3CMAP

The structure of cca and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
143
structure length
143
Chain Sequence
b'TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Peptidyl-CCA deacylation on the ribosome promoted by induced fit and the O3'-hydroxyl group of A76 of the unacylated A-site tRNA.
pubmed doi rcsb
molecule tags Ribosome
total genus 48
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2008-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3cmaP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 3cmaP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 3cmaP02
1KQSO 3I56P 1W2BO 1VQ8P 1JJ2O 1QVFO 3CCRP 1VQNP 1Q86Q 3CCVP 3CCJP 3CCQP 3CMAP 3I55P 1YI2P 1KD1Q 1VQMP 2OTJP 1YHQP 1YITP 1S72P 1VQ9P 3CC2P 1KC8Q 1YJ9P 1Q7YQ 2QEXP 1VQKP 3CCEP 3CMEP 3CC7P 3G6EP 1Q81Q 1VQOP 1N8RQ 1M1KQ 2OTLP 3CXCO 1VQ4P 1NJIQ 3G71P 1VQPP 1VQ7P 3CCUP 1YIJP 2QA4P 3CCSP 1K8AQ 3CCMP 1YJNP 3G4SP 3OW2O 1YJWP 1VQ6P 3CC4P 1VQ5P 3CD6P 3CPWO 1K9MQ 1M90Q 1K73Q 1QVGO 3CCLP 1VQLP 1Q82Q
chains in the Genus database with same CATH superfamily
2E43A 3CXHD 2D2CB 4I7ZC 1LTJB 1OW7A 2O1KA 3CX5H 4U0BA 5APTA 3L74G 3GF7A 3RL0C 2PEMA 3TSIA 4NPFX 2N1TC 2GDYA 2N6YA 2YIUB 3GZMA 2Q9IA 5KJ7C 3CPWO 3I56P 2FQ1A 4Y99C 4XA4A 3EJDA 3HE4B 3MUDA 1JO5A 1IFMA 2KNCA 2E5YA 3RBZA 2LKIA 4OGQD 1KQLA 2YMYA 2RH0A 1LWUC 3H1HD 1X22A 3B71A 2N98A 1G2CB 4BPFA 2E74D 1N73C 2KODA 3K5BA 2MF4A 2EIAA 1NAFA 1EC5A 4NPEA 2B9BA 1S5LH 3HTKB 3H1KE 1LGHB 1XTCC 1WMKA 2LTEA 1PP9D 2JAZA 3HE5A 2BCCE 2L0QA 1E0HA 2B88A 1UNKA 1SQBK 5K5GB 1BCCJ 1SFCC 3O6QA 5H2FE 4HKGA 3M06A 3A5TA 3M9HA 3V2NA 1KQSO 1N7SB 4H44D 3PRJA 2M5AA 3H4EA 2JP3A 2B89A 2VSQA 1HBWA 1NTKJ 1NTZE 3H1IJ 5CCHC 1AF8A 1E6JP 2G8YA 2BEQD 5B66H 2P7JA 2FADA 2JJLA 3MZWB 2WT7A 2WPTA 4ZKPA 3WUVA 2LIWA 1VF5B 2K9JA 3RG6C 1QEXA 5APWA 4D6TG 1DX7A 2FXPA 1KQGB 3N7NA 3L75J 4U0CA 3AE5C 1CI6A 1DEEG 3JCUE 2JBGA 1Z6MA 1BE3J 1Y47A 2WZ7A 1BGYD 1J1DC 3EFGA 4COPA 5KKZC 1QVFO 2KGAA 1SQXJ 1ZOYC 1NTMJ 3U43A 3CC2P 2GDWA 2A06G 3KDPB 2PGDA 1J1EB 1T8ZA 3TF5A 4WBAA 2KW2A 2KLVA 1NVOA 3WUUA 2L9FA 4IOIH 1NO4A 1EZVG 5APYA 3G9RA 1A02F 3M0DA 1M1JA 4N78D 1SQPJ 1WRGA 4I6MC 2NO8A 1EMVA 4I7ZB 5KAFE 1VQNP 5KAIH 3AE4C 2XU6A 2P10A 1BCCD 2R32A 3NFQA 3CXCO 1P84I 1VQPP 1USDA 5KP8B 3S4RA 5KLVJ 3G3ZA 1FDMA 2KYVA 4M3LA 1FZCA 1LTAC 1LT1A 1NTKD 3B8EB 2K5XA 3N4XA 4DZOA 3CCVP 3H1ID 4Y28J 1YI2P 5F2NA 1X3OA 1L0LE 2E1MA 2LPKA 3IFMA 3HZQA 1VDFA 4GIFA 1P84D 3H47A 1L0NJ 3L72G 2VLNA 2PEIA 1JB0J 2FBWC 4MRTC 3L75D 3MGNA 1PGOA 5AVYB 2HYNA 1HGVA 3M9BA 4XFYA 1BE3D 2HR3A 3IF4A 2QJKB 4OGQB 4LLHA 2YNYA 1ZP0C 1A43A 2Z4EA 2BEZF 1NTMD 1RNIA 2M5AB 3CE7A 4PV1D 3A0BH 4EYYQ 1NTKK 2IZ1A 1JOCA 1RH5B 2PNGA 2XV5A 1UJZA 1LTBC 2PEQA 1LTIC 1SQPD 1L4AC 2WT7B 1QVGO 1VQ8P 2E75D 3CWBG 1OX3A 2XNXA 3P7KA 2R5BA 4H44B 5KLVD 5H2FH 1NU1G 1KB9I 2FFDC 1JY2N 2QJYC 1HQBA 1YIJP 5KKZB 1NTMK 2YO2A 3WBHA 4UB6H 1EQ7A 1M8OB 1N7LA 1YHQP 1GXGA 1Q7YQ 1L0ND 3CMEP 1M1JB 1SQPK 1KB9D 4DT0A 4JPZB 2OYIA 1ZN5A 5CZDB 2Z46A 2WTYA 2WSCH 2M3BA 2FACA 3PJSK 2YKOA 3JCUH 1KILE 5KLVK 1KILC 2Q3IA 1RO0A 2WVRA 3TGUE 2Z44A 2ZAEB 2GM4A 4QKOA 3L74J 4EOTA 1IMQA 4L73A 2YXRB 3B5NC 1GK6A 2FQ0A 3V6IA 4PD4E 3GW6A 2JYLA 1OMIA 1YQ3C 4AQRD 1L0NK 2NZ2A 1VQ7P 5KAFH 2WSEH 5AVXB 4C7NB 2ZVNB 2O1JA 4BPHA 2KIKA 2W27A 2IFNA 2KORA 3BCCE 2A45G 2HPCB 1EDJA 3AE7C 4NEOA 4N6JA 1SQXG 1MFTA 3OA7A 4BWNA 1L0HA 3I55P 3II6A 3S9OA 3D70A 3Q1MA 5AVUB 4WY4D 1KN7A 1Q81Q 4LC1A 2LXBA 1RF1C 1MV8A 1NKZB 3F89A 5B5EE 5AW0B 5I4TG 1JY3O 1IC2A 1KYOI 4YPCA 3AEBC 2IX7C 4XE5B 5GTHE 2KB7P 3B5IA 1HF9A 1SQQD 3CCLP 1JJ2O 4GR6A 2FYUE 3VRLC 1MZ9A 2OTKE 3TK1A 2IDBA 4UB8E 4XFJA 1H0TB 2XV6A 1M1KQ 1DEBA 5HGLA 1OWAA 1X9VA 2C0XA 2D2CC 1LTJC 4R4LA 3HUSA 2KG8A 4DJGA 3B4SA 1M90Q 4WY4A 3AE1C 2M0BA 3NY7B 4OVNF 2YIUC 3AEDC 4PJ0E 3L74D 3RK3D 3L70J 3G6EP 2KK7A 5AW8B 3FX0A 2J5UA 4D6TJ 3SFDC 1H88A 2FAEA 2Y9ZA 4ZNCA 3A0HE 4ASVA 4CPGA 1OXZA 3VP8A 1PEQA 1D1DA 1VPCA 2OYOA 1SQVE 1W5CE 3H1JE 2E75B 1SLQA 1IK7A 3TNUB 2JKVA 3KQGA 2N6ZA 4U0FA 2OYIB 2WITA 1F80D 2P67A 2KLUA 1FS0E 2ONTA 3PTZA 4DG9A 3TDKA 3RK2D 2Z5IA 3U59A 3IAOA 2POHA 3F5HA 1N7SC 2Z5HA 2IZ0A 2HODA 3GHGA 2KR5A 2WPQA 1S4XA 3BCCG 4W80A 2KOPA 3USSA 1FJKA 3SWYA 2QRXA 1KZUB 5JPAA 1FJPA 4JBZA 3V5BA 4WWIA 2P2UA 4TT3H 1URQD 1ZMBA 1YTZT 2ZXXA 2LL8A 3AE6C 2W6JH 1LNQA 2WPVB 5APQA 2RKLA 4XFXA 2E42A 3AE2C 2FYUG 1VQLP 1SP4A 3L72J 4D6TD 3DTJA 4DOJA 1EZVI 1RF1B 2OTJP 2GA1A 3S1KA 3LIDA 1JY3P 1PEOA 1KORA 5KP7B 4PD4H 1KQFB 4COCA 1URQA 2ZJSE 1S9KD 2I1KA 4OH8B 2QNWA 2A06D 3ZDMA 3C1LA 1CZQA 3I5CA 1IFIA 2IBZE 2K3RA 2P58A 5BU5A 3EJEA 1EZVD 3RBXA 4QNBA 2O3JA 2J59M 2JR8A 2YMKA 4WY4B 3SSUA 4EIJA 1SQBD 3DS2A 1VQ6P 1HUCA 4U3FE 1EDLA 1VQ5P 3ITKA 2GZGA 3H1JG 1L2PA 4EI2A 5HGMA 5B5EH 4K35A 3BVHA 2JO1A 2BQ1E 3CWBJ 1M7LA 3CCEP 5GTHH 1OVUA 3G1IA 2JGPA 1NU1J 4R4MA 3CXHE 5TJHA 3CCSP 4UB8H 1A8OA 4H13D 1IFNA 3L73E 3CD6P 2MJZA 2W83C 3P32A 1EOQA 3H1LG 1R5LA 3BASA 1AV1A 2FYZA 2L5GB 2M5RA 3MGEA 2H88C 2I8DA 4PJ0H 3L72D 4UHPB 2O01H 1N73A 2ZYGA 2QJKC 4OGQC 3KZIE 1ZV8A 3H1HE 2QG4A 1X0TA 2HODB 3GHGB 3A0HH 2NPSD 2JYGA 3P8MC 3CMAP 5CBOA 2KS1A 2OGUA 2E74C 1PPJG 3H6PA 2MD9A 1OVVA 1IMPA 2CGQA 2E76D 3EWKA 5CCGD 4YXWH 1RF0A 1SFCA 3ABVC 2K88A 3KXDA 3NTEA 1PP9E 1U7JA 3Q5RA 2XZ0D 2LXCB 2JWDA 3L71E 3IR9A 3L70G 2RN0A 2ITAA 4HJGH 4BXLA 3GZLA 1KFMA 3MD0A 1HTLC 1AVYA 4H44C 2M3EA 3QH9A 2NPSA 3CWBD 3WUTA 1SVFA 2K9YA 2FVFA 2UWJE 1K73Q 1IJDB 1NU1D 4IZ6A 3GJNA 5CCGA 2GUSA 3CCJP 3DS4A 2IFMA 2XXMA 2PEJA 2EHSA 3VMXA 1URQB 1LTSC 4JQ0D 5BS2A 4U3FG 2QM7A 4H2WC 5AW9B 2MY5A 4U0AA 1FBMA 3M0DC 2QIWA 1M1JC 3V2PA 4O9BA 2K0YA 1RO2A 2Y0DA 4TLFA 3EJBA 2N9BA 5BS1A 1BGYE 3CC7P 5F2KA 4RJTA 2MVVA 2ZXEB 3EQ2A 3L73G 1GD2E 2K1AA 3CI9A 2PEKA 5KLIC 2V4HA 5APVA 2KNCB 1ZRTD 2H89C 3VOPA 3G1GA 1NU1K 3H1KG 4N78E 2WSSH 2WMMA 2R3CA 1MZ8A 2A45I 1JM0A 1DV5A 2BCCG 1RE3C 4PXHB 1BCCE 3FGAD 3CC4P 4EDFA 1OVRA 3AEGC 2K92A 2LF4A 1GK4A 2PP6A 2OARA 3HE5B 1NTKE 3R2PA 2KOSA 3GMAA 1NTZG 1CW5A 3H1IE 3O6QB 2V7QH 2ZFCA 1SQXD 1YBKA 1S1CX 4GT1A 4H13B 2E74B 3CXHH 3L71G 4H2XC 2FKWB 1P84E 4BRYA 1HH0A 1PZQA 4ZKUA 1T2KD 2QEXP 5APXA 5AW7B 4WVZA 3L75E 2PENA 2K0XA 1BE3E 2K9JB 3BCCJ 2M8LA 2DGYA 4A7PA 1GTWA 5CMZA 2LMLA 3VN0A 1KFNA 3A2AA 1CI6B 1R5SA 2NPSB 1JCCA 3KZIH 3JSVC 2YO3A 4PV1C 2L6EA 1WT6A 4H2YC 1SQXK 2LOLA 1AJYA 2KOQA 1RQUA 2K0DX 1IO4A 1BGYG 3M9QA 2FYUJ 3AEEC 1FDIA 3LMOA 3CLQA 3VMAA 2XNDH 1FZBA 1GL2D 1AVOA 2E75C 2ZYDA 1D7MA 1KV4A 3PP5A 2H43A 3DS0A 3NTNA 5KLVE 1ZLLA 2OYIC 3G26A 2KXPB 1N2DC 1W2BO 3E7KA 5HV8A 2MKVA 2WQYC 1JY3N 2KWLA 2P9XA 4C7RA 1K04A 5AW3B 1FZFA 1S72P 1L0LG 5C39A 1RE4A 3CX5I 2AXTE 1FZCB 3RGUA 5KLIB 2WWWA 2Z45A 4YTPC 4HH2A 3DPHA 2WSFH 3OW2O 1QLED 1JEKA 1GL2A 2W6AA 5AW2B 2M8NA 1KB9E 1LT9A 3H1JJ 5HGOA 1E5WA 1T3JA 3Q5PA 4NPDA 2VRSA 1HVVA 3BCCD 4U0EA 3CX5D 1L0IA 5APSA 3TYYA 1IFDA 4IL6X 4N3YB 2C9LY 5AVQB 3H1LJ 4RO0A 4I2LC 2PY8A 2W90A 1JMMA 5KP6B 1K8AQ 4MN4C 2L22A 1YJNP 1BDDA 1Y8AA 5E79E 3M91A 2GDXA 3MHVA 1ZXGA 2YKQA 1YTZI 2N5HA 3D6YA 1NHLA 3U1AA 1PV3A 2ZT9D 1NH4A 1FC2C 2GYKA 1EDKA 3HUSC 3M0AA 4WY4C 3VMYA 3SWKA 1FR2A 1MUUA 4I1LA 4PV1B 1FU1A 1SQQE 3PHLA 4RESB 1RY3A 1P84H 2KOGA 1BSHA 2Y0EA 1IFJA 2FYUK 5EFWB 4HYTB 2LIUA 3T97A 1Q82Q 3VTPC 2KI7B 1M74A 2M8RA 1OW8A 1JTHA 3AE3C 5BVZA 1KYOE 3AEAC 3TGUG 3HE4A 1QL1A 3B4QA 2CQ8A 3V4WA 3Q5SA 2LR2A 3L74E 4PH1A 5AVWB 3H1LD 4W7ZA 4U3FJ 4GKGA 3RK3C 3L4FA 5DJUB 1PGPA 1NGMB 2L91A 4H0LD 3CCQP 2HFED 5HGNA 1YITP 2N50A 1JMBA 3GHGC 3HTKA 1GL2B 5DCKA 2N5IA 2CPSA 1S5LX 2K37A 2FVAA 2Q3EA 3L73J 3FXDA 3G28A 1VF5D 2G3AA 1PPJD 1GDTA 2MR7A 1N7SA 3H1KJ 5KTBA 3E1IA 2OTLP 2EHTA 3G0VA 1KMIZ 1S2EA 2KSEA 3RK2C 1EXIA 3DS5A 2BCCJ 1FOSF 4KHXA 2B87A 1T8KA 4U0DA 2AXTH 2K94A 3L70D 5GTIE 2XDJA 2FQ2A 3IN6A 4Z1MH 2JU1A 1VQKP 1YJ9P 2GZEA 3HD7D 3P8CE 3OJAB 1KB9H 1NTZJ 3FWLA 2YXQB 1DNYA 3D6ZA 3MIWA 1URQC 2MR8A 2JEEA 1UIXA 1X79B 1SS1A 3RL0D 5TISE 1IK9A 1YQ4C 1HGZA 1SQQG 3L71J 1M56D 2N1TD 4HKZH 1M57D 5KJ7D 4U3FD 2OYHA 4D6TE 1FZGA 3HUSB 5AW4B 3RG2A 2GUVA 2HLOA 2WSCJ 3NXSA 2Q5UA 1U57A 1G1IA 3HD7A 1SQVG 2FXOA 2AFDA 2JDIH 1ZR2A 2MVUA 2CWOA 1OIPA 1Q86Q 2KSJA 5E79H 3MUDC 1S9KE 2XZ1C 2WSFJ 3L73D 4DCKA 1LTGC 2A06E 1QX8A 1VQ4P 1PEMA 3Q20A 4BPGA 3U1CA 2EG5A 2FHSC 3T97B 2QJPB 2ZT9B 1IUQA 2N1TA 1JTHB 1EZVE 3H1KD 5KJ7A 1NWQA 1H89A 5AW6B 1PEUA 1SQBE 1ZNVA 2BCCD 2WSEJ 1BGYJ 1SFCD 1PFIA 3A0BE 5L8RJ 1LWUA 3RK3B 1ZW0A 1EXJA 4LGDE 2KP8A 1HWTC 3W67A 2CNRA 1EIAA 5CCHD 1NTZD 4AYCA 1W2EA 2KG9A 4L76A 1VQ9P 1E79H 1J2JB 4H13C 1L0LJ 2AEFA 1NYHA 3BRTB 3Q3DA 2Q1KA 3L37A 1KTMA 2AF8A 4JYCA 3L71D 3SFEC 1RF0C 1KYOH 2YKPA 4IFFA 2CG5B 7CEIA 3L72E 2ERHA 2GZJA 4H0LB 2K2QA 1VQMP 2FYNC 3RK2B 1G1JA 1FDOA 2B87B 5APUA 2FY8A 1OR5A 4KT0J 1IFPA 1RQVA 5CCHA 4UB6E 2NPSC 4CA3A 3PLNA 2C9NY 3KHUA 1DD4A 5AVRB 3L35A 2IBZG 1FZAA 2E76C 1S3JA 5CCGC 1NTZK 1BXIA 3KPEA 2XZRA 1M6NA 2ROQA 3LW5H 2AVAA 2M8PA 3P05A 2KGDA 1HY8A 3SWFA 1QRJA 2PRRA 2W8ZA 2KZJA 5AVTB 1JNMA 5AVVB 5AVSB 2QSIA 1AUMA 3LIEA 2Q6QA 2OYHB 3CCRP 3A3YB 3CWBE 4IFMA 1FOSE 2ZVOB 2BHVA 2DNWA 5GTIH 1NU1E 5DJTB 3H25A 3HD7B 1IZNB 2KZIA 2AEMA 3R4YA 2GZFA 1K30A 3V2QA 1FZCC 2L4BA 2J58A 1PL5A 1LJ2A 2OQQA 3VYIA 2Y9YA 4R0MA 1L0LD 1SQBG 2PEOA 4QMAA 1NQ4A 3RL0B 5CHXA 1Q2NA 2N1TB 5TISH 4Y99B 5M1BA 1FE6A 4B86A 2FXMA 1OFCX 2EFJA 3H1HG 5CJ0A 4GODA 3MP7B 4PWVB 1H8AA 1GZLA 3CL3D 2XKMA 2PAJA 1LWUB 4HB1A 1N73B 1ZRTE 1RE3A 3CCUP 3GF3A 3TGUJ 3UIAA 2CPBA 4IPYA 2Y0CA 2KOOA 1UIIA 1PP9G 2H8PD 1DIPA 4C7NA 1X8YA 2KS1B 1L4AD 1Y9BA 1L0LK 1AFOA 1QL2A 1GMJA 3AECC 4JF7A 2HPCA 2H7HA 1A02J 3WU2E 1PGQA 1N86A 1SFCB 3BATA 3H32A 1MKMA 1VL2A 1JUNA 3NMDA 2FYNB 3FWNA 2VLOA 2R5DA 1SQXE 2RMZA 1NTME 1AQ5A 4C46A 3G71P 1L4AA 4F37A 2WPSA 1ZR4A 3V4QA 1H0TA 1T2KC 2E76B 1EDIA 1SQPE 2JQ4A 3O8ZA 1FZEA 2VLQA 2AEJA 3WMM0 1T6AA 2FFDA 4RKUJ 4PD4I 2HG5D 1J1DB 1GU4A 3G21A 1KILD 2JWAA 1R8EA 2CK3H 2P1JA 1M6EX 3C9IA 1CEIA 4IL6E 3EFFK 3TGUD 3W68A 2O01J 3E2DA 1SQQJ 1RE4C 3TNUA 1XTGB 3B5ND 4GR2A 3L36A 1BCCG 4K3AA 4YXDC 4PD4D 1YJWP 1L0NE 2DW3A 2R3SA 1GL2C 5CBNA 1HJ0A 3PH0A 1LT9C 1SQVJ 2FVEA 1NTKG 3Q2YA 4KJMA 1KILA 3M1MA 4WB4A 3A7OA 3H1IG 1GU5A 3AE9C 3G29A 2SPZA 4OWFA 3D71A 1VKUA 1FAVA 3CCMP 1BAJA 3G4SP 4XFZA 2QM8A 2IYPA 3B5NA 1JY2O 1GW3A 2LKMA 1BDCA 4GOFA 3LRYA 1TU3F 2AXCA 1U7MA 3L75G 3GLMA 2JB0A 1BE3G 1ZMEC 1USEA 2FYUD 3BRVB 4BRYB 4PH0A 3LW5J 3KYQA 3CX5E 1NTMG 1NOHA 2VLPA 2D2CD 3HYBA 3H32B 5AW1B 2BASA 1KC8Q 3JC22 3MTUE 1RF1A 2E5TA 1SQPG 1K9MQ 1LP1A 2NRGA 3HRNA 1ACPA 1L4AB 2BUOA 1AYIA 1OW6A 1N8RQ 4L74A 2GZIA 1NJIQ 5KLVG 1Z56A 1RHZB 1PIXA 4M0IA 3H1JD 1SQVD 2KUBA 4W7YA 1LTJA 1S5LE 3GG2A 3WU2H 3AEFC 1MFZA 2XT1A 1KYOD 2C0WA 2QJPC 2IYOA 2ZT9C 2FFDB 4XRQA 2QJYB 1KD1Q 3DS1A 2Q7CA 2A45H 3FXEA 1AQTA 3H0DA 1L0NG 2R44A 3RK3E 1N7SD 1T3UA 1SQQK 2O01N 4ZMDA 5BU8B 1G2CA 2I1JA 1GPJA 3QWOC 2JU2A 2W6BA 2K93A 4IFDK 4ASWA 5F2OA 2KGCA 2V7QJ 1Q90D 5AW5B 5B66E 1LTTC 2QA4P 1DD3A 1YYCA 5AVZB 1SQVK 1LT9B 2X2BA 4GOEA 1KILB 2QE7H 3RL0g 3H1LE 1SQBJ 5EW5E 4XROA 4IL6H 2IBZI 1NKNA 4H0LC 3GKLC 1OZHA 3B5NB 1JY2P 2KG6A 3P8CD 2PFXA 3H1HJ 3V2RA 3VP9A 2WPRA 3AE8C 3E1RA 4GDOA 3OAKA 1PPJE 1VF5C 1GXHA 3DS3A 5HVCA 1JCDA 1VHNA 2JO0A 5CJ4A 5KAIE 2IBZD 1PGJA 1NAYA 2AFEA 1PP9J 3CXHI 3C8VA 3VMZA 4AUWA 4JYBA 1DH3A 3L70E 1HJBA 2OYHC 1KLPA 2IPPA 1VQOP 2QVAA 1BSNA 4U7JA 2KGEA 4WYMA 4L75A 1J1EC 5EJDA 1LP1B 2ZYAA 1GW4A 1K05A 2N9YB 1CSBA 1AA0A 3HD7C 1QGKB
chains in the Genus database with same CATH topology
2PEIA 3DTJA 3CCRP 3G1GA 1PEUA 2JYGA 3CMAP 5F2OA 2OTJP 3RG6C 3LRYA 4XFYA 2BHVA 3G6EP 1RO0A 2OTLP 1PEOA 3G0VA 3G71P 4U0BA 4U0CA 2QA4P 2Z44A 3DS0A 3DS5A 2PEMA 4COCA 1A43A 1K30A 4U0DA 1RNIA 3CC4P 1PEQA 3G26A 3NTEA 3CPWO 4PH0A 1D1DA 1EIAA 3I56P 1W2BO 4COPA 1QVFO 2LF4A 2P9XA 2PEOA 3HYBA 2JYLA 2OARA 1S72P 1VQ9P 3CC2P 1KC8Q 1YJ9P 1VQKP 4U0FA 4XROA 2PEQA 4QNBA 1VQ7P 2Z45A 3CC7P 3DPHA 2KODA 3DS2A 3G21A 2ONTA 3OW2O 1VQ6P 1VQ5P 1K9MQ 1M6EX 2EFJA 1K73Q 1VQ8P 1Q82Q 2EIAA 5HGMA 1M74A 2M8NA 1VQNP 2BQ1E 3CCJP 3I55P 5HGOA 3DS4A 1VQMP 2BUOA 2XXMA 2PEJA 3CCEP 3E2DA 2QEXP 1Q81Q 1N8RQ 3CXCO 1NJIQ 1VQPP 3G1IA 4GR2A 3CCUP 3DS3A 1YIJP 4U0EA 2PENA 5BS2A 4M0IA 4PH1A 3CCSP 2JO0A 5I4TG 1A8OA 4U0AA 4IPYA 1YJWP 3CD6P 2XT1A 3B5IA 2M8LA 2DGYA 3CCLP 5JPAA 1KQSO 1EOQA 1JJ2O 4XRQA 2CWOA 4GR6A 1RO2A 3WBHA 3VRLC 1Q86Q 3CCVP 3CCQP 1YI2P 1KD1Q 1M6NA 3H4EA 1ZMBA 5BS1A 5HGNA 1YHQP 1YITP 2M8PA 2PY8A 1Q7YQ 3MGEA 3M1MA 5F2NA 5F2KA 3CMEP 2XV6A 3DS1A 1VQOP 1M1KQ 2E1MA 3P05A 1QRJA 1VQ4P 3HZQA 1PEMA 3Q20A 5HGLA 2L6EA 4WYMA 2EG5A 5DCKA 3H0DA 3G29A 1E6JP 1K8AQ 3CCMP 3H47A 1BAJA 1YJNP 1IUQA 3G4SP 4XFZA 2PEKA 4XFXA 1M90Q 1AUMA 1QVGO 2Z46A 3G28A 1VQLP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KQS O;  3I56 P;  1W2B O;  1VQ8 P;  1JJ2 O;  1QVF O;  3CCR P;  1VQN P;  1Q86 Q;  3CCV P;  3CCJ P;  3CCQ P;  3CMA P;  3I55 P;  1YI2 P;  1KD1 Q;  1VQM P;  2OTJ P;  1YHQ P;  1YIT P;  1S72 P;  1VQ9 P;  3CC2 P;  1KC8 Q;  1YJ9 P;  1Q7Y Q;  2QEX P;  1VQK P;  3CCE P;  3CME P;  3CC7 P;  3G6E P;  1Q81 Q;  1VQO P;  1N8R Q;  1M1K Q;  2OTL P;  3CXC O;  1VQ4 P;  1NJI Q;  3G71 P;  1VQP P;  1VQ7 P;  3CCU P;  1YIJ P;  2QA4 P;  3CCS P;  1K8A Q;  3CCM P;  1YJN P;  3G4S P;  3OW2 O;  1YJW P;  1VQ6 P;  3CC4 P;  1VQ5 P;  3CD6 P;  3CPW O;  1K9M Q;  1M90 Q;  1K73 Q;  1QVG O;  3CCL P;  1VQL P;  1Q82 Q; 
#chains in the Genus database with same CATH topology
 2E43 A;  3CXH D;  2D2C B;  4I7Z C;  1LTJ B;  1OW7 A;  2O1K A;  3CX5 H;  4U0B A;  5APT A;  3L74 G;  3GF7 A;  3RL0 C;  2PEM A;  3TSI A;  4NPF X;  2N1T C;  2GDY A;  2N6Y A;  2YIU B;  3GZM A;  2Q9I A;  5KJ7 C;  3CPW O;  3I56 P;  2FQ1 A;  4Y99 C;  4XA4 A;  3EJD A;  3HE4 B;  3MUD A;  1JO5 A;  1IFM A;  2KNC A;  2E5Y A;  3RBZ A;  2LKI A;  4OGQ D;  1KQL A;  2YMY A;  2RH0 A;  1LWU C;  3H1H D;  1X22 A;  3B71 A;  2N98 A;  1G2C B;  4BPF A;  2E74 D;  1N73 C;  2KOD A;  3K5B A;  2MF4 A;  2EIA A;  1NAF A;  1EC5 A;  4NPE A;  2B9B A;  1S5L H;  3HTK B;  3H1K E;  1LGH B;  1XTC C;  1WMK A;  2LTE A;  1PP9 D;  2JAZ A;  3HE5 A;  2BCC E;  2L0Q A;  1E0H A;  2B88 A;  1UNK A;  1SQB K;  5K5G B;  1BCC J;  1SFC C;  3O6Q A;  5H2F E;  4HKG A;  3M06 A;  3A5T A;  3M9H A;  3V2N A;  1KQS O;  1N7S B;  4H44 D;  3PRJ A;  2M5A A;  3H4E A;  2JP3 A;  2B89 A;  2VSQ A;  1HBW A;  1NTK J;  1NTZ E;  3H1I J;  5CCH C;  1AF8 A;  1E6J P;  2G8Y A;  2BEQ D;  5B66 H;  2P7J A;  2FAD A;  2JJL A;  3MZW B;  2WT7 A;  2WPT A;  4ZKP A;  3WUV A;  2LIW A;  1VF5 B;  2K9J A;  3RG6 C;  1QEX A;  5APW A;  4D6T G;  1DX7 A;  2FXP A;  1KQG B;  3N7N A;  3L75 J;  4U0C A;  3AE5 C;  1CI6 A;  1DEE G;  3JCU E;  2JBG A;  1Z6M A;  1BE3 J;  1Y47 A;  2WZ7 A;  1BGY D;  1J1D C;  3EFG A;  4COP A;  5KKZ C;  1QVF O;  2KGA A;  1SQX J;  1ZOY C;  1NTM J;  3U43 A;  3CC2 P;  2GDW A;  2A06 G;  3KDP B;  2PGD A;  1J1E B;  1T8Z A;  3TF5 A;  4WBA A;  2KW2 A;  2KLV A;  1NVO A;  3WUU A;  2L9F A;  4IOI H;  1NO4 A;  1EZV G;  5APY A;  3G9R A;  1A02 F;  3M0D A;  1M1J A;  4N78 D;  1SQP J;  1WRG A;  4I6M C;  2NO8 A;  1EMV A;  4I7Z B;  5KAF E;  1VQN P;  5KAI H;  3AE4 C;  2XU6 A;  2P10 A;  1BCC D;  2R32 A;  3NFQ A;  3CXC O;  1P84 I;  1VQP P;  1USD A;  5KP8 B;  3S4R A;  5KLV J;  3G3Z A;  1FDM A;  2KYV A;  4M3L A;  1FZC A;  1LTA C;  1LT1 A;  1NTK D;  3B8E B;  2K5X A;  3N4X A;  4DZO A;  3CCV P;  3H1I D;  4Y28 J;  1YI2 P;  5F2N A;  1X3O A;  1L0L E;  2E1M A;  2LPK A;  3IFM A;  3HZQ A;  1VDF A;  4GIF A;  1P84 D;  3H47 A;  1L0N J;  3L72 G;  2VLN A;  2PEI A;  1JB0 J;  2FBW C;  4MRT C;  3L75 D;  3MGN A;  1PGO A;  5AVY B;  2HYN A;  1HGV A;  3M9B A;  4XFY A;  1BE3 D;  2HR3 A;  3IF4 A;  2QJK B;  4OGQ B;  4LLH A;  2YNY A;  1ZP0 C;  1A43 A;  2Z4E A;  2BEZ F;  1NTM D;  1RNI A;  2M5A B;  3CE7 A;  4PV1 D;  3A0B H;  4EYY Q;  1NTK K;  2IZ1 A;  1JOC A;  1RH5 B;  2PNG A;  2XV5 A;  1UJZ A;  1LTB C;  2PEQ A;  1LTI C;  1SQP D;  1L4A C;  2WT7 B;  1QVG O;  1VQ8 P;  2E75 D;  3CWB G;  1OX3 A;  2XNX A;  3P7K A;  2R5B A;  4H44 B;  5KLV D;  5H2F H;  1NU1 G;  1KB9 I;  2FFD C;  1JY2 N;  2QJY C;  1HQB A;  1YIJ P;  5KKZ B;  1NTM K;  2YO2 A;  3WBH A;  4UB6 H;  1EQ7 A;  1M8O B;  1N7L A;  1YHQ P;  1GXG A;  1Q7Y Q;  1L0N D;  3CME P;  1M1J B;  1SQP K;  1KB9 D;  4DT0 A;  4JPZ B;  2OYI A;  1ZN5 A;  5CZD B;  2Z46 A;  2WTY A;  2WSC H;  2M3B A;  2FAC A;  3PJS K;  2YKO A;  3JCU H;  1KIL E;  5KLV K;  1KIL C;  2Q3I A;  1RO0 A;  2WVR A;  3TGU E;  2Z44 A;  2ZAE B;  2GM4 A;  4QKO A;  3L74 J;  4EOT A;  1IMQ A;  4L73 A;  2YXR B;  3B5N C;  1GK6 A;  2FQ0 A;  3V6I A;  4PD4 E;  3GW6 A;  2JYL A;  1OMI A;  1YQ3 C;  4AQR D;  1L0N K;  2NZ2 A;  1VQ7 P;  5KAF H;  2WSE H;  5AVX B;  4C7N B;  2ZVN B;  2O1J A;  4BPH A;  2KIK A;  2W27 A;  2IFN A;  2KOR A;  3BCC E;  2A45 G;  2HPC B;  1EDJ A;  3AE7 C;  4NEO A;  4N6J A;  1SQX G;  1MFT A;  3OA7 A;  4BWN A;  1L0H A;  3I55 P;  3II6 A;  3S9O A;  3D70 A;  3Q1M A;  5AVU B;  4WY4 D;  1KN7 A;  1Q81 Q;  4LC1 A;  2LXB A;  1RF1 C;  1MV8 A;  1NKZ B;  3F89 A;  5B5E E;  5AW0 B;  5I4T G;  1JY3 O;  1IC2 A;  1KYO I;  4YPC A;  3AEB C;  2IX7 C;  4XE5 B;  5GTH E;  2KB7 P;  3B5I A;  1HF9 A;  1SQQ D;  3CCL P;  1JJ2 O;  4GR6 A;  2FYU E;  3VRL C;  1MZ9 A;  2OTK E;  3TK1 A;  2IDB A;  4UB8 E;  4XFJ A;  1H0T B;  2XV6 A;  1M1K Q;  1DEB A;  5HGL A;  1OWA A;  1X9V A;  2C0X A;  2D2C C;  1LTJ C;  4R4L A;  3HUS A;  2KG8 A;  4DJG A;  3B4S A;  1M90 Q;  4WY4 A;  3AE1 C;  2M0B A;  3NY7 B;  4OVN F;  2YIU C;  3AED C;  4PJ0 E;  3L74 D;  3RK3 D;  3L70 J;  3G6E P;  2KK7 A;  5AW8 B;  3FX0 A;  2J5U A;  4D6T J;  3SFD C;  1H88 A;  2FAE A;  2Y9Z A;  4ZNC A;  3A0H E;  4ASV A;  4CPG A;  1OXZ A;  3VP8 A;  1PEQ A;  1D1D A;  1VPC A;  2OYO A;  1SQV E;  1W5C E;  3H1J E;  2E75 B;  1SLQ A;  1IK7 A;  3TNU B;  2JKV A;  3KQG A;  2N6Z A;  4U0F A;  2OYI B;  2WIT A;  1F80 D;  2P67 A;  2KLU A;  1FS0 E;  2ONT A;  3PTZ A;  4DG9 A;  3TDK A;  3RK2 D;  2Z5I A;  3U59 A;  3IAO A;  2POH A;  3F5H A;  1N7S C;  2Z5H A;  2IZ0 A;  2HOD A;  3GHG A;  2KR5 A;  2WPQ A;  1S4X A;  3BCC G;  4W80 A;  2KOP A;  3USS A;  1FJK A;  3SWY A;  2QRX A;  1KZU B;  5JPA A;  1FJP A;  4JBZ A;  3V5B A;  4WWI A;  2P2U A;  4TT3 H;  1URQ D;  1ZMB A;  1YTZ T;  2ZXX A;  2LL8 A;  3AE6 C;  2W6J H;  1LNQ A;  2WPV B;  5APQ A;  2RKL A;  4XFX A;  2E42 A;  3AE2 C;  2FYU G;  1VQL P;  1SP4 A;  3L72 J;  4D6T D;  3DTJ A;  4DOJ A;  1EZV I;  1RF1 B;  2OTJ P;  2GA1 A;  3S1K A;  3LID A;  1JY3 P;  1PEO A;  1KOR A;  5KP7 B;  4PD4 H;  1KQF B;  4COC A;  1URQ A;  2ZJS E;  1S9K D;  2I1K A;  4OH8 B;  2QNW A;  2A06 D;  3ZDM A;  3C1L A;  1CZQ A;  3I5C A;  1IFI A;  2IBZ E;  2K3R A;  2P58 A;  5BU5 A;  3EJE A;  1EZV D;  3RBX A;  4QNB A;  2O3J A;  2J59 M;  2JR8 A;  2YMK A;  4WY4 B;  3SSU A;  4EIJ A;  1SQB D;  3DS2 A;  1VQ6 P;  1HUC A;  4U3F E;  1EDL A;  1VQ5 P;  3ITK A;  2GZG A;  3H1J G;  1L2P A;  4EI2 A;  5HGM A;  5B5E H;  4K35 A;  3BVH A;  2JO1 A;  2BQ1 E;  3CWB J;  1M7L A;  3CCE P;  5GTH H;  1OVU A;  3G1I A;  2JGP A;  1NU1 J;  4R4M A;  3CXH E;  5TJH A;  3CCS P;  4UB8 H;  1A8O A;  4H13 D;  1IFN A;  3L73 E;  3CD6 P;  2MJZ A;  2W83 C;  3P32 A;  1EOQ A;  3H1L G;  1R5L A;  3BAS A;  1AV1 A;  2FYZ A;  2L5G B;  2M5R A;  3MGE A;  2H88 C;  2I8D A;  4PJ0 H;  3L72 D;  4UHP B;  2O01 H;  1N73 A;  2ZYG A;  2QJK C;  4OGQ C;  3KZI E;  1ZV8 A;  3H1H E;  2QG4 A;  1X0T A;  2HOD B;  3GHG B;  3A0H H;  2NPS D;  2JYG A;  3P8M C;  3CMA P;  5CBO A;  2KS1 A;  2OGU A;  2E74 C;  1PPJ G;  3H6P A;  2MD9 A;  1OVV A;  1IMP A;  2CGQ A;  2E76 D;  3EWK A;  5CCG D;  4YXW H;  1RF0 A;  1SFC A;  3ABV C;  2K88 A;  3KXD A;  3NTE A;  1PP9 E;  1U7J A;  3Q5R A;  2XZ0 D;  2LXC B;  2JWD A;  3L71 E;  3IR9 A;  3L70 G;  2RN0 A;  2ITA A;  4HJG H;  4BXL A;  3GZL A;  1KFM A;  3MD0 A;  1HTL C;  1AVY A;  4H44 C;  2M3E A;  3QH9 A;  2NPS A;  3CWB D;  3WUT A;  1SVF A;  2K9Y A;  2FVF A;  2UWJ E;  1K73 Q;  1IJD B;  1NU1 D;  4IZ6 A;  3GJN A;  5CCG A;  2GUS A;  3CCJ P;  3DS4 A;  2IFM A;  2XXM A;  2PEJ A;  2EHS A;  3VMX A;  1URQ B;  1LTS C;  4JQ0 D;  5BS2 A;  4U3F G;  2QM7 A;  4H2W C;  5AW9 B;  2MY5 A;  4U0A A;  1FBM A;  3M0D C;  2QIW A;  1M1J C;  3V2P A;  4O9B A;  2K0Y A;  1RO2 A;  2Y0D A;  4TLF A;  3EJB A;  2N9B A;  5BS1 A;  1BGY E;  3CC7 P;  5F2K A;  4RJT A;  2MVV A;  2ZXE B;  3EQ2 A;  3L73 G;  1GD2 E;  2K1A A;  3CI9 A;  2PEK A;  5KLI C;  2V4H A;  5APV A;  2KNC B;  1ZRT D;  2H89 C;  3VOP A;  3G1G A;  1NU1 K;  3H1K G;  4N78 E;  2WSS H;  2WMM A;  2R3C A;  1MZ8 A;  2A45 I;  1JM0 A;  1DV5 A;  2BCC G;  1RE3 C;  4PXH B;  1BCC E;  3FGA D;  3CC4 P;  4EDF A;  1OVR A;  3AEG C;  2K92 A;  2LF4 A;  1GK4 A;  2PP6 A;  2OAR A;  3HE5 B;  1NTK E;  3R2P A;  2KOS A;  3GMA A;  1NTZ G;  1CW5 A;  3H1I E;  3O6Q B;  2V7Q H;  2ZFC A;  1SQX D;  1YBK A;  1S1C X;  4GT1 A;  4H13 B;  2E74 B;  3CXH H;  3L71 G;  4H2X C;  2FKW B;  1P84 E;  4BRY A;  1HH0 A;  1PZQ A;  4ZKU A;  1T2K D;  2QEX P;  5APX A;  5AW7 B;  4WVZ A;  3L75 E;  2PEN A;  2K0X A;  1BE3 E;  2K9J B;  3BCC J;  2M8L A;  2DGY A;  4A7P A;  1GTW A;  5CMZ A;  2LML A;  3VN0 A;  1KFN A;  3A2A A;  1CI6 B;  1R5S A;  2NPS B;  1JCC A;  3KZI H;  3JSV C;  2YO3 A;  4PV1 C;  2L6E A;  1WT6 A;  4H2Y C;  1SQX K;  2LOL A;  1AJY A;  2KOQ A;  1RQU A;  2K0D X;  1IO4 A;  1BGY G;  3M9Q A;  2FYU J;  3AEE C;  1FDI A;  3LMO A;  3CLQ A;  3VMA A;  2XND H;  1FZB A;  1GL2 D;  1AVO A;  2E75 C;  2ZYD A;  1D7M A;  1KV4 A;  3PP5 A;  2H43 A;  3DS0 A;  3NTN A;  5KLV E;  1ZLL A;  2OYI C;  3G26 A;  2KXP B;  1N2D C;  1W2B O;  3E7K A;  5HV8 A;  2MKV A;  2WQY C;  1JY3 N;  2KWL A;  2P9X A;  4C7R A;  1K04 A;  5AW3 B;  1FZF A;  1S72 P;  1L0L G;  5C39 A;  1RE4 A;  3CX5 I;  2AXT E;  1FZC B;  3RGU A;  5KLI B;  2WWW A;  2Z45 A;  4YTP C;  4HH2 A;  3DPH A;  2WSF H;  3OW2 O;  1QLE D;  1JEK A;  1GL2 A;  2W6A A;  5AW2 B;  2M8N A;  1KB9 E;  1LT9 A;  3H1J J;  5HGO A;  1E5W A;  1T3J A;  3Q5P A;  4NPD A;  2VRS A;  1HVV A;  3BCC D;  4U0E A;  3CX5 D;  1L0I A;  5APS A;  3TYY A;  1IFD A;  4IL6 X;  4N3Y B;  2C9L Y;  5AVQ B;  3H1L J;  4RO0 A;  4I2L C;  2PY8 A;  2W90 A;  1JMM A;  5KP6 B;  1K8A Q;  4MN4 C;  2L22 A;  1YJN P;  1BDD A;  1Y8A A;  5E79 E;  3M91 A;  2GDX A;  3MHV A;  1ZXG A;  2YKQ A;  1YTZ I;  2N5H A;  3D6Y A;  1NHL A;  3U1A A;  1PV3 A;  2ZT9 D;  1NH4 A;  1FC2 C;  2GYK A;  1EDK A;  3HUS C;  3M0A A;  4WY4 C;  3VMY A;  3SWK A;  1FR2 A;  1MUU A;  4I1L A;  4PV1 B;  1FU1 A;  1SQQ E;  3PHL A;  4RES B;  1RY3 A;  1P84 H;  2KOG A;  1BSH A;  2Y0E A;  1IFJ A;  2FYU K;  5EFW B;  4HYT B;  2LIU A;  3T97 A;  1Q82 Q;  3VTP C;  2KI7 B;  1M74 A;  2M8R A;  1OW8 A;  1JTH A;  3AE3 C;  5BVZ A;  1KYO E;  3AEA C;  3TGU G;  3HE4 A;  1QL1 A;  3B4Q A;  2CQ8 A;  3V4W A;  3Q5S A;  2LR2 A;  3L74 E;  4PH1 A;  5AVW B;  3H1L D;  4W7Z A;  4U3F J;  4GKG A;  3RK3 C;  3L4F A;  5DJU B;  1PGP A;  1NGM B;  2L91 A;  4H0L D;  3CCQ P;  2HFE D;  5HGN A;  1YIT P;  2N50 A;  1JMB A;  3GHG C;  3HTK A;  1GL2 B;  5DCK A;  2N5I A;  2CPS A;  1S5L X;  2K37 A;  2FVA A;  2Q3E A;  3L73 J;  3FXD A;  3G28 A;  1VF5 D;  2G3A A;  1PPJ D;  1GDT A;  2MR7 A;  1N7S A;  3H1K J;  5KTB A;  3E1I A;  2OTL P;  2EHT A;  3G0V A;  1KMI Z;  1S2E A;  2KSE A;  3RK2 C;  1EXI A;  3DS5 A;  2BCC J;  1FOS F;  4KHX A;  2B87 A;  1T8K A;  4U0D A;  2AXT H;  2K94 A;  3L70 D;  5GTI E;  2XDJ A;  2FQ2 A;  3IN6 A;  4Z1M H;  2JU1 A;  1VQK P;  1YJ9 P;  2GZE A;  3HD7 D;  3P8C E;  3OJA B;  1KB9 H;  1NTZ J;  3FWL A;  2YXQ B;  1DNY A;  3D6Z A;  3MIW A;  1URQ C;  2MR8 A;  2JEE A;  1UIX A;  1X79 B;  1SS1 A;  3RL0 D;  5TIS E;  1IK9 A;  1YQ4 C;  1HGZ A;  1SQQ G;  3L71 J;  1M56 D;  2N1T D;  4HKZ H;  1M57 D;  5KJ7 D;  4U3F D;  2OYH A;  4D6T E;  1FZG A;  3HUS B;  5AW4 B;  3RG2 A;  2GUV A;  2HLO A;  2WSC J;  3NXS A;  2Q5U A;  1U57 A;  1G1I A;  3HD7 A;  1SQV G;  2FXO A;  2AFD A;  2JDI H;  1ZR2 A;  2MVU A;  2CWO A;  1OIP A;  1Q86 Q;  2KSJ A;  5E79 H;  3MUD C;  1S9K E;  2XZ1 C;  2WSF J;  3L73 D;  4DCK A;  1LTG C;  2A06 E;  1QX8 A;  1VQ4 P;  1PEM A;  3Q20 A;  4BPG A;  3U1C A;  2EG5 A;  2FHS C;  3T97 B;  2QJP B;  2ZT9 B;  1IUQ A;  2N1T A;  1JTH B;  1EZV E;  3H1K D;  5KJ7 A;  1NWQ A;  1H89 A;  5AW6 B;  1PEU A;  1SQB E;  1ZNV A;  2BCC D;  2WSE J;  1BGY J;  1SFC D;  1PFI A;  3A0B E;  5L8R J;  1LWU A;  3RK3 B;  1ZW0 A;  1EXJ A;  4LGD E;  2KP8 A;  1HWT C;  3W67 A;  2CNR A;  1EIA A;  5CCH D;  1NTZ D;  4AYC A;  1W2E A;  2KG9 A;  4L76 A;  1VQ9 P;  1E79 H;  1J2J B;  4H13 C;  1L0L J;  2AEF A;  1NYH A;  3BRT B;  3Q3D A;  2Q1K A;  3L37 A;  1KTM A;  2AF8 A;  4JYC A;  3L71 D;  3SFE C;  1RF0 C;  1KYO H;  2YKP A;  4IFF A;  2CG5 B;  7CEI A;  3L72 E;  2ERH A;  2GZJ A;  4H0L B;  2K2Q A;  1VQM P;  2FYN C;  3RK2 B;  1G1J A;  1FDO A;  2B87 B;  5APU A;  2FY8 A;  1OR5 A;  4KT0 J;  1IFP A;  1RQV A;  5CCH A;  4UB6 E;  2NPS C;  4CA3 A;  3PLN A;  2C9N Y;  3KHU A;  1DD4 A;  5AVR B;  3L35 A;  2IBZ G;  1FZA A;  2E76 C;  1S3J A;  5CCG C;  1NTZ K;  1BXI A;  3KPE A;  2XZR A;  1M6N A;  2ROQ A;  3LW5 H;  2AVA A;  2M8P A;  3P05 A;  2KGD A;  1HY8 A;  3SWF A;  1QRJ A;  2PRR A;  2W8Z A;  2KZJ A;  5AVT B;  1JNM A;  5AVV B;  5AVS B;  2QSI A;  1AUM A;  3LIE A;  2Q6Q A;  2OYH B;  3CCR P;  3A3Y B;  3CWB E;  4IFM A;  1FOS E;  2ZVO B;  2BHV A;  2DNW A;  5GTI H;  1NU1 E;  5DJT B;  3H25 A;  3HD7 B;  1IZN B;  2KZI A;  2AEM A;  3R4Y A;  2GZF A;  1K30 A;  3V2Q A;  1FZC C;  2L4B A;  2J58 A;  1PL5 A;  1LJ2 A;  2OQQ A;  3VYI A;  2Y9Y A;  4R0M A;  1L0L D;  1SQB G;  2PEO A;  4QMA A;  1NQ4 A;  3RL0 B;  5CHX A;  1Q2N A;  2N1T B;  5TIS H;  4Y99 B;  5M1B A;  1FE6 A;  4B86 A;  2FXM A;  1OFC X;  2EFJ A;  3H1H G;  5CJ0 A;  4GOD A;  3MP7 B;  4PWV B;  1H8A A;  1GZL A;  3CL3 D;  2XKM A;  2PAJ A;  1LWU B;  4HB1 A;  1N73 B;  1ZRT E;  1RE3 A;  3CCU P;  3GF3 A;  3TGU J;  3UIA A;  2CPB A;  4IPY A;  2Y0C A;  2KOO A;  1UII A;  1PP9 G;  2H8P D;  1DIP A;  4C7N A;  1X8Y A;  2KS1 B;  1L4A D;  1Y9B A;  1L0L K;  1AFO A;  1QL2 A;  1GMJ A;  3AEC C;  4JF7 A;  2HPC A;  2H7H A;  1A02 J;  3WU2 E;  1PGQ A;  1N86 A;  1SFC B;  3BAT A;  3H32 A;  1MKM A;  1VL2 A;  1JUN A;  3NMD A;  2FYN B;  3FWN A;  2VLO A;  2R5D A;  1SQX E;  2RMZ A;  1NTM E;  1AQ5 A;  4C46 A;  3G71 P;  1L4A A;  4F37 A;  2WPS A;  1ZR4 A;  3V4Q A;  1H0T A;  1T2K C;  2E76 B;  1EDI A;  1SQP E;  2JQ4 A;  3O8Z A;  1FZE A;  2VLQ A;  2AEJ A;  3WMM 0;  1T6A A;  2FFD A;  4RKU J;  4PD4 I;  2HG5 D;  1J1D B;  1GU4 A;  3G21 A;  1KIL D;  2JWA A;  1R8E A;  2CK3 H;  2P1J A;  1M6E X;  3C9I A;  1CEI A;  4IL6 E;  3EFF K;  3TGU D;  3W68 A;  2O01 J;  3E2D A;  1SQQ J;  1RE4 C;  3TNU A;  1XTG B;  3B5N D;  4GR2 A;  3L36 A;  1BCC G;  4K3A A;  4YXD C;  4PD4 D;  1YJW P;  1L0N E;  2DW3 A;  2R3S A;  1GL2 C;  5CBN A;  1HJ0 A;  3PH0 A;  1LT9 C;  1SQV J;  2FVE A;  1NTK G;  3Q2Y A;  4KJM A;  1KIL A;  3M1M A;  4WB4 A;  3A7O A;  3H1I G;  1GU5 A;  3AE9 C;  3G29 A;  2SPZ A;  4OWF A;  3D71 A;  1VKU A;  1FAV A;  3CCM P;  1BAJ A;  3G4S P;  4XFZ A;  2QM8 A;  2IYP A;  3B5N A;  1JY2 O;  1GW3 A;  2LKM A;  1BDC A;  4GOF A;  3LRY A;  1TU3 F;  2AXC A;  1U7M A;  3L75 G;  3GLM A;  2JB0 A;  1BE3 G;  1ZME C;  1USE A;  2FYU D;  3BRV B;  4BRY B;  4PH0 A;  3LW5 J;  3KYQ A;  3CX5 E;  1NTM G;  1NOH A;  2VLP A;  2D2C D;  3HYB A;  3H32 B;  5AW1 B;  2BAS A;  1KC8 Q;  3JC2 2;  3MTU E;  1RF1 A;  2E5T A;  1SQP G;  1K9M Q;  1LP1 A;  2NRG A;  3HRN A;  1ACP A;  1L4A B;  2BUO A;  1AYI A;  1OW6 A;  1N8R Q;  4L74 A;  2GZI A;  1NJI Q;  5KLV G;  1Z56 A;  1RHZ B;  1PIX A;  4M0I A;  3H1J D;  1SQV D;  2KUB A;  4W7Y A;  1LTJ A;  1S5L E;  3GG2 A;  3WU2 H;  3AEF C;  1MFZ A;  2XT1 A;  1KYO D;  2C0W A;  2QJP C;  2IYO A;  2ZT9 C;  2FFD B;  4XRQ A;  2QJY B;  1KD1 Q;  3DS1 A;  2Q7C A;  2A45 H;  3FXE A;  1AQT A;  3H0D A;  1L0N G;  2R44 A;  3RK3 E;  1N7S D;  1T3U A;  1SQQ K;  2O01 N;  4ZMD A;  5BU8 B;  1G2C A;  2I1J A;  1GPJ A;  3QWO C;  2JU2 A;  2W6B A;  2K93 A;  4IFD K;  4ASW A;  5F2O A;  2KGC A;  2V7Q J;  1Q90 D;  5AW5 B;  5B66 E;  1LTT C;  2QA4 P;  1DD3 A;  1YYC A;  5AVZ B;  1SQV K;  1LT9 B;  2X2B A;  4GOE A;  1KIL B;  2QE7 H;  3RL0 g;  3H1L E;  1SQB J;  5EW5 E;  4XRO A;  4IL6 H;  2IBZ I;  1NKN A;  4H0L C;  3GKL C;  1OZH A;  3B5N B;  1JY2 P;  2KG6 A;  3P8C D;  2PFX A;  3H1H J;  3V2R A;  3VP9 A;  2WPR A;  3AE8 C;  3E1R A;  4GDO A;  3OAK A;  1PPJ E;  1VF5 C;  1GXH A;  3DS3 A;  5HVC A;  1JCD A;  1VHN A;  2JO0 A;  5CJ4 A;  5KAI E;  2IBZ D;  1PGJ A;  1NAY A;  2AFE A;  1PP9 J;  3CXH I;  3C8V A;  3VMZ A;  4AUW A;  4JYB A;  1DH3 A;  3L70 E;  1HJB A;  2OYH C;  1KLP A;  2IPP A;  1VQO P;  2QVA A;  1BSN A;  4U7J A;  2KGE A;  4WYM A;  4L75 A;  1J1E C;  5EJD A;  1LP1 B;  2ZYA A;  1GW4 A;  1K05 A;  2N9Y B;  1CSB A;  1AA0 A;  3HD7 C;  1QGK B; 
#chains in the Genus database with same CATH homology
 2PEI A;  3DTJ A;  3CCR P;  3G1G A;  1PEU A;  2JYG A;  3CMA P;  5F2O A;  2OTJ P;  3RG6 C;  3LRY A;  4XFY A;  2BHV A;  3G6E P;  1RO0 A;  2OTL P;  1PEO A;  3G0V A;  3G71 P;  4U0B A;  4U0C A;  2QA4 P;  2Z44 A;  3DS0 A;  3DS5 A;  2PEM A;  4COC A;  1A43 A;  1K30 A;  4U0D A;  1RNI A;  3CC4 P;  1PEQ A;  3G26 A;  3NTE A;  3CPW O;  4PH0 A;  1D1D A;  1EIA A;  3I56 P;  1W2B O;  4COP A;  1QVF O;  2LF4 A;  2P9X A;  2PEO A;  3HYB A;  2JYL A;  2OAR A;  1S72 P;  1VQ9 P;  3CC2 P;  1KC8 Q;  1YJ9 P;  1VQK P;  4U0F A;  4XRO A;  2PEQ A;  4QNB A;  1VQ7 P;  2Z45 A;  3CC7 P;  3DPH A;  2KOD A;  3DS2 A;  3G21 A;  2ONT A;  3OW2 O;  1VQ6 P;  1VQ5 P;  1K9M Q;  1M6E X;  2EFJ A;  1K73 Q;  1VQ8 P;  1Q82 Q;  2EIA A;  5HGM A;  1M74 A;  2M8N A;  1VQN P;  2BQ1 E;  3CCJ P;  3I55 P;  5HGO A;  3DS4 A;  1VQM P;  2BUO A;  2XXM A;  2PEJ A;  3CCE P;  3E2D A;  2QEX P;  1Q81 Q;  1N8R Q;  3CXC O;  1NJI Q;  1VQP P;  3G1I A;  4GR2 A;  3CCU P;  3DS3 A;  1YIJ P;  4U0E A;  2PEN A;  5BS2 A;  4M0I A;  4PH1 A;  3CCS P;  2JO0 A;  5I4T G;  1A8O A;  4U0A A;  4IPY A;  1YJW P;  3CD6 P;  2XT1 A;  3B5I A;  2M8L A;  2DGY A;  3CCL P;  5JPA A;  1KQS O;  1EOQ A;  1JJ2 O;  4XRQ A;  2CWO A;  4GR6 A;  1RO2 A;  3WBH A;  3VRL C;  1Q86 Q;  3CCV P;  3CCQ P;  1YI2 P;  1KD1 Q;  1M6N A;  3H4E A;  1ZMB A;  5BS1 A;  5HGN A;  1YHQ P;  1YIT P;  2M8P A;  2PY8 A;  1Q7Y Q;  3MGE A;  3M1M A;  5F2N A;  5F2K A;  3CME P;  2XV6 A;  3DS1 A;  1VQO P;  1M1K Q;  2E1M A;  3P05 A;  1QRJ A;  1VQ4 P;  3HZQ A;  1PEM A;  3Q20 A;  5HGL A;  2L6E A;  4WYM A;  2EG5 A;  5DCK A;  3H0D A;  3G29 A;  1E6J P;  1K8A Q;  3CCM P;  3H47 A;  1BAJ A;  1YJN P;  1IUQ A;  3G4S P;  4XFZ A;  2PEK A;  4XFX A;  1M90 Q;  1AUM A;  1QVG O;  2Z46 A;  3G28 A;  1VQL P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...