYD 3HD7A 4IZ6A 1LNQA 4C7NA 1LTIC 1RF1B 1GW3A 3L73J 2D2CD 4IL6E 1KILE 3T97B 1L0LK 2JO0A 3H1LJ 3DS0A 2Y0CA 4H13C 1R8EA 3NY7B 1VDFA 5CBNA 3JC22 1IMPA 1W2BO 1LT9A 3AEDC 3JCUH 1NTZD 3A0BE 5B66H 5APXA 1QLED 4U7JA 2FAEA 3VMXA 1SQXE 3CMAP 2L9FA 1NU1K 1U7MA 2G8YA 5EW5E 2D2CB 1NH4A 1YQ4C 4U0BA 1M90Q 1KB9I 3CCSP 4HKGA 2ERHA 1Y8AA 2H7HA 1KYOE 2QJPC 1FDIA 3RBXA 1SQVE 3EFFK 1BCCD 2E74C 4OWFA 2EFJA 2ZYGA 4U3FE 2QNWA 2R44A 3VYIA 3GZLA 2DNWA 3L72E 4N3YB 2A06E 5APUA 2XU6A 3CCVP 5CZDB 2FYNC 3L71G 2OYIA 1KORA 3HUSA 2K0DX 2AFDA 2XNDH 1YQ3C 1Z6MA 2WPRA 1L0LJ 3WMM0 4D6TJ 1X22A 1H88A 1MFTA 1NWQA 2EIAA 1YI2P 2JO1A 1PGPA 3EWKA 4PJ0E 1LTJB 3B4SA 1Q82Q 2FFDC 2HR3A 2PEMA 1URQB 4IFDK 1DD3A 1DEEG 2XKMA 1ZRTD 3L73E 2FKWB 2LOLA 3U1CA 1CW5A 1BDCA 1NU1J 2YXQB 1M6EX 1YJWP 1GL2D 3H1LE 4BPFA 1LTTC 1S9KD 1X9VA 1AVOA 2QA4P 3RL0C 1RY3A 1W2EA 3G29A 5DJUB 1YITP 1LP1B 3KZIH 5TISE 3M9HA 2LTEA 2MVVA 3BRVB 1KV4A 2QJKB 1NTMD 3C9IA 1RF1C 2J5UA 4UB6H 3HE5A 3LW5J 4GODA 1KQSO 5AW0B 4R4MA 2HPCB 2Z45A 2AVAA 2N98A 1BE3D 2FYUG 5AW6B 5APVA 5AW1B 2E42A 1VQ7P 1Y47A 4H2YC 4I7ZB 5BS1A 3EFGA 1M1JA 3H32B 2W8ZA 2SPZA 3GG2A 3CCJP 1JTHB 5CJ0A 1GXGA 2NPSB 3A2AA 2CK3H 1FZEA 3AE5C 1BE3J 1E0HA 1VQ5P 2D2CC 3TNUB 4RESB 3OA7A 2V4HA 3VOPA 1VQ6P 1JCCA 4R4LA 2BASA 4D6TE 2WSCJ 2OTLP 3B5NA 4ZMDA 3HZQA 2GDYA 3VMZA 3SWYA 4H44B 1FZCB 2PP6A 3TF5A 3L74J 5KAIH 3IR9A 1JY2P 2CNRA 2JP3A 1KTMA 3RG2A 4WB4A 1NU1E 3M0DA 5BS2A 3DS5A 1D7MA 3L75E 5APSA 1KILA 5B5EE 2RKLA 1SQPD 3S9OA 3PRJA 2I8DA 2H8PD 3FGAD 3A0HE 4JBZA 3GHGA 1FBMA 2FBWC 3BCCE 4PD4E 4PH0A 4TLFA 4XRQA 3CC2P 2KODA 1LTJC 1SQQK 4WY4A 1URQC 1KLPA 2RN0A 4U0FA 1SQBE 2GDXA 4XFJA 4R0MA 3G1IA 2KI7B 2Q6QA 3HD7B 4C7NB 2KS1A 2LR2A 2PEOA 2IYOA 4ASVA 3Q20A 4JPZB 1OW7A 1VQ8P 2AFEA 1CEIA 2O01N 1ZW0A 2W90A 3L36A 2QJKC 3L70D 2BHVA 1VL2A 1GTWA 1LT9B 2ONTA 3MHVA 1QL1A 1SQQD 2ZT9B 3AE4C 1SS1A 1N86A 1HGZA 3NXSA 1AQTA 1FDMA 2FYUK 3B8EB 3DPHA 1EXJA 1L4AA 2Q3EA 4I7ZC 1L0NG 1BSHA 5CCHA 1VHNA 1JM0A 4A7PA 3L70J 3A5TA 3L74E 1Z56A 1HTLC 2B87A 2NPSC 1JY2N 1SQQJ 2LF4A 4COCA 3CX5D 2N6ZA 2KUBA 3W68A 2IDBA 2KORA 1YTZT 2H43A 2K0XA 3K5BA 2PFXA 3V2PA 3DS2A 2QEXP 5AW9B 3CWBG 2E75B 2OYIB 3HUSB 2VSQA 1JY2O 1VQNP 4H44C 1FZCC 3IN6A 4YXWH 1BGYG 2XT1A 2K37A 2V7QH 2Z4EA 3WU2E 2MY5A 1AA0A 1HVVA 2K92A 3GKLC 2M8LA 3CX5I 2GA1A 1P84I 1Q7YQ 2YNYA 2C9LY 3V2RA 1PPJD 3FX0A 2CGQA 2LKIA 4U0EA 4DG9A 2KG8A 3RBZA 2FYUJ 4EDFA 1PGJA 1NTZG 5F2KA 2AXTH 3R2PA 2GDWA 1KMIZ 1K30A 2VLNA 2KZJA 4H13D 1FC2C 3B5IA 3RGUA 1KZUB 2FQ2A 5KJ7A 2L6EA 3H1JD 4WYMA 3GF7A 3NMDA 3Q5RA 1PEMA 2R3SA 2JB0A 1CSBA 3HD7C 2VLPA 4O9BA 3HRNA 3SSUA 5KKZB 1GD2E 3HE5B 3L71E 3KQGA 2CQ8A 2Q5UA 3G9RA 3KHUA 3CMEP 4I1LA 1L0LG 3LIEA 4OGQB 1BCCG 7CEIA 3E7KA 4CA3A 1NTKK 4L75A 3GF3A 1AV1A 2L0QA 3DS1A 3H1JJ 1NJIQ 2CG5B 2JQ4A 1M1JB 1IUQA 1ZR2A 1S3JA 1LT9C 3MIWA 3IFMA 2LIWA 2ZT9C 4YTPC 2HODA 2B88A 2K88A 2E74D 5HV8A 2FVAA 1GDTA 4N78D 3D70A 5APTA 4H0LB 2Y0EA 4U0CA 2ZVNB 1L0NK 1P84E 1HF9A 1DD4A 3B5NB 3E1RA 1ZN5A 4YPCA 2N5HA 5BVZA 3P7KA 1FZFA 4RKUJ 1NYHA 3CX5H 3I5CA 1T6AA 4UB8H 2WPTA 2POHA 2LIUA 3GLMA 1IFPA 2CWOA 2FYUE 1FZBA 1KILB 2EHTA 2E75C 2OYIC 2A45H 3HUSC 3H1KJ 4BRYA 2JBGA 1NTMG 3RL0D 1NTKJ 3KPEA 3GHGB 2C0WA 1DV5A 2KXPB 2IBZD 1PP9J 2JKVA 2WMMA 1BE3G 3B71A 2ZXXA 3BATA 1RQVA 4WY4B 1A8OA 3R4YA 2JWDA 1QGKB 4AYCA 2Z5IA 1T3UA 3FXEA 4F37A 1ZNVA 1PGOA 4LC1A 2AF8A 1NTZK 1VQ4P 3WUTA 2KS1B 2P58A 1L0NJ 4HKZH 5GTHE 2GZIA 4HB1A 2RH0A 5HGMA 3MP7B 2K9JA 2IBZI 5M1BA 2BEZF 3H1HD 2KYVA 5KKZC 2QG4A 2WSFJ 3AE9C 1FS0E 5E79H 2BEQD 5AW8B 4OGQC 2JU1A 3GW6A 2M8RA 2AEJA 1AUMA 5B66E 1AVYA 2ZJSE 3TGUD 1L4AB 1IFMA 3CWBJ 2Z5HA 1JUNA 1M1JC 3IF4A 2P10A 1A02J 1BGYJ 3H1HJ 1WMKA 2YIUB 1SQPG 5CCGA 3GZMA 3G6EP 1SFCA 2K9YA 1K04A 2B87B 2KG9A 4QNBA 1IFNA 1L2PA 3TYYA 1AF8A 2E76B 3G28A 1DX7A 2QRXA 4H0LC 1PGQA 2FACA 2P7JA 3B5NC 3TSIA 2PNGA 1NTZJ 3G21A 3NTEA 2W6JH 2WSSH 4GR2A 5F2OA 1PP9E 1YBKA 3CLQA 3AE2C 2KOSA 2G3AA 5GTIE 2QIWA 1G1IA 1URQD 5AW2B 1JNMA 5KJ7D 3M0DC 1PL5A 3OW2O 1S2EA 5CJ4A 2GM4A 1KILC 2FQ1A 1IK7A 5DJTB 1EDJA 3BVHA 3Q2YA 1OW8A 1L0NE 3L70G 1OW6A 1USEA 3GHGC 1RHZB 1NTMK 1BCCJ 2LXBA 1X8YA 2ROQA 5HGLA 2XNXA 1AQ5A 1SQQG 4GDOA 4WY4C 3BRTB 4YXDC 1L0IA 1MKMA 4DOJA 2W83C 1VF5B 3GMAA 3L75D 2FADA 2H88C 1KQLA 1FE6A 1OVVA 2WSFH 3RK3E 2E43A 3CWBE 3KZIE 4XE5B 2LL8A 4DZOA 3G26A 1BGYE 3N7NA 4I6MC 4RO0A 4EYYQ 4UB6E 3MZWB 2N1TA 3DS4A 2R5DA 2NPSD 1PV3A 1SQBD 2VLQA 2L4BA 1KB9E 4EIJA 3Q5PA 1RQUA 1YJ9P 5AW3B 2HODB 3V4WA 2OARA 1M74A 1IZNB 1WRGA 5AVZB 3VP8A 4U0AA 1NTZE 1L4AC 3PH0A 3U1AA 1NOHA 2KOQA 5TJHA 1RE4A 5CCHC 1HBWA 1GW4A 2Q1KA 2YIUC 1NTMJ 4H44D 3LRYA 2HG5D 1PPJG 1SQPK 2PY8A 1T8ZA 1W5CE 2E76C 4PH1A 5HGNA 4BPGA 2BCCD 2M5AA 4L74A 2WTYA 1L0LE 2CPBA 1BCCE 5KAIE 3H1JG 1AYIA 2IPPA 3VRLC 4BRYB 3TK1A 3GJNA 1S5LH 1IC2A 4IPYA 2ZXEB 4NPFX 1LTGC 4B86A 3AE7C 5KAFH 4U0DA 3AE6C 1K9MQ 1FOSF 5AW7B 3O6QA 1DNYA 1IMQA 2WSEJ 1X0TA 3HD7D 3EJEA 2K3RA 1NKNA 2R32A 5EJDA 2ZYDA 3M9QA 2V7QJ 2HFED 2HLOA 1ZRTE 4GR6A 1N7SA 2Z46A 2QM8A 1YJNP 3MTUE 5KJ7C 1VF5C 1PZQA 1SQPJ 4WWIA 2O1KA 2YO2A 1M57D 2K9JB 2ZFCA 2ZT9D 4HYTB 3AEBC 3B4QA 1USDA 3H1KG 1EZVD 1NTKG 1NTME 2JU2A 3F5HA 1FOSE 3CXHD 2WPSA 3V2QA 1EQ7A 1PP9G 1LJ2A 2Y9ZA 2O01H 3CCMP 4BXLA 5AW4B 1BE3E 1H89A 2OYOA 4M3LA 4QMAA 2MD9A 1SFCB 4H2WC 5AVWB 4I2LC 4EI2A 3I55P 4IFFA 5H2FH 3MUDA 1S5LX 5EFWB 5AVVB 3MGEA 4AQRD 2IBZG 3ITKA 2E75D 3S1KA 1EZVI 5KLVD 2E5TA 3CXHI 3P05A 2Y9YA 1IO4A 1WT6A 1KD1Q 3L35A 2JJLA 1NQ4A 2PENA 5L8RJ 2P2UA 2KZIA 1FAVA 1OVRA 3P8MC 1LTAC 5KLVJ 2WSEH 3AE1C 1EMVA 2JR8A 2X2BA 4DJGA 1VQPP 3H1HG 1SP4A 1M8OB 3CC4P 4GOFA 3CCEP 1SQPE 3Q3DA 1NHLA 4PWVB 3QH9A 4ZNCA 2KOOA 5AVTB 3H1ID 3UIAA 2AXTE 3TGUG 3M91A 2R3CA 4NPEA 2MKVA 2WT7A 1PEQA 4OGQD 2A45I 1PEOA 3P8CD 1N7LA 1QL2A 2AXCA 5C39A 2N50A 1RE3A 2VRSA 1EOQA 3H1IJ 2ZAEB 1ZR4A 1ACPA 2EHSA 1YIJP 2N1TB 1JEKA 3H0DA 2XDJA 4H0LD 4CPGA 3L70E 3VMAA 3CCRP 1J1EB 3CXHH 1FDOA 1CZQA 1SQQE 3B5ND 3A7OA 2N5IA 3G1GA 1YYCA 4GKGA 1VQ9P 1J2JB 5CCGC 1SFCC 2KB7P 3JSVC 3CD6P 3DS3A 3TDKA 1JY3N 4MN4C 2ZYAA 2KGDA 1AJYA 1DH3A 2K93A 5AVUB 2OGUA 2Z44A 1KILD 2M5AB 2KIKA 1IJDB 3CX5E 1KN7A 2M3BA 1ZMBA 1EIAA 1VQLP 4UB8E 3HTKA 1T3JA 1GL2A 3CL3D 1OXZA 3LIDA 5KP8B 4HJGH 1JY3O 1VQMP 2K2QA 3M0AA 5AVQB 1HUCA 4WY4D 1IFJA 1ZLLA 1SQXD 2KLVA 4XA4A 2XZ0D 1MZ9A 4K3AA 1OIPA 4K35A 5KLIB 3O6QB 5AVYB 1R5SA 3HE4A 5I4TG 2WPVB 3CI9A 3E1IA 3C8VA 1RO2A 1ZP0C 1EXIA 1KYOD 2L5GB 3EJBA 2QSIA 1PPJE 1SQVD 1SQXJ 1U57A 4OH8B 1N7SB 3L4FA 1YTZI 2W6BA 4U3FD 3M1MA 1GXHA 2GYKA 3L72D 2A06D 4M0IA 3PHLA 1E79H 2DGYA 1CI6A 2UWJE 1J1DB 2JDIH 3V4QA 1G2CA 2IFMA 3QWOC 4TT3H 3H1JE 3CPWO 1D1DA 2YXRB 2IX7C 1F80D 1L4AD 2IZ1A 3KYQA 3HYBA 1EC5A 5CCHD 4U3FJ 2JAZA 2KOGA 1A43A 1KYOI 2BCCG 1EDIA 2MR7A 1HGVA 3L72J 4PV1B 3G71P 1UIXA 2N1TC 2VLOA 2OTJP 2FY8A 1HY8A 1JJ2O 5E79E 1OMIA 2XV6A 3L73D 2E1MA 4BWNA 1VKUA 3SFEC 1H8AA 2E76D 2PGDA 2W27A 2M3EA 2M8PA 3H1LD 5CBOA 3RK2D 2YKQA 4Y99B 1RF0A 1J1EC 4WBAA 1ZMEC 2KP8A 3JCUE 4L76A 1ZXGA 1K8AQ 3FWLA 2FYZA 1RE4C 1X79B 4WVZA 3CXCO 2OYHA 1GK6A 5HGOA 2KWLA 2QVAA 4N78E 2GZFA 2Q3IA 3PP5A 1ZOYC 1FJKA 1KB9D 1R5LA 2Q9IA 4IL6H 3RK2B 3H1KE 1EDKA 3TGUJ 3VN0A 2Y0DA 3RK3B 4W7ZA 4BPHA 2P67A 3D6ZA 1RH5B 1NTKE 1JMMA 5APYA 3A0BH 3AEEC 2JGPA 4W7YA 3PTZA 2FHSC 1L0HA 4C7RA 1Q2NA 1LTSC 1VF5D 2MF4A 1EZVG 1A02F 1LWUA 1KFMA 5KLIC 4XFYA 4UHPB 3NFQA 1L0LD 2O3JA 2HYNA 4D6TD 1HH0A 2IBZE 5CHXA 4XFZA 2WZ7A 2WT7B 1SQBK 1KYOH 2PEJA 3CCLP 5GTIH 3CCQP 1N7SC 3V2NA 1QX8A 1E5WA 2R5BA 3RG6C 2M5RA 3E2DA 1NU1D 2FVFA 1VQOP 1U7JA 3U43A 5KLVG 1XTCC 1J1DC 4JQ0D 3NTNA 1AFOA 3RL0g 1GU4A 3OJAB 2N9BA 2M8NA 3WUVA 4H2XC 1N73A 3VMYA 1RO0A 1T2KC 2C9NY 2WWWA 3BCCD 4PD4D 1Y9BA 3H1HE 5K5GB 1FZGA 4PV1C 3M9BA 3V5BA 4PJ0H 3G3ZA 4LLHA 1ZV8A 2I1KA 3L75J 1UNKA 2DW3A 3O8ZA 4IL6X 3PJSK 1N2DC 1UJZA 3G0VA 2A45G 3TGUE 1LT1A 4Y99C 3F89A 3Q1MA 3BCCJ 3MUDC 1Q81Q 2FVEA 5AW5B 1FJPA 2YO3A 1IFIA 1TU3F 3KXDA 3G4SP 2O01J 3USSA 4XFXA 1UIIA 1GPJA 4PD4I 3FXDA 3H1IG 1SQBJ 3KDPB 1QVFO 5TISH 4EOTA 3HTKB 1DEBA 5KP7B 1GL2B 1KB9H 2LMLA 2KNCA 2LXCB 3RK2C 2CPSA 1NVOA 3RK3C 3IAOA 2K0YA 1QEXA 2FXMA 1XTGB 1S5LE 2AEMA 2J59M 2W6AA 2GZEA 3P32A 2WQYC 3HE4B 3AEFC 4JF7A 3L74D 5KAFE 3C1LA 1GU5A 2K1AA 2GZJA 2L91A 3H47A 4KJMA 1NKZB 2FQ0A 2BCCJ 1KQGB 3ABVC 1OX3A 2KG6A 4LGDE 4NEOA 2NRGA 3H25A 2P1JA 2JYGA 1MUUA 1H0TA 1GMJA 1CI6B 4W80A 1X3OA 3EQ2A 1JO5A 1G2CB 2IFNA 2E5YA 2QM7A 2ZVOB 1RE3C 3DTJA 1S9KE 1S1CX 2IZ0A 5CCGD 1SFCD 5B5EH 1HJ0A 1K73Q 5KLVK 1OFCX 4JYCA 2KGEA 3VP9A 3A0HH 2JWAA 2FFDA 4IOIH 1FU1A 4PD4H 5CMZA 1VQKP 1VPCA 2OQQA 1SQXG 4GT1A 2H89C 1Q90D 4DCKA 3LW5H 4RJTA 2OYHB 2KOPA 1NAFA 5H2FE 1NGMB 2PEKA 2KK7A 1S4XA 5KP6B 3AE3C 4XROA 1SLQA 3L71D 2YMKA 4ASWA 3I56P 1EDLA 1BAJA 2ITAA 1SQVG 3CE7A 1SVFA 1RF1A 2FXPA 2XV5A 4U3FG 5F2NA 3V6IA 3L72G 2A06G 1GL2C 2BCCE 3T97A 2KSJA 1MFZA 3CCUP 2MJZA 4N6JA 3FWNA 1JMBA 3L71J 5AVSB 3WBHA 1DIPA 2P9XA 4QKOA 4DT0A 1PFIA 1JY3P 1T8KA 2WSCH 1LWUB 2QE7H 5KTBA 1LTBC 1QRJA 2WITA 2KGAA 3H4EA 1P84D 4Y28J 2KGCA 3L73G 1KQFB 2O1JA 2GUSA 4AUWA 2MR8A 3H1LG 4COPA 3W67A 2N1TD 2RMZA 2GZGA 2KLUA 3VTPC 4JYBA 2PAJA 1IK9A 1QVGO 3N4XA 4ZKUA 2N6YA 2FYUD 1IFDA 5AVXB 1K05A 3EJDA 5DCKA 1JCDA 3BASA 2NZ2A 1LGHB 1N73B 1FZAA 2EG5A 3WU2H 2B89A 1OZHA 3D71A 3MD0A 4GOEA 1MZ8A 3AEAC 2XXMA 1EZVE 2QJYB 2XZRA 3CXHE 1LTJA 5APWA 1HWTC 1URQA 2C0XA 4GIFA 1RF0C 3S4RA 1NO4A 3D6YA 2J58A 1SQXK 2JEEA 1S72P 1M1KQ 2OYHC 3H6PA 1HJBA 1NAYA 5APQA 1OWAA 3WUUA 4D6TG 2BUOA 1BDDA 2LKMA 4KT0J 5KLVE 3AEGC 1LP1A 2GUVA 1BSNA 2KNCB 1HQBA 4H13B 1RNIA 2KW2A 1M7LA 1KC8Q 1PEUA 1SQVK 2K5XA 1PIXA 2HPCA 2PEQA 2AEFA 1NU1G 4L73A 3L75G 1BXIA 2KR5A 3OAKA 3MGNA 2Q7CA 5AVRB 1N7SD 2L22A 1JB0J 3H32A 3ZDMA 2LPKA 1Q86Q 1LWUC 1JTHA 3BCCG
chains in the Genus database with same CATH topology
5JPAA 3M1MA 1QVFO 5DCKA 5HGLA 1VQKP 2QA4P 4M0IA 3H0DA 5HGMA 3MGEA 3VRLC 2DGYA 1W2BO 4IPYA 3G29A 3CC7P 2EG5A 3CCRP 1M6NA 3DS2A 2QEXP 2PEKA 4PH0A 1YITP 4XRQA 4XFYA 3CC2P 2JYLA 2KODA 3P05A 4U0CA 3CPWO 1D1DA 3CMAP 1VQNP 4U0DA 3G1GA 1K9MQ 1N8RQ 2XXMA 4XROA 1KD1Q 2XT1A 3HYBA 4XFZA 1AUMA 1VQ9P 1E6JP 4U0FA 2PENA 3I56P 1KQSO 1A43A 1BAJA 2PEJA 2Z45A 3G71P 2M8LA 3CCLP 3CD6P 4U0BA 3DS3A 3CCQP 3G1IA 2BQ1E 3G26A 4XFXA 2OTJP 1M90Q 1Q7YQ 1JJ2O 1VQ7P 2XV6A 3CCSP 2E1MA 3RG6C 3H47A 5F2NA 1YHQP 3G6EP 3E2DA 2PEOA 2Z44A 5BS1A 4QNBA 1VQOP 4U0EA 2M8PA 4GR6A 3DS4A 2Z46A 3CCUP 2CWOA 1VQPP 1S72P 3Q20A 1M1KQ 1EIAA 1ZMBA 1VQLP 1VQ8P 3CCJP 3G28A 5F2KA 1YJNP 3WBHA 3CC4P 2EFJA 3CCEP 1K8AQ 1K30A 2P9XA 1YJ9P 2M8NA 2JYGA 2BHVA 1RO0A 3B5IA 2OARA 2BUOA 3CCVP 3CXCO 1VQMP 1VQ5P 1M74A 5HGOA 2ONTA 2PEIA 1QRJA 4U0AA 2L6EA 3G21A 1RNIA 3NTEA 4WYMA 4GR2A 1PEMA 3H4EA 5F2OA 1KC8Q 1PEUA 1VQ6P 3DPHA 1A8OA 2OTLP 1PEQA 2EIAA 3G0VA 3LRYA 2PEQA 3HZQA 1YI2P 3DTJA 1PEOA 5I4TG 2PY8A 3CMEP 1RO2A 3CCMP 1Q82Q 3OW2O 4COPA 2PEMA 4PH1A 1EOQA 1K73Q 5HGNA 1Q81Q 1VQ4P 3DS1A 1QVGO 1NJIQ 2LF4A 4COCA 1YIJP 5BS2A 3DS5A 1Q86Q 1IUQA 3I55P 2JO0A 1M6EX 3G4SP 1YJWP 3DS0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCJ P;  1YJN P;  3CC4 P;  1QVF O;  3I56 P;  1KQS O;  1VQK P;  2QA4 P;  1YI2 P;  1K8A Q;  3CCE P;  3G71 P;  1YJ9 P;  3CCL P;  3CME P;  3CD6 P;  2OTJ P;  3CCQ P;  3CCM P;  1Q82 Q;  3OW2 O;  3CCV P;  1W2B O;  3CXC O;  1M90 Q;  1Q7Y Q;  1JJ2 O;  3CC7 P;  1VQ7 P;  1VQM P;  3CCS P;  3CCR P;  1VQ5 P;  1K73 Q;  2QEX P;  1YHQ P;  3G6E P;  1M1K Q;  1YIT P;  1Q81 Q;  1VQ4 P;  3CC2 P;  1VQO P;  1QVG O;  1NJI Q;  1YIJ P;  3CPW O;  3CMA P;  1KC8 Q;  1VQN P;  3CCU P;  1Q86 Q;  1VQP P;  1VQ6 P;  3I55 P;  1S72 P;  1K9M Q;  1N8R Q;  3G4S P;  1YJW P;  1VQ9 P;  1KD1 Q;  1VQL P;  2OTL P;  1VQ8 P; 
#chains in the Genus database with same CATH topology
 5JPA A;  2WVR A;  3H1K D;  2NPS A;  3II6 A;  1FR2 A;  2YMY A;  1GK4 A;  3U59 A;  2QJP B;  1P84 H;  1NTK D;  3CC7 P;  3TNU A;  1H0T B;  2N9Y B;  1M6N A;  1SQB G;  5HVC A;  2E74 B;  3H1I E;  1T2K D;  4PXH B;  1PP9 D;  2OTK E;  2YKP A;  3AE8 C;  2JYL A;  3M06 A;  2KSE A;  1GZL A;  2IYP A;  4PV1 D;  2XZ1 C;  5BU8 B;  1N8R Q;  4OVN F;  1E6J P;  2FYN B;  3A3Y B;  4NPD A;  1FZC A;  3P8C E;  2BQ1 E;  1MV8 A;  2FXO A;  4KHX A;  4MRT C;  1YHQ P;  3SWK A;  1L0N D;  1OVU A;  1KFN A;  2I1J A;  3PLN A;  2MVU A;  1N73 C;  2PRR A;  1JOC A;  1SQV J;  2FFD B;  2K94 A;  3Q5S A;  5BU5 A;  1OR5 A;  2WPQ A;  2B9B A;  1M56 D;  2QJY C;  2PEI A;  3SFD C;  4Z1M H;  3SWF A;  2YKO A;  3RL0 B;  3L74 G;  3LMO A;  1G1J A;  3AEC C;  3L37 A;  3RK3 D;  3CWB D;  4HH2 A;  4IFM A;  4ZKP A;  5GTH H;  4C46 A;  2NO8 A;  2M0B A;  1BGY D;  3HD7 A;  4IZ6 A;  1LNQ A;  4C7N A;  1LTI C;  1RF1 B;  1GW3 A;  3L73 J;  2D2C D;  4IL6 E;  1KIL E;  3T97 B;  1L0L K;  2JO0 A;  3H1L J;  3DS0 A;  2Y0C A;  4H13 C;  1R8E A;  3NY7 B;  1VDF A;  5CBN A;  3JC2 2;  1IMP A;  1W2B O;  1LT9 A;  3AED C;  3JCU H;  1NTZ D;  3A0B E;  5B66 H;  5APX A;  1QLE D;  4U7J A;  2FAE A;  3VMX A;  1SQX E;  3CMA P;  2L9F A;  1NU1 K;  1U7M A;  2G8Y A;  5EW5 E;  2D2C B;  1NH4 A;  1YQ4 C;  4U0B A;  1M90 Q;  1KB9 I;  3CCS P;  4HKG A;  2ERH A;  1Y8A A;  2H7H A;  1KYO E;  2QJP C;  1FDI A;  3RBX A;  1SQV E;  3EFF K;  1BCC D;  2E74 C;  4OWF A;  2EFJ A;  2ZYG A;  4U3F E;  2QNW A;  2R44 A;  3VYI A;  3GZL A;  2DNW A;  3L72 E;  4N3Y B;  2A06 E;  5APU A;  2XU6 A;  3CCV P;  5CZD B;  2FYN C;  3L71 G;  2OYI A;  1KOR A;  3HUS A;  2K0D X;  2AFD A;  2XND H;  1YQ3 C;  1Z6M A;  2WPR A;  1L0L J;  3WMM 0;  4D6T J;  1X22 A;  1H88 A;  1MFT A;  1NWQ A;  2EIA A;  1YI2 P;  2JO1 A;  1PGP A;  3EWK A;  4PJ0 E;  1LTJ B;  3B4S A;  1Q82 Q;  2FFD C;  2HR3 A;  2PEM A;  1URQ B;  4IFD K;  1DD3 A;  1DEE G;  2XKM A;  1ZRT D;  3L73 E;  2FKW B;  2LOL A;  3U1C A;  1CW5 A;  1BDC A;  1NU1 J;  2YXQ B;  1M6E X;  1YJW P;  1GL2 D;  3H1L E;  4BPF A;  1LTT C;  1S9K D;  1X9V A;  1AVO A;  2QA4 P;  3RL0 C;  1RY3 A;  1W2E A;  3G29 A;  5DJU B;  1YIT P;  1LP1 B;  3KZI H;  5TIS E;  3M9H A;  2LTE A;  2MVV A;  3BRV B;  1KV4 A;  2QJK B;  1NTM D;  3C9I A;  1RF1 C;  2J5U A;  4UB6 H;  3HE5 A;  3LW5 J;  4GOD A;  1KQS O;  5AW0 B;  4R4M A;  2HPC B;  2Z45 A;  2AVA A;  2N98 A;  1BE3 D;  2FYU G;  5AW6 B;  5APV A;  5AW1 B;  2E42 A;  1VQ7 P;  1Y47 A;  4H2Y C;  4I7Z B;  5BS1 A;  3EFG A;  1M1J A;  3H32 B;  2W8Z A;  2SPZ A;  3GG2 A;  3CCJ P;  1JTH B;  5CJ0 A;  1GXG A;  2NPS B;  3A2A A;  2CK3 H;  1FZE A;  3AE5 C;  1BE3 J;  1E0H A;  1VQ5 P;  2D2C C;  3TNU B;  4RES B;  3OA7 A;  2V4H A;  3VOP A;  1VQ6 P;  1JCC A;  4R4L A;  2BAS A;  4D6T E;  2WSC J;  2OTL P;  3B5N A;  4ZMD A;  3HZQ A;  2GDY A;  3VMZ A;  3SWY A;  4H44 B;  1FZC B;  2PP6 A;  3TF5 A;  3L74 J;  5KAI H;  3IR9 A;  1JY2 P;  2CNR A;  2JP3 A;  1KTM A;  3RG2 A;  4WB4 A;  1NU1 E;  3M0D A;  5BS2 A;  3DS5 A;  1D7M A;  3L75 E;  5APS A;  1KIL A;  5B5E E;  2RKL A;  1SQP D;  3S9O A;  3PRJ A;  2I8D A;  2H8P D;  3FGA D;  3A0H E;  4JBZ A;  3GHG A;  1FBM A;  2FBW C;  3BCC E;  4PD4 E;  4PH0 A;  4TLF A;  4XRQ A;  3CC2 P;  2KOD A;  1LTJ C;  1SQQ K;  4WY4 A;  1URQ C;  1KLP A;  2RN0 A;  4U0F A;  1SQB E;  2GDX A;  4XFJ A;  4R0M A;  3G1I A;  2KI7 B;  2Q6Q A;  3HD7 B;  4C7N B;  2KS1 A;  2LR2 A;  2PEO A;  2IYO A;  4ASV A;  3Q20 A;  4JPZ B;  1OW7 A;  1VQ8 P;  2AFE A;  1CEI A;  2O01 N;  1ZW0 A;  2W90 A;  3L36 A;  2QJK C;  3L70 D;  2BHV A;  1VL2 A;  1GTW A;  1LT9 B;  2ONT A;  3MHV A;  1QL1 A;  1SQQ D;  2ZT9 B;  3AE4 C;  1SS1 A;  1N86 A;  1HGZ A;  3NXS A;  1AQT A;  1FDM A;  2FYU K;  3B8E B;  3DPH A;  1EXJ A;  1L4A A;  2Q3E A;  4I7Z C;  1L0N G;  1BSH A;  5CCH A;  1VHN A;  1JM0 A;  4A7P A;  3L70 J;  3A5T A;  3L74 E;  1Z56 A;  1HTL C;  2B87 A;  2NPS C;  1JY2 N;  1SQQ J;  2LF4 A;  4COC A;  3CX5 D;  2N6Z A;  2KUB A;  3W68 A;  2IDB A;  2KOR A;  1YTZ T;  2H43 A;  2K0X A;  3K5B A;  2PFX A;  3V2P A;  3DS2 A;  2QEX P;  5AW9 B;  3CWB G;  2E75 B;  2OYI B;  3HUS B;  2VSQ A;  1JY2 O;  1VQN P;  4H44 C;  1FZC C;  3IN6 A;  4YXW H;  1BGY G;  2XT1 A;  2K37 A;  2V7Q H;  2Z4E A;  3WU2 E;  2MY5 A;  1AA0 A;  1HVV A;  2K92 A;  3GKL C;  2M8L A;  3CX5 I;  2GA1 A;  1P84 I;  1Q7Y Q;  2YNY A;  2C9L Y;  3V2R A;  1PPJ D;  3FX0 A;  2CGQ A;  2LKI A;  4U0E A;  4DG9 A;  2KG8 A;  3RBZ A;  2FYU J;  4EDF A;  1PGJ A;  1NTZ G;  5F2K A;  2AXT H;  3R2P A;  2GDW A;  1KMI Z;  1K30 A;  2VLN A;  2KZJ A;  4H13 D;  1FC2 C;  3B5I A;  3RGU A;  1KZU B;  2FQ2 A;  5KJ7 A;  2L6E A;  3H1J D;  4WYM A;  3GF7 A;  3NMD A;  3Q5R A;  1PEM A;  2R3S A;  2JB0 A;  1CSB A;  3HD7 C;  2VLP A;  4O9B A;  3HRN A;  3SSU A;  5KKZ B;  1GD2 E;  3HE5 B;  3L71 E;  3KQG A;  2CQ8 A;  2Q5U A;  3G9R A;  3KHU A;  3CME P;  4I1L A;  1L0L G;  3LIE A;  4OGQ B;  1BCC G;  7CEI A;  3E7K A;  4CA3 A;  1NTK K;  4L75 A;  3GF3 A;  1AV1 A;  2L0Q A;  3DS1 A;  3H1J J;  1NJI Q;  2CG5 B;  2JQ4 A;  1M1J B;  1IUQ A;  1ZR2 A;  1S3J A;  1LT9 C;  3MIW A;  3IFM A;  2LIW A;  2ZT9 C;  4YTP C;  2HOD A;  2B88 A;  2K88 A;  2E74 D;  5HV8 A;  2FVA A;  1GDT A;  4N78 D;  3D70 A;  5APT A;  4H0L B;  2Y0E A;  4U0C A;  2ZVN B;  1L0N K;  1P84 E;  1HF9 A;  1DD4 A;  3B5N B;  3E1R A;  1ZN5 A;  4YPC A;  2N5H A;  5BVZ A;  3P7K A;  1FZF A;  4RKU J;  1NYH A;  3CX5 H;  3I5C A;  1T6A A;  4UB8 H;  2WPT A;  2POH A;  2LIU A;  3GLM A;  1IFP A;  2CWO A;  2FYU E;  1FZB A;  1KIL B;  2EHT A;  2E75 C;  2OYI C;  2A45 H;  3HUS C;  3H1K J;  4BRY A;  2JBG A;  1NTM G;  3RL0 D;  1NTK J;  3KPE A;  3GHG B;  2C0W A;  1DV5 A;  2KXP B;  2IBZ D;  1PP9 J;  2JKV A;  2WMM A;  1BE3 G;  3B71 A;  2ZXX A;  3BAT A;  1RQV A;  4WY4 B;  1A8O A;  3R4Y A;  2JWD A;  1QGK B;  4AYC A;  2Z5I A;  1T3U A;  3FXE A;  4F37 A;  1ZNV A;  1PGO A;  4LC1 A;  2AF8 A;  1NTZ K;  1VQ4 P;  3WUT A;  2KS1 B;  2P58 A;  1L0N J;  4HKZ H;  5GTH E;  2GZI A;  4HB1 A;  2RH0 A;  5HGM A;  3MP7 B;  2K9J A;  2IBZ I;  5M1B A;  2BEZ F;  3H1H D;  2KYV A;  5KKZ C;  2QG4 A;  2WSF J;  3AE9 C;  1FS0 E;  5E79 H;  2BEQ D;  5AW8 B;  4OGQ C;  2JU1 A;  3GW6 A;  2M8R A;  2AEJ A;  1AUM A;  5B66 E;  1AVY A;  2ZJS E;  3TGU D;  1L4A B;  1IFM A;  3CWB J;  2Z5H A;  1JUN A;  1M1J C;  3IF4 A;  2P10 A;  1A02 J;  1BGY J;  3H1H J;  1WMK A;  2YIU B;  1SQP G;  5CCG A;  3GZM A;  3G6E P;  1SFC A;  2K9Y A;  1K04 A;  2B87 B;  2KG9 A;  4QNB A;  1IFN A;  1L2P A;  3TYY A;  1AF8 A;  2E76 B;  3G28 A;  1DX7 A;  2QRX A;  4H0L C;  1PGQ A;  2FAC A;  2P7J A;  3B5N C;  3TSI A;  2PNG A;  1NTZ J;  3G21 A;  3NTE A;  2W6J H;  2WSS H;  4GR2 A;  5F2O A;  1PP9 E;  1YBK A;  3CLQ A;  3AE2 C;  2KOS A;  2G3A A;  5GTI E;  2QIW A;  1G1I A;  1URQ D;  5AW2 B;  1JNM A;  5KJ7 D;  3M0D C;  1PL5 A;  3OW2 O;  1S2E A;  5CJ4 A;  2GM4 A;  1KIL C;  2FQ1 A;  1IK7 A;  5DJT B;  1EDJ A;  3BVH A;  3Q2Y A;  1OW8 A;  1L0N E;  3L70 G;  1OW6 A;  1USE A;  3GHG C;  1RHZ B;  1NTM K;  1BCC J;  2LXB A;  1X8Y A;  2ROQ A;  5HGL A;  2XNX A;  1AQ5 A;  1SQQ G;  4GDO A;  4WY4 C;  3BRT B;  4YXD C;  1L0I A;  1MKM A;  4DOJ A;  2W83 C;  1VF5 B;  3GMA A;  3L75 D;  2FAD A;  2H88 C;  1KQL A;  1FE6 A;  1OVV A;  2WSF H;  3RK3 E;  2E43 A;  3CWB E;  3KZI E;  4XE5 B;  2LL8 A;  4DZO A;  3G26 A;  1BGY E;  3N7N A;  4I6M C;  4RO0 A;  4EYY Q;  4UB6 E;  3MZW B;  2N1T A;  3DS4 A;  2R5D A;  2NPS D;  1PV3 A;  1SQB D;  2VLQ A;  2L4B A;  1KB9 E;  4EIJ A;  3Q5P A;  1RQU A;  1YJ9 P;  5AW3 B;  2HOD B;  3V4W A;  2OAR A;  1M74 A;  1IZN B;  1WRG A;  5AVZ B;  3VP8 A;  4U0A A;  1NTZ E;  1L4A C;  3PH0 A;  3U1A A;  1NOH A;  2KOQ A;  5TJH A;  1RE4 A;  5CCH C;  1HBW A;  1GW4 A;  2Q1K A;  2YIU C;  1NTM J;  4H44 D;  3LRY A;  2HG5 D;  1PPJ G;  1SQP K;  2PY8 A;  1T8Z A;  1W5C E;  2E76 C;  4PH1 A;  5HGN A;  4BPG A;  2BCC D;  2M5A A;  4L74 A;  2WTY A;  1L0L E;  2CPB A;  1BCC E;  5KAI E;  3H1J G;  1AYI A;  2IPP A;  3VRL C;  4BRY B;  3TK1 A;  3GJN A;  1S5L H;  1IC2 A;  4IPY A;  2ZXE B;  4NPF X;  1LTG C;  4B86 A;  3AE7 C;  5KAF H;  4U0D A;  3AE6 C;  1K9M Q;  1FOS F;  5AW7 B;  3O6Q A;  1DNY A;  1IMQ A;  2WSE J;  1X0T A;  3HD7 D;  3EJE A;  2K3R A;  1NKN A;  2R32 A;  5EJD A;  2ZYD A;  3M9Q A;  2V7Q J;  2HFE D;  2HLO A;  1ZRT E;  4GR6 A;  1N7S A;  2Z46 A;  2QM8 A;  1YJN P;  3MTU E;  5KJ7 C;  1VF5 C;  1PZQ A;  1SQP J;  4WWI A;  2O1K A;  2YO2 A;  1M57 D;  2K9J B;  2ZFC A;  2ZT9 D;  4HYT B;  3AEB C;  3B4Q A;  1USD A;  3H1K G;  1EZV D;  1NTK G;  1NTM E;  2JU2 A;  3F5H A;  1FOS E;  3CXH D;  2WPS A;  3V2Q A;  1EQ7 A;  1PP9 G;  1LJ2 A;  2Y9Z A;  2O01 H;  3CCM P;  4BXL A;  5AW4 B;  1BE3 E;  1H89 A;  2OYO A;  4M3L A;  4QMA A;  2MD9 A;  1SFC B;  4H2W C;  5AVW B;  4I2L C;  4EI2 A;  3I55 P;  4IFF A;  5H2F H;  3MUD A;  1S5L X;  5EFW B;  5AVV B;  3MGE A;  4AQR D;  2IBZ G;  3ITK A;  2E75 D;  3S1K A;  1EZV I;  5KLV D;  2E5T A;  3CXH I;  3P05 A;  2Y9Y A;  1IO4 A;  1WT6 A;  1KD1 Q;  3L35 A;  2JJL A;  1NQ4 A;  2PEN A;  5L8R J;  2P2U A;  2KZI A;  1FAV A;  1OVR A;  3P8M C;  1LTA C;  5KLV J;  2WSE H;  3AE1 C;  1EMV A;  2JR8 A;  2X2B A;  4DJG A;  1VQP P;  3H1H G;  1SP4 A;  1M8O B;  3CC4 P;  4GOF A;  3CCE P;  1SQP E;  3Q3D A;  1NHL A;  4PWV B;  3QH9 A;  4ZNC A;  2KOO A;  5AVT B;  3H1I D;  3UIA A;  2AXT E;  3TGU G;  3M91 A;  2R3C A;  4NPE A;  2MKV A;  2WT7 A;  1PEQ A;  4OGQ D;  2A45 I;  1PEO A;  3P8C D;  1N7L A;  1QL2 A;  2AXC A;  5C39 A;  2N50 A;  1RE3 A;  2VRS A;  1EOQ A;  3H1I J;  2ZAE B;  1ZR4 A;  1ACP A;  2EHS A;  1YIJ P;  2N1T B;  1JEK A;  3H0D A;  2XDJ A;  4H0L D;  4CPG A;  3L70 E;  3VMA A;  3CCR P;  1J1E B;  3CXH H;  1FDO A;  1CZQ A;  1SQQ E;  3B5N D;  3A7O A;  2N5I A;  3G1G A;  1YYC A;  4GKG A;  1VQ9 P;  1J2J B;  5CCG C;  1SFC C;  2KB7 P;  3JSV C;  3CD6 P;  3DS3 A;  3TDK A;  1JY3 N;  4MN4 C;  2ZYA A;  2KGD A;  1AJY A;  1DH3 A;  2K93 A;  5AVU B;  2OGU A;  2Z44 A;  1KIL D;  2M5A B;  2KIK A;  1IJD B;  3CX5 E;  1KN7 A;  2M3B A;  1ZMB A;  1EIA A;  1VQL P;  4UB8 E;  3HTK A;  1T3J A;  1GL2 A;  3CL3 D;  1OXZ A;  3LID A;  5KP8 B;  4HJG H;  1JY3 O;  1VQM P;  2K2Q A;  3M0A A;  5AVQ B;  1HUC A;  4WY4 D;  1IFJ A;  1ZLL A;  1SQX D;  2KLV A;  4XA4 A;  2XZ0 D;  1MZ9 A;  4K3A A;  1OIP A;  4K35 A;  5KLI B;  3O6Q B;  5AVY B;  1R5S A;  3HE4 A;  5I4T G;  2WPV B;  3CI9 A;  3E1I A;  3C8V A;  1RO2 A;  1ZP0 C;  1EXI A;  1KYO D;  2L5G B;  3EJB A;  2QSI A;  1PPJ E;  1SQV D;  1SQX J;  1U57 A;  4OH8 B;  1N7S B;  3L4F A;  1YTZ I;  2W6B A;  4U3F D;  3M1M A;  1GXH A;  2GYK A;  3L72 D;  2A06 D;  4M0I A;  3PHL A;  1E79 H;  2DGY A;  1CI6 A;  2UWJ E;  1J1D B;  2JDI H;  3V4Q A;  1G2C A;  2IFM A;  3QWO C;  4TT3 H;  3H1J E;  3CPW O;  1D1D A;  2YXR B;  2IX7 C;  1F80 D;  1L4A D;  2IZ1 A;  3KYQ A;  3HYB A;  1EC5 A;  5CCH D;  4U3F J;  2JAZ A;  2KOG A;  1A43 A;  1KYO I;  2BCC G;  1EDI A;  2MR7 A;  1HGV A;  3L72 J;  4PV1 B;  3G71 P;  1UIX A;  2N1T C;  2VLO A;  2OTJ P;  2FY8 A;  1HY8 A;  1JJ2 O;  5E79 E;  1OMI A;  2XV6 A;  3L73 D;  2E1M A;  4BWN A;  1VKU A;  3SFE C;  1H8A A;  2E76 D;  2PGD A;  2W27 A;  2M3E A;  2M8P A;  3H1L D;  5CBO A;  3RK2 D;  2YKQ A;  4Y99 B;  1RF0 A;  1J1E C;  4WBA A;  1ZME C;  2KP8 A;  3JCU E;  4L76 A;  1ZXG A;  1K8A Q;  3FWL A;  2FYZ A;  1RE4 C;  1X79 B;  4WVZ A;  3CXC O;  2OYH A;  1GK6 A;  5HGO A;  2KWL A;  2QVA A;  4N78 E;  2GZF A;  2Q3I A;  3PP5 A;  1ZOY C;  1FJK A;  1KB9 D;  1R5L A;  2Q9I A;  4IL6 H;  3RK2 B;  3H1K E;  1EDK A;  3TGU J;  3VN0 A;  2Y0D A;  3RK3 B;  4W7Z A;  4BPH A;  2P67 A;  3D6Z A;  1RH5 B;  1NTK E;  1JMM A;  5APY A;  3A0B H;  3AEE C;  2JGP A;  4W7Y A;  3PTZ A;  2FHS C;  1L0H A;  4C7R A;  1Q2N A;  1LTS C;  1VF5 D;  2MF4 A;  1EZV G;  1A02 F;  1LWU A;  1KFM A;  5KLI C;  4XFY A;  4UHP B;  3NFQ A;  1L0L D;  2O3J A;  2HYN A;  4D6T D;  1HH0 A;  2IBZ E;  5CHX A;  4XFZ A;  2WZ7 A;  2WT7 B;  1SQB K;  1KYO H;  2PEJ A;  3CCL P;  5GTI H;  3CCQ P;  1N7S C;  3V2N A;  1QX8 A;  1E5W A;  2R5B A;  3RG6 C;  2M5R A;  3E2D A;  1NU1 D;  2FVF A;  1VQO P;  1U7J A;  3U43 A;  5KLV G;  1XTC C;  1J1D C;  4JQ0 D;  3NTN A;  1AFO A;  3RL0 g;  1GU4 A;  3OJA B;  2N9B A;  2M8N A;  3WUV A;  4H2X C;  1N73 A;  3VMY A;  1RO0 A;  1T2K C;  2C9N Y;  2WWW A;  3BCC D;  4PD4 D;  1Y9B A;  3H1H E;  5K5G B;  1FZG A;  4PV1 C;  3M9B A;  3V5B A;  4PJ0 H;  3G3Z A;  4LLH A;  1ZV8 A;  2I1K A;  3L75 J;  1UNK A;  2DW3 A;  3O8Z A;  4IL6 X;  3PJS K;  1N2D C;  1UJZ A;  3G0V A;  2A45 G;  3TGU E;  1LT1 A;  4Y99 C;  3F89 A;  3Q1M A;  3BCC J;  3MUD C;  1Q81 Q;  2FVE A;  5AW5 B;  1FJP A;  2YO3 A;  1IFI A;  1TU3 F;  3KXD A;  3G4S P;  2O01 J;  3USS A;  4XFX A;  1UII A;  1GPJ A;  4PD4 I;  3FXD A;  3H1I G;  1SQB J;  3KDP B;  1QVF O;  5TIS H;  4EOT A;  3HTK B;  1DEB A;  5KP7 B;  1GL2 B;  1KB9 H;  2LML A;  2KNC A;  2LXC B;  3RK2 C;  2CPS A;  1NVO A;  3RK3 C;  3IAO A;  2K0Y A;  1QEX A;  2FXM A;  1XTG B;  1S5L E;  2AEM A;  2J59 M;  2W6A A;  2GZE A;  3P32 A;  2WQY C;  3HE4 B;  3AEF C;  4JF7 A;  3L74 D;  5KAF E;  3C1L A;  1GU5 A;  2K1A A;  2GZJ A;  2L91 A;  3H47 A;  4KJM A;  1NKZ B;  2FQ0 A;  2BCC J;  1KQG B;  3ABV C;  1OX3 A;  2KG6 A;  4LGD E;  4NEO A;  2NRG A;  3H25 A;  2P1J A;  2JYG A;  1MUU A;  1H0T A;  1GMJ A;  1CI6 B;  4W80 A;  1X3O A;  3EQ2 A;  1JO5 A;  1G2C B;  2IFN A;  2E5Y A;  2QM7 A;  2ZVO B;  1RE3 C;  3DTJ A;  1S9K E;  1S1C X;  2IZ0 A;  5CCG D;  1SFC D;  5B5E H;  1HJ0 A;  1K73 Q;  5KLV K;  1OFC X;  4JYC A;  2KGE A;  3VP9 A;  3A0H H;  2JWA A;  2FFD A;  4IOI H;  1FU1 A;  4PD4 H;  5CMZ A;  1VQK P;  1VPC A;  2OQQ A;  1SQX G;  4GT1 A;  2H89 C;  1Q90 D;  4DCK A;  3LW5 H;  4RJT A;  2OYH B;  2KOP A;  1NAF A;  5H2F E;  1NGM B;  2PEK A;  2KK7 A;  1S4X A;  5KP6 B;  3AE3 C;  4XRO A;  1SLQ A;  3L71 D;  2YMK A;  4ASW A;  3I56 P;  1EDL A;  1BAJ A;  2ITA A;  1SQV G;  3CE7 A;  1SVF A;  1RF1 A;  2FXP A;  2XV5 A;  4U3F G;  5F2N A;  3V6I A;  3L72 G;  2A06 G;  1GL2 C;  2BCC E;  3T97 A;  2KSJ A;  1MFZ A;  3CCU P;  2MJZ A;  4N6J A;  3FWN A;  1JMB A;  3L71 J;  5AVS B;  3WBH A;  1DIP A;  2P9X A;  4QKO A;  4DT0 A;  1PFI A;  1JY3 P;  1T8K A;  2WSC H;  1LWU B;  2QE7 H;  5KTB A;  1LTB C;  1QRJ A;  2WIT A;  2KGA A;  3H4E A;  1P84 D;  4Y28 J;  2KGC A;  3L73 G;  1KQF B;  2O1J A;  2GUS A;  4AUW A;  2MR8 A;  3H1L G;  4COP A;  3W67 A;  2N1T D;  2RMZ A;  2GZG A;  2KLU A;  3VTP C;  4JYB A;  2PAJ A;  1IK9 A;  1QVG O;  3N4X A;  4ZKU A;  2N6Y A;  2FYU D;  1IFD A;  5AVX B;  1K05 A;  3EJD A;  5DCK A;  1JCD A;  3BAS A;  2NZ2 A;  1LGH B;  1N73 B;  1FZA A;  2EG5 A;  3WU2 H;  2B89 A;  1OZH A;  3D71 A;  3MD0 A;  4GOE A;  1MZ8 A;  3AEA C;  2XXM A;  1EZV E;  2QJY B;  2XZR A;  3CXH E;  1LTJ A;  5APW A;  1HWT C;  1URQ A;  2C0X A;  4GIF A;  1RF0 C;  3S4R A;  1NO4 A;  3D6Y A;  2J58 A;  1SQX K;  2JEE A;  1S72 P;  1M1K Q;  2OYH C;  3H6P A;  1HJB A;  1NAY A;  5APQ A;  1OWA A;  3WUU A;  4D6T G;  2BUO A;  1BDD A;  2LKM A;  4KT0 J;  5KLV E;  3AEG C;  1LP1 A;  2GUV A;  1BSN A;  2KNC B;  1HQB A;  4H13 B;  1RNI A;  2KW2 A;  1M7L A;  1KC8 Q;  1PEU A;  1SQV K;  2K5X A;  1PIX A;  2HPC A;  2PEQ A;  2AEF A;  1NU1 G;  4L73 A;  3L75 G;  1BXI A;  2KR5 A;  3OAK A;  3MGN A;  2Q7C A;  5AVR B;  1N7S D;  2L22 A;  1JB0 J;  3H32 A;  3ZDM A;  2LPK A;  1Q86 Q;  1LWU C;  1JTH A;  3BCC G; 
#chains in the Genus database with same CATH homology
 5JPA A;  3M1M A;  1QVF O;  5DCK A;  5HGL A;  1VQK P;  2QA4 P;  4M0I A;  3H0D A;  5HGM A;  3MGE A;  3VRL C;  2DGY A;  1W2B O;  4IPY A;  3G29 A;  3CC7 P;  2EG5 A;  3CCR P;  1M6N A;  3DS2 A;  2QEX P;  2PEK A;  4PH0 A;  1YIT P;  4XRQ A;  4XFY A;  3CC2 P;  2JYL A;  2KOD A;  3P05 A;  4U0C A;  3CPW O;  1D1D A;  3CMA P;  1VQN P;  4U0D A;  3G1G A;  1K9M Q;  1N8R Q;  2XXM A;  4XRO A;  1KD1 Q;  2XT1 A;  3HYB A;  4XFZ A;  1AUM A;  1VQ9 P;  1E6J P;  4U0F A;  2PEN A;  3I56 P;  1KQS O;  1A43 A;  1BAJ A;  2PEJ A;  2Z45 A;  3G71 P;  2M8L A;  3CCL P;  3CD6 P;  4U0B A;  3DS3 A;  3CCQ P;  3G1I A;  2BQ1 E;  3G26 A;  4XFX A;  2OTJ P;  1M90 Q;  1Q7Y Q;  1JJ2 O;  1VQ7 P;  2XV6 A;  3CCS P;  2E1M A;  3RG6 C;  3H47 A;  5F2N A;  1YHQ P;  3G6E P;  3E2D A;  2PEO A;  2Z44 A;  5BS1 A;  4QNB A;  1VQO P;  4U0E A;  2M8P A;  4GR6 A;  3DS4 A;  2Z46 A;  3CCU P;  2CWO A;  1VQP P;  1S72 P;  3Q20 A;  1M1K Q;  1EIA A;  1ZMB A;  1VQL P;  1VQ8 P;  3CCJ P;  3G28 A;  5F2K A;  1YJN P;  3WBH A;  3CC4 P;  2EFJ A;  3CCE P;  1K8A Q;  1K30 A;  2P9X A;  1YJ9 P;  2M8N A;  2JYG A;  2BHV A;  1RO0 A;  3B5I A;  2OAR A;  2BUO A;  3CCV P;  3CXC O;  1VQM P;  1VQ5 P;  1M74 A;  5HGO A;  2ONT A;  2PEI A;  1QRJ A;  4U0A A;  2L6E A;  3G21 A;  1RNI A;  3NTE A;  4WYM A;  4GR2 A;  1PEM A;  3H4E A;  5F2O A;  1KC8 Q;  1PEU A;  1VQ6 P;  3DPH A;  1A8O A;  2OTL P;  1PEQ A;  2EIA A;  3G0V A;  3LRY A;  2PEQ A;  3HZQ A;  1YI2 P;  3DTJ A;  1PEO A;  5I4T G;  2PY8 A;  3CME P;  1RO2 A;  3CCM P;  1Q82 Q;  3OW2 O;  4COP A;  2PEM A;  4PH1 A;  1EOQ A;  1K73 Q;  5HGN A;  1Q81 Q;  1VQ4 P;  3DS1 A;  1QVG O;  1NJI Q;  2LF4 A;  4COC A;  1YIJ P;  5BS2 A;  3DS5 A;  1Q86 Q;  1IUQ A;  3I55 P;  2JO0 A;  1M6E X;  3G4S P;  1YJW P;  3DS0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...