3CMAP

The structure of cca and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
publication title Peptidyl-CCA deacylation on the ribosome promoted by induced fit and the O3'-hydroxyl group of A76 of the unacylated A-site tRNA.
pubmed doi rcsb
total genus 48
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2008-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3cmaP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 3cmaP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 3cmaP02
1JJ2O 1QVFO 1S72P 1Q81Q 1YHQP 1K9MQ 3CCUP 1KC8Q 1VQ8P 3CCMP 1YJWP 3G6EP 3CCVP 3CCSP 3CMAP 3CCJP 3CC4P 1YIJP 2QA4P 1Q7YQ 2QEXP 1KQSO 3CC7P 2OTLP 1VQNP 1M90Q 1NJIQ 3CXCO 1K8AQ 1Q82Q 1VQ9P 3CCRP 1VQ5P 1VQ4P 3CCLP 1VQLP 1K73Q 3CCEP 1YI2P 1VQKP 3I56P 1VQMP 1VQPP 3G71P 2OTJP 1Q86Q 1YJNP 1VQ6P 1N8RQ 3CPWO 3CC2P 3CD6P 1YJ9P 1KD1Q 3CCQP 1QVGO 3OW2O 3CMEP 1YITP 1W2BO 1VQ7P 1M1KQ 1VQOP 3I55P 3G4SP
chains in the Genus database with same CATH superfamily
1P84E 5AVQB 1QL1A 1JY3P 2PFXA 1DD3A 2CNRA 1BXIA 1NTZD 3L72G 3G6EP 3IN6A 2QEXP 3HUSB 2O1JA 3IFMA 2CGQA 2P2UA 1FU1A 3GF3A 3U1CA 4EYYQ 1IZNB 2K1AA 2LTEA 2IYOA 4H0LB 1W2BO 4QKOA 1P84D 2KZJA 1PGQA 2JO0A 4HKGA 3B5NA 1VHNA 4PD4E 2EFJA 5APTA 1KILA 3E7KA 1M74A 5DJUB 2P10A 1JNMA 2GZIA 3M06A 5I4TG 2O01H 1AVYA 2PEQA 3AE1C 5AW0B 3NFQA 3GLMA 1KFMA 2IDBA 3VN0A 3DS3A 3V4WA 2N1TA 1BGYD 4PD4D 3RL0C 1GL2D 1VF5C 1URQB 4GKGA 5CCHC 3DS4A 2QM7A 1M7LA 2IBZE 3U59A 2JYLA 4PV1B 1P84H 2PAJA 3MHVA 3LMOA 4A7PA 4JBZA 2R3SA 1KN7A 2Y0CA 1L0IA 1AQTA 5KKZC 3AEEC 4PXHB 2A06G 1EQ7A 3P8CE 1E5WA 4EDFA 2XNDH 2WSSH 1D7MA 1IK7A 1UJZA 4H2WC 3EJEA 3PLNA 1PP9E 4TLFA 3H1JE 3CWBG 3AE6C 2QJPC 2UWJE 3W68A 4PD4H 3H1LJ 2N9YB 2QJKB 3P8CD 2M3EA 5CJ0A 4U3FG 2Y9ZA 4YXDC 1PP9D 2K2QA 1GTWA 1SFCC 3H1JD 2FADA 4JF7A 3WMM0 1VQKP 1GU4A 2IFMA 4AUWA 2M5AA 3N4XA 1LT9B 4WY4D 3L74E 1BE3E 1IFPA 2BEZF 3TGUJ 3JC22 1L0LG 4GOEA 3KPEA 2KR5A 2W27A 1IK9A 3M9HA 1IO4A 2ROQA 3U1AA 2FYUG 4COPA 1JY2P 3L72E 1N73B 3WUUA 1LTJC 4DG9A 3Q2YA 1FZGA 1LTGC 1BDCA 2M8PA 5KLVJ 4C46A 2PP6A 2B9BA 2XXMA 4XROA 1SQPJ 1YTZI 3SWKA 1ZRTE 5K5GB 3PJSK 2RMZA 2R5BA 2LXCB 2E76C 3L72D 1NTKK 3AEFC 3A0BH 1KYOD 5KJ7D 4W80A 5AW5B 1L0LK 3G3ZA 1G2CA 3L75G 2OYIB 3NMDA 2H7HA 2Z5IA 1JJ2O 3E1RA 2E1MA 2E74B 4I7ZC 2PEJA 2GDXA 2KK7A 2FFDB 5AW9B 1IMPA 3GHGA 1Z56A 4UB8H 1JMBA 1OZHA 1HF9A 4NPDA 1SQVG 2ITAA 2BCCD 2IFNA 3AE5C 4H2YC 4L73A 1KYOH 2VSQA 1JCDA 1PL5A 3BATA 2A06E 3KQGA 4LLHA 2PENA 4H44B 5APSA 3CXCO 3G1IA 1L0HA 1DX7A 4WYMA 2ZT9B 1GL2B 4LC1A 1LT1A 2K88A 1D1DA 3E1IA 1LTTC 3CWBE 1BCCD 1S72P 4RESB 4B86A 4OGQB 1S5LX 2D2CB 3VMZA 4U0CA 3VRLC 2ZVNB 1DIPA 4U3FE 2QJYC 2O1KA 1ZMBA 2K9JA 4H2XC 1FBMA 2OYOA 3HYBA 5AVYB 5BU5A 1L0NJ 2K37A 4K3AA 5CCHA 3P05A 2AFDA 3EFGA 3Q20A 3TF5A 1PEQA 3H0DA 4U3FD 1L0LE 4AYCA 2XU6A 3E2DA 5H2FH 5CBOA 2FYUE 4IL6E 4WWIA 4KHXA 2Q6QA 2IYPA 3HRNA 2N6ZA 1EMVA 2VLNA 1JO5A 1NTMK 2FYUD 3HE4A 3KHUA 4DZOA 3MTUE 1N7SC 1IUQA 4W7ZA 4WVZA 3RK3E 1NU1J 3TYYA 5KP7B 1Y9BA 2ONTA 1EDJA 5GTIE 3L75E 3CX5E 3O8ZA 1SQXJ 2KNCA 2JBGA 5BS2A 4D6TJ 5BU8B 4WY4A 4XFJA 1U57A 2OGUA 2NPSC 1BAJA 2ZYAA 3RG6C 3H1LD 1A43A 2N5IA 3GKLC 2WMMA 3CX5D 1SQVE 2VLPA 1NOHA 2QA4P 1X79B 1W2EA 4R4LA 1EZVD 2M8LA 1DD4A 1QRJA 1RF1A 2I1JA 5APWA 1UIXA 5B5EE 1H8AA 1PV3A 2FYZA 4N3YB 1RHZB 2Y0EA 3TGUD 4HKZH 1LP1B 3B5NC 4IFFA 2WSEJ 1KILC 3KDPB 1LGHB 5KLIB 5GTIH 3CX5H 4JYBA 3WUVA 3S1KA 2Q3IA 2JKVA 4COCA 5AW7B 2KS1B 3HTKA 2Z45A 2M3BA 1JM0A 2FQ0A 3RGUA 5KLVD 2N1TC 3G28A 5TJHA 4UB6E 3AEGC 5AW6B 1FDMA 4H0LD 1HBWA 1M6NA 3LRYA 3CCEP 1P84I 4W7YA 1KD1Q 1RO0A 3DPHA 2XZ1C 4RO0A 2HG5D 1SQBK 2LXBA 3EFFK 3P32A 1PGPA 2BASA 5EW5E 1OX3A 1SQQG 3VTPC 1K05A 2VRSA 3HD7B 1CW5A 1AVOA 1U7JA 2NO8A 4F37A 1OW8A 1NTZK 4NPFX 1IFMA 1URQD 4PD4I 1BGYG 2IZ0A 2W6JH 3MUDA 3D71A 4PV1D 1FZBA 3GZMA 2EHSA 2YKQA 1N2DC 1ACPA 1Q7YQ 1FR2A 2BUOA 5HGOA 2HODA 3A7OA 3OAKA 5F2KA 2LL8A 1FZCB 2KZIA 3H25A 3EWKA 3CD6P 2QSIA 2JAZA 3NTEA 3IAOA 2GUVA 4PWVB 4UB6H 1MV8A 1NQ4A 1SP4A 2DW3A 2KOOA 2K5XA 4K35A 3R4YA 1J1DB 2WWWA 2JP3A 2N98A 1GU5A 1RE3A 1OWAA 1KB9D 4IPYA 1M1JA 5HGMA 2YIUB 2QRXA 3FWLA 3V2RA 3GMAA 1EXJA 2L9FA 2KGEA 4IZ6A 2WPVB 2JB0A 2A45H 2P1JA 1ZNVA 1GK4A 1LWUB 5AW2B 1T2KD 2L4BA 2G3AA 2E75C 5GTHH 3OJAB 1GZLA 5HV8A 1MZ8A 3VP8A 1PGJA 2VLQA 5B66E 2WT7B 1E6JP 1GPJA 1KB9H 1HGVA 1R8EA 1OFCX 2H43A 1JY3O 2KGAA 2C0WA 3H1KJ 5AVUB 3AE8C 2MR8A 3GHGC 2M8NA 3OA7A 1E79H 3CCMP 2E42A 5APUA 5AW3B 3CCVP 1NU1D 1E0HA 1G1JA 1KYOI 1UIIA 3RK2B 2N5HA 2G8YA 1SQQE 2LKMA 2E74D 2O3JA 1QVGO 4LGDE 4D6TD 4U0EA 5BS1A 2JO1A 1K9MQ 3V5BA 5CBNA 1BSNA 1FOSF 4C7RA 1BGYE 3L71J 2W83C 2PEIA 1NJIQ 5B66H 1A02J 1SQQD 1KZUB 1HJ0A 2BCCG 1KFNA 4R0MA 1HQBA 1KQLA 2JQ4A 4YTPC 1KV4A 4NPEA 1HWTC 1QVFO 2HR3A 4H44D 1MFTA 1FZFA 4HYTB 2ZT9D 3GG2A 2YNYA 3KYQA 4MRTC 3FWNA 1GXGA 1YIJP 5EFWB 3MD0A 3L73J 5F2OA 1GW3A 2ZVOB 5KAIH 4H13B 1IFDA 4OGQD 2M5RA 2D2CD 1BCCG 1NTKJ 3PTZA 1FOSE 1ZXGA 2KG6A 1YTZT 1HGZA 3HE5B 2PRRA 2ZXXA 4IFMA 2LR2A 4Y28J 2QNWA 2QVAA 1ZV8A 1VPCA 1Q86Q 3CCQP 1T6AA 2LPKA 1DV5A 2KB7P 1QLED 3M0AA 3SWFA 1L4AB 3A0BE 1ZMEC 1N7LA 2WSEH 2EHTA 1JTHB 3O6QB 1HTLC 3FXDA 3FX0A 3Q5PA 2B87A 2RH0A 4WY4C 1NKNA 2K94A 5F2NA 2AEJA 3WBHA 2JGPA 3DS1A 4O9BA 1GMJA 1NGMB 1WMKA 1EDLA 3TNUB 1PEUA 4UB8E 1OR5A 3CL3D 1EOQA 1MZ9A 2BEQD 1T8KA 2JDIH 2GZEA 1VQLP 2KG9A 2IPPA 1MFZA 3HZQA 2W90A 1KYOE 2KG8A 1RF1C 4NEOA 3F5HA 2H88C 2J59M 1LT9A 3CC4P 1EC5A 2DGYA 1OXZA 3MIWA 1FDOA 3MGEA 4RKUJ 3H1LG 3CX5I 2P7JA 3LW5H 1IFIA 1N73A 1FE6A 2FYUK 2BCCE 3Q3DA 1EZVI 3V4QA 4XA4A 1BDDA 2JU2A 1EZVG 1LNQA 2Q5UA 1VQNP 1M90Q 1Q2NA 1RNIA 1X8YA 3AECC 1UNKA 1HH0A 3CC2P 1YJ9P 1NTMJ 2JYGA 3BCCJ 5H2FE 3AEBC 4YPCA 3TGUG 1BCCE 4RJTA 5AVWB 2Q9IA 2EIAA 3Q5SA 1RQVA 2V7QJ 1AJYA 3H1IJ 3G29A 2FFDA 2WTYA 1ZOYC 1DH3A 1JY3N 3CLQA 1X9VA 5CHXA 2HFED 3H1KD 2GDWA 3SWYA 5KLVG 3H32A 3MUDC 5HGNA 2AVAA 3USSA 4BPGA 1RQUA 1DEBA 4Y99C 3RL0B 3CCRP 1VF5B 3UIAA 3CCLP 1SQVK 2POHA 1YQ3C 1GL2A 2JWAA 1YHQP 1QX8A 3HD7D 2MVVA 2Z44A 5CJ4A 5KKZB 3CCJP 4MN4C 1GDTA 2FYNC 3L70J 2HPCB 3AE4C 2ZYDA 2E5YA 3QWOC 3L71D 4OH8B 1FAVA 4C7NA 2PEOA 5AVTB 5KLVK 1RE3C 4TT3H 3L37A 3I55P 2GA1A 2QJPB 3G9RA 1M1JC 3H1HJ 1NWQA 2Y0DA 5CCGD 1VDFA 2WPTA 1S3JA 2A45G 4ZMDA 2KORA 2JJLA 1T8ZA 5DJTB 3L73D 1S9KD 7CEIA 4U0AA 3D6YA 1SFCB 2R44A 3C8VA 1NTKD 4QNBA 4OWFA 3H1LE 1SQBJ 2N50A 1J1EC 1KTMA 1VQ9P 2KSJA 2OTJP 1LTAC 1EZVE 1VQ6P 2YO2A 3RK3C 1NTZJ 1JB0J 2K92A 2AXTH 2CPBA 2WPSA 4L74A 5KP6B 4U0FA 1CI6B 5CZDB 1LTJB 2FQ2A 1KQSO 1GXHA 4DJGA 3CC7P 4BRYB 4IL6X 1K04A 3TGUE 2XT1A 1VQ5P 1IFJA 1M8OB 3I56P 4PJ0E 5AVXB 1PPJD 2E76B 3PH0A 2C9NY 3CXHE 1T3UA 2X2BA 1JOCA 1RE4A 1AV1A 3M0DC 5KJ7A 2OTLP 5KLVE 4XFYA 1IC2A 2AFEA 3CI9A 2W8ZA 1YI2P 4I7ZB 3HTKB 1SQPE 3B5IA 2QG4A 1G1IA 2L0QA 3HUSC 3CXHD 1NU1G 3RG2A 3RK2D 3CCSP 2FY8A 2FXOA 4H0LC 1SVFA 1SQPD 1SQXG 3A0HE 5KAFH 4D6TG 1LP1A 1ZP0C 2RKLA 2XV5A 1M1KQ 1FJKA 4PJ0H 3VOPA 2WSCJ 2WSFJ 4JYCA 2Z5HA 2LOLA 2KS1A 3PP5A 2FVEA 4WBAA 4DOJA 1WT6A 3CXHH 3GJNA 1HJBA 1ZR4A 2N6YA 1NO4A 2KXPB 2QJYB 2KW2A 1PP9J 4U7JA 4PV1C 1JMMA 2KI7B 3H1JJ 1NTMD 2MR7A 4H13D 3QH9A 1USDA 3BCCD 5GTHE 2OYHA 4ZKUA 2K0XA 2XV6A 3HD7A 3H1ID 1KB9E 1VL2A 3VMYA 1H0TB 2YKPA 1SQQK 3A0HH 4I1LA 1L0NE 3EJBA 2CG5B 1A8OA 4L76A 4GIFA 3L74J 1BE3J 2QJKC 4GODA 2PEKA 3G1GA 3W67A 1FZEA 4JQ0D 1L4AD 1IFNA 1FDIA 1FZCA 2C0XA 2CPSA 3M9BA 2L22A 3FGAD 3L72J 1RF0A 3T97B 1L0ND 1N7SB 4EOTA 4I6MC 2DNWA 1LT9C 2V7QH 2YO3A 2MKVA 1NAFA 2MF4A 1T2KC 2WQYC 1M6EX 1J1EB 4GT1A 1SLQA 1ZR2A 2ZAEB 3B4QA 3RK3B 2ERHA 2NPSB 2JU1A 1CZQA 1N73C 3H1HD 4HB1A 1OIPA 1NU1E 2I1KA 1YBKA 2SPZA 1FJPA 2E75D 1M57D 2FXMA 3WU2E 2P9XA 5HVCA 2XKMA 4DT0A 1LWUA 1SQXE 5AW1B 3AEAC 4D6TE 5KAIE 1PIXA 2PGDA 5AVVB 3JSVC 2XZRA 1H89A 5HGLA 2WT7A 2MY5A 2I8DA 4HH2A 2OYIC 3CE7A 1SQBD 1FZAA 4M3LA 1Z6MA 2E74C 2L91A 3B5NB 1SQXD 1NKZB 4GOFA 1KILB 5AVRB 4I2LC 2FFDC 2M8RA 4CA3A 1FC2C 2R32A 3M0DA 4KJMA 2B89A 3VMXA 2MVUA 3CMAP 3BASA 5BVZA 2RN0A 2W6AA 1PGOA 3CWBJ 4ZKPA 3BRTB 3KXDA 3AE9C 2N1TB 2BQ1E 3HUSA 1GW4A 3Q1MA 3G4SP 2Q3EA 2EG5A 4H44C 4U3FJ 2K0YA 1GL2C 2ZT9C 5TISH 3RBZA 2R3CA 3V6IA 4XFZA 1TU3F 3WU2H 3L35A 4OGQC 2D2CC 2IX7C 2K3RA 2O01N 1YITP 3H1KG 1H88A 4JPZB 1L0LJ 2YMKA 3CCUP 5AVSB 1FS0E 1JUNA 3RL0D 1VF5D 3AEDC 4BWNA 5CCHD 2FYUJ 2H89C 2OQQA 2XNXA 4XFXA 1EDKA 1OVVA 1URQA 5EJDA 1X0TA 1NVOA 2KIKA 1OW7A 2GYKA 2IBZD 3N7NA 1LTBC 3L71G 2B87B 3HE5A 2M5AB 3EJDA 3SFEC 1KORA 2NRGA 3L75J 2YKOA 2KGDA 1R5LA 3LIEA 1VQ8P 2KODA 1JY2O 3M9QA 3A5TA 1ZN5A 2B88A 2AEMA 1SFCD 1L4AA 2K0DX 3L73G 3TDKA 1HVVA 3II6A 2GZJA 1N8RQ 3V2PA 2QE7H 1SQVJ 1NTKG 4PH0A 1JTHA 1OVRA 3SSUA 2OTKE 3O6QA 2WITA 1CEIA 3JCUE 3H6PA 1QGKB 2WSCH 1HUCA 1U7MA 4QMAA 2CQ8A 2E75B 2WSFH 2W6BA 4U0DA 4GR6A 3ITKA 2KOQA 1RE4C 1G2CB 3TNUA 1K73Q 5KJ7C 2QIWA 1PZQA 1XTGB 2YMYA 1NAYA 3L74D 1BE3D 2VLOA 3LIDA 4AQRD 2KUBA 2Z4EA 1VQOP 2KSEA 2AF8A 2PEMA 3KZIE 2JWDA 4BPHA 3L4FA 2KLVA 5KTBA 3GHGB 4OVNF 1WRGA 1S5LE 2JR8A 2E76D 2C9LY 2KOSA 1VQPP 1PPJG 3NY7B 1JEKA 2KOPA 3K5BA 2IZ1A 2FAEA 3MP7B 3V2NA 3VYIA 2AEFA 3BVHA 1ZRTD 3H1KE 5KP8B 5KLIC 2OYIA 1AYIA 2KLUA 1A02F 1MUUA 2WPQA 4R4MA 3JCUH 1RY3A 3L36A 2L5GB 1VQMP 3NTNA 1S4XA 1S2EA 3CXHI 2XDJA 3I5CA 2FACA 3H32B 4EI2A 5AVZB 3DTJA 1IJDB 1LJ2A 2K9JB 1XTCC 1SQPG 2LF4A 2LIUA 2FXPA 2OYHC 3GW6A 3KZIH 3L71E 3M91A 1J2JB 4ZNCA 1LTIC 1S5LH 4ASWA 2FKWB 3HD7C 5APVA 2N9BA 2A06D 4C7NB 1HY8A 1DNYA 1RH5B 5APXA 2KYVA 2AXTE 1GD2E 1T3JA 2H8PD 1OVUA 1YJNP 1OMIA 3CWBD 3L73E 2M0BA 1S9KE 1NTMG 1VQ4P 1SQPK 3BCCG 2LMLA 2GZFA 5E79E 1NTKE 1FZCC 2K9YA 2OARA 5CCGC 2CWOA 4YXWH 4IFDK 3HE4B 1RF0C 4N78E 1JCCA 2A45I 1K8AQ 1VKUA 3TK1A 3H1IG 3B71A 3A3YB 3D6ZA 2HPCA 3OW2O 3CMEP 2ZYGA 3PHLA 2WZ7A 2E43A 1K30A 1J1DC 1M56D 1AFOA 1L0LD 2AXCA 2KNCB 4WY4B 4N78D 5JPAA 2YIUC 2FBWC 1KB9I 2O01J 2WVRA 1KMIZ 2P58A 3DS0A 1N7SD 3AE7C 2MJZA 1PPJE 1X3OA 1L0NG 4HJGH 1SFCA 5APQA 5KAFE 1LWUC 5C39A 5APYA 1RF1B 1RO2A 1BSHA 5AW4B 3VP9A 2QM8A 3TSIA 2XZ0D 1KQGB 3L70G 3FXEA 1KLPA 2GUSA 5E79H 2ZFCA 3RK3D 4EIJA 2NPSD 3RL0g 3S4RA 1GK6A 3BRVB 2L6EA 2GZGA 1LTSC 3D70A 5L8RJ 3Q5RA 3L75D 1PEOA 1AQ5A 3H1HG 4BXLA 2Z46A 4IL6H 1SS1A 1SQQJ 2Y9YA 1JY2N 3C9IA 5AW8B 3IF4A 1CI6A 2YXQB 4XE5B 1LTJA 1KILE 4M0IA 1L0NK 1N86A 1EIAA 3CPWO 3GF7A 4BRYA 3H47A 1L2PA 1BGYJ 3ABVC 1KQFB 4CPGA 2HLOA 2KP8A 2FVAA 4PH1A 1SQVD 3RK2C 1QEXA 1KC8Q 4BPFA 2CK3H 2ZXEB 3PRJA 1CSBA 3B4SA 3P7KA 1SQBG 3R2PA 1R5SA 3B5ND 4GDOA 1KILD 2FQ1A 3P8MC 4L75A 2JEEA 2HYNA 2KWLA 1NHLA 1MKMA 3U43A 2R5DA 3S9OA 3ZDMA 1AUMA 2J5UA 2E5TA 1NTZG 1X22A 1PFIA 1NTME 1F80D 2N1TD 2BHVA 3BCCE 2P67A 2K93A 1IMQA 2Q7CA 3G71P 1YQ4C 1OW6A 2GDYA 2GM4A 1URQC 1NU1K 3RBXA 4Y99B 1ZW0A 3H1IE 2MD9A 2HODB 3WUTA 2OYHB 3C1LA 4H13C 3NXSA 3G26A 1SQXK 2NZ2A 5DCKA 5B5EH 1Y47A 2Q1KA 2PY8A 3A2AA 1PEMA 1Y8AA 1QL2A 2FYNB 5CMZA 2WPRA 3GZLA 3LW5J 1USEA 1YJWP 3AE3C 2J58A 1W5CE 1M1JB 4N6JA 2LKIA 1L4AC 3SFDC 3L70E 1VQ7P 2IBZI 1NYHA 2IBZG 3B8EB 4Z1MH 1EDIA 1YYCA 5CCGA 4U0BA 2V4HA 3VMAA 3MGNA 1H0TA 4UHPB 3H1HE 5M1BA 3EQ2A 2KGCA 3L70D 3IR9A 1AF8A 4ASVA 1AA0A 1EXIA 1Q81Q 2KOGA 1PP9G 3MZWB 3H1JG 2YXRB 2LIWA 1NH4A 4GR2A 4DCKA 1Q90D 4WB4A 4IOIH 3T97A 3H4EA 1N7SA 3M1MA 1SQBE 2BCCJ 3F89A 5TISE 3G21A 3AE2C 2PNGA 3V2QA 3DS2A 2FVFA 3DS5A 2FHSC 1DEEG 1ZLLA 1NTZE 4XRQA 1Q82Q 2NPSA 4KT0J 3L74G 1BE3G 1S1CX 1BCCJ 3G0VA 2ZJSE
chains in the Genus database with same CATH topology
2EG5A 1PEOA 2ONTA 1YJWP 2Z46A 3G6EP 1E6JP 3CCSP 4U0DA 4GR6A 4XFZA 2QEXP 1VQNP 2PENA 1M90Q 3CXCO 3G1IA 1RNIA 4WYMA 5BS2A 1K73Q 1VQKP 1D1DA 1M6EX 4M0IA 1Q86Q 1YJNP 1EIAA 3CPWO 3H47A 3CC2P 1YJ9P 4U0AA 1BAJA 3CCQP 1YITP 1W2BO 1VQ7P 1M1KQ 1VQOP 1VQ4P 2M8NA 3RG6C 2JYGA 1S72P 4PH1A 4QNBA 2PEMA 2JO0A 3CCUP 1KC8Q 1A43A 4U0BA 3CCMP 4U0CA 2OARA 2EFJA 1M74A 3CCVP 2CWOA 2QA4P 2BUOA 3VRLC 5HGOA 1Q7YQ 2EIAA 4COPA 5I4TG 4XFXA 1K8AQ 1VQ9P 2M8LA 5F2KA 1ZMBA 2PEQA 1VQPP 1QRJA 2OTJP 3G29A 1VQ6P 3HYBA 3CD6P 3NTEA 1AUMA 1QVGO 3OW2O 3CMEP 2P9XA 4U0EA 2M8PA 5F2NA 3WBHA 1K30A 5BS1A 1Q81Q 3DS3A 1K9MQ 3DS1A 3P05A 2XXMA 4XROA 4U0FA 1RO0A 3Q20A 1PEUA 3DS4A 5HGNA 1PEQA 4GR2A 5JPAA 3H0DA 1KQSO 1EOQA 5HGLA 3CC7P 2BHVA 2JYLA 2PEIA 3E2DA 1NJIQ 2XT1A 3H4EA 3CCRP 1VQ5P 3CCLP 1VQLP 3I56P 1VQMP 3M1MA 3G71P 2XV6A 4IPYA 3G21A 3HZQA 5HGMA 3DS0A 4COCA 3I55P 3DS2A 3DS5A 1JJ2O 1QVFO 3DTJA 1YHQP 2E1MA 1VQ8P 2KODA 2Z45A 2Z44A 3CC4P 2PEJA 3CMAP 1RO2A 3G26A 4XRQA 3CCJP 3G28A 1YIJP 1A8OA 2OTLP 5DCKA 2LF4A 2PY8A 4XFYA 5F2OA 1Q82Q 1M6NA 1PEMA 3LRYA 2PEKA 3CCEP 2DGYA 1YI2P 3G1GA 2PEOA 3B5IA 3G0VA 1N8RQ 2BQ1E 3MGEA 1KD1Q 4PH0A 2L6EA 3DPHA 1IUQA 3G4SP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JJ2 O;  1QVF O;  1S72 P;  1Q81 Q;  1YHQ P;  1K9M Q;  3CCU P;  1KC8 Q;  1VQ8 P;  3CCM P;  1YJW P;  3G6E P;  3CCV P;  3CCS P;  3CMA P;  3CCJ P;  3CC4 P;  1YIJ P;  2QA4 P;  1Q7Y Q;  2QEX P;  1KQS O;  3CC7 P;  2OTL P;  1VQN P;  1M90 Q;  1NJI Q;  3CXC O;  1K8A Q;  1Q82 Q;  1VQ9 P;  3CCR P;  1VQ5 P;  1VQ4 P;  3CCL P;  1VQL P;  1K73 Q;  3CCE P;  1YI2 P;  1VQK P;  3I56 P;  1VQM P;  1VQP P;  3G71 P;  2OTJ P;  1Q86 Q;  1YJN P;  1VQ6 P;  1N8R Q;  3CPW O;  3CC2 P;  3CD6 P;  1YJ9 P;  1KD1 Q;  3CCQ P;  1QVG O;  3OW2 O;  3CME P;  1YIT P;  1W2B O;  1VQ7 P;  1M1K Q;  1VQO P;  3I55 P;  3G4S P; 
#chains in the Genus database with same CATH topology
 1P84 E;  5AVQ B;  1QL1 A;  1JY3 P;  2PFX A;  1DD3 A;  2CNR A;  1BXI A;  1NTZ D;  3L72 G;  3G6E P;  3IN6 A;  2QEX P;  3HUS B;  2O1J A;  3IFM A;  2CGQ A;  2P2U A;  1FU1 A;  3GF3 A;  3U1C A;  4EYY Q;  1IZN B;  2K1A A;  2LTE A;  2IYO A;  4H0L B;  1W2B O;  4QKO A;  1P84 D;  2KZJ A;  1PGQ A;  2JO0 A;  4HKG A;  3B5N A;  1VHN A;  4PD4 E;  2EFJ A;  5APT A;  1KIL A;  3E7K A;  1M74 A;  5DJU B;  2P10 A;  1JNM A;  2GZI A;  3M06 A;  5I4T G;  2O01 H;  1AVY A;  2PEQ A;  3AE1 C;  5AW0 B;  3NFQ A;  3GLM A;  1KFM A;  2IDB A;  3VN0 A;  3DS3 A;  3V4W A;  2N1T A;  1BGY D;  4PD4 D;  3RL0 C;  1GL2 D;  1VF5 C;  1URQ B;  4GKG A;  5CCH C;  3DS4 A;  2QM7 A;  1M7L A;  2IBZ E;  3U59 A;  2JYL A;  4PV1 B;  1P84 H;  2PAJ A;  3MHV A;  3LMO A;  4A7P A;  4JBZ A;  2R3S A;  1KN7 A;  2Y0C A;  1L0I A;  1AQT A;  5KKZ C;  3AEE C;  4PXH B;  2A06 G;  1EQ7 A;  3P8C E;  1E5W A;  4EDF A;  2XND H;  2WSS H;  1D7M A;  1IK7 A;  1UJZ A;  4H2W C;  3EJE A;  3PLN A;  1PP9 E;  4TLF A;  3H1J E;  3CWB G;  3AE6 C;  2QJP C;  2UWJ E;  3W68 A;  4PD4 H;  3H1L J;  2N9Y B;  2QJK B;  3P8C D;  2M3E A;  5CJ0 A;  4U3F G;  2Y9Z A;  4YXD C;  1PP9 D;  2K2Q A;  1GTW A;  1SFC C;  3H1J D;  2FAD A;  4JF7 A;  3WMM 0;  1VQK P;  1GU4 A;  2IFM A;  4AUW A;  2M5A A;  3N4X A;  1LT9 B;  4WY4 D;  3L74 E;  1BE3 E;  1IFP A;  2BEZ F;  3TGU J;  3JC2 2;  1L0L G;  4GOE A;  3KPE A;  2KR5 A;  2W27 A;  1IK9 A;  3M9H A;  1IO4 A;  2ROQ A;  3U1A A;  2FYU G;  4COP A;  1JY2 P;  3L72 E;  1N73 B;  3WUU A;  1LTJ C;  4DG9 A;  3Q2Y A;  1FZG A;  1LTG C;  1BDC A;  2M8P A;  5KLV J;  4C46 A;  2PP6 A;  2B9B A;  2XXM A;  4XRO A;  1SQP J;  1YTZ I;  3SWK A;  1ZRT E;  5K5G B;  3PJS K;  2RMZ A;  2R5B A;  2LXC B;  2E76 C;  3L72 D;  1NTK K;  3AEF C;  3A0B H;  1KYO D;  5KJ7 D;  4W80 A;  5AW5 B;  1L0L K;  3G3Z A;  1G2C A;  3L75 G;  2OYI B;  3NMD A;  2H7H A;  2Z5I A;  1JJ2 O;  3E1R A;  2E1M A;  2E74 B;  4I7Z C;  2PEJ A;  2GDX A;  2KK7 A;  2FFD B;  5AW9 B;  1IMP A;  3GHG A;  1Z56 A;  4UB8 H;  1JMB A;  1OZH A;  1HF9 A;  4NPD A;  1SQV G;  2ITA A;  2BCC D;  2IFN A;  3AE5 C;  4H2Y C;  4L73 A;  1KYO H;  2VSQ A;  1JCD A;  1PL5 A;  3BAT A;  2A06 E;  3KQG A;  4LLH A;  2PEN A;  4H44 B;  5APS A;  3CXC O;  3G1I A;  1L0H A;  1DX7 A;  4WYM A;  2ZT9 B;  1GL2 B;  4LC1 A;  1LT1 A;  2K88 A;  1D1D A;  3E1I A;  1LTT C;  3CWB E;  1BCC D;  1S72 P;  4RES B;  4B86 A;  4OGQ B;  1S5L X;  2D2C B;  3VMZ A;  4U0C A;  3VRL C;  2ZVN B;  1DIP A;  4U3F E;  2QJY C;  2O1K A;  1ZMB A;  2K9J A;  4H2X C;  1FBM A;  2OYO A;  3HYB A;  5AVY B;  5BU5 A;  1L0N J;  2K37 A;  4K3A A;  5CCH A;  3P05 A;  2AFD A;  3EFG A;  3Q20 A;  3TF5 A;  1PEQ A;  3H0D A;  4U3F D;  1L0L E;  4AYC A;  2XU6 A;  3E2D A;  5H2F H;  5CBO A;  2FYU E;  4IL6 E;  4WWI A;  4KHX A;  2Q6Q A;  2IYP A;  3HRN A;  2N6Z A;  1EMV A;  2VLN A;  1JO5 A;  1NTM K;  2FYU D;  3HE4 A;  3KHU A;  4DZO A;  3MTU E;  1N7S C;  1IUQ A;  4W7Z A;  4WVZ A;  3RK3 E;  1NU1 J;  3TYY A;  5KP7 B;  1Y9B A;  2ONT A;  1EDJ A;  5GTI E;  3L75 E;  3CX5 E;  3O8Z A;  1SQX J;  2KNC A;  2JBG A;  5BS2 A;  4D6T J;  5BU8 B;  4WY4 A;  4XFJ A;  1U57 A;  2OGU A;  2NPS C;  1BAJ A;  2ZYA A;  3RG6 C;  3H1L D;  1A43 A;  2N5I A;  3GKL C;  2WMM A;  3CX5 D;  1SQV E;  2VLP A;  1NOH A;  2QA4 P;  1X79 B;  1W2E A;  4R4L A;  1EZV D;  2M8L A;  1DD4 A;  1QRJ A;  1RF1 A;  2I1J A;  5APW A;  1UIX A;  5B5E E;  1H8A A;  1PV3 A;  2FYZ A;  4N3Y B;  1RHZ B;  2Y0E A;  3TGU D;  4HKZ H;  1LP1 B;  3B5N C;  4IFF A;  2WSE J;  1KIL C;  3KDP B;  1LGH B;  5KLI B;  5GTI H;  3CX5 H;  4JYB A;  3WUV A;  3S1K A;  2Q3I A;  2JKV A;  4COC A;  5AW7 B;  2KS1 B;  3HTK A;  2Z45 A;  2M3B A;  1JM0 A;  2FQ0 A;  3RGU A;  5KLV D;  2N1T C;  3G28 A;  5TJH A;  4UB6 E;  3AEG C;  5AW6 B;  1FDM A;  4H0L D;  1HBW A;  1M6N A;  3LRY A;  3CCE P;  1P84 I;  4W7Y A;  1KD1 Q;  1RO0 A;  3DPH A;  2XZ1 C;  4RO0 A;  2HG5 D;  1SQB K;  2LXB A;  3EFF K;  3P32 A;  1PGP A;  2BAS A;  5EW5 E;  1OX3 A;  1SQQ G;  3VTP C;  1K05 A;  2VRS A;  3HD7 B;  1CW5 A;  1AVO A;  1U7J A;  2NO8 A;  4F37 A;  1OW8 A;  1NTZ K;  4NPF X;  1IFM A;  1URQ D;  4PD4 I;  1BGY G;  2IZ0 A;  2W6J H;  3MUD A;  3D71 A;  4PV1 D;  1FZB A;  3GZM A;  2EHS A;  2YKQ A;  1N2D C;  1ACP A;  1Q7Y Q;  1FR2 A;  2BUO A;  5HGO A;  2HOD A;  3A7O A;  3OAK A;  5F2K A;  2LL8 A;  1FZC B;  2KZI A;  3H25 A;  3EWK A;  3CD6 P;  2QSI A;  2JAZ A;  3NTE A;  3IAO A;  2GUV A;  4PWV B;  4UB6 H;  1MV8 A;  1NQ4 A;  1SP4 A;  2DW3 A;  2KOO A;  2K5X A;  4K35 A;  3R4Y A;  1J1D B;  2WWW A;  2JP3 A;  2N98 A;  1GU5 A;  1RE3 A;  1OWA A;  1KB9 D;  4IPY A;  1M1J A;  5HGM A;  2YIU B;  2QRX A;  3FWL A;  3V2R A;  3GMA A;  1EXJ A;  2L9F A;  2KGE A;  4IZ6 A;  2WPV B;  2JB0 A;  2A45 H;  2P1J A;  1ZNV A;  1GK4 A;  1LWU B;  5AW2 B;  1T2K D;  2L4B A;  2G3A A;  2E75 C;  5GTH H;  3OJA B;  1GZL A;  5HV8 A;  1MZ8 A;  3VP8 A;  1PGJ A;  2VLQ A;  5B66 E;  2WT7 B;  1E6J P;  1GPJ A;  1KB9 H;  1HGV A;  1R8E A;  1OFC X;  2H43 A;  1JY3 O;  2KGA A;  2C0W A;  3H1K J;  5AVU B;  3AE8 C;  2MR8 A;  3GHG C;  2M8N A;  3OA7 A;  1E79 H;  3CCM P;  2E42 A;  5APU A;  5AW3 B;  3CCV P;  1NU1 D;  1E0H A;  1G1J A;  1KYO I;  1UII A;  3RK2 B;  2N5H A;  2G8Y A;  1SQQ E;  2LKM A;  2E74 D;  2O3J A;  1QVG O;  4LGD E;  4D6T D;  4U0E A;  5BS1 A;  2JO1 A;  1K9M Q;  3V5B A;  5CBN A;  1BSN A;  1FOS F;  4C7R A;  1BGY E;  3L71 J;  2W83 C;  2PEI A;  1NJI Q;  5B66 H;  1A02 J;  1SQQ D;  1KZU B;  1HJ0 A;  2BCC G;  1KFN A;  4R0M A;  1HQB A;  1KQL A;  2JQ4 A;  4YTP C;  1KV4 A;  4NPE A;  1HWT C;  1QVF O;  2HR3 A;  4H44 D;  1MFT A;  1FZF A;  4HYT B;  2ZT9 D;  3GG2 A;  2YNY A;  3KYQ A;  4MRT C;  3FWN A;  1GXG A;  1YIJ P;  5EFW B;  3MD0 A;  3L73 J;  5F2O A;  1GW3 A;  2ZVO B;  5KAI H;  4H13 B;  1IFD A;  4OGQ D;  2M5R A;  2D2C D;  1BCC G;  1NTK J;  3PTZ A;  1FOS E;  1ZXG A;  2KG6 A;  1YTZ T;  1HGZ A;  3HE5 B;  2PRR A;  2ZXX A;  4IFM A;  2LR2 A;  4Y28 J;  2QNW A;  2QVA A;  1ZV8 A;  1VPC A;  1Q86 Q;  3CCQ P;  1T6A A;  2LPK A;  1DV5 A;  2KB7 P;  1QLE D;  3M0A A;  3SWF A;  1L4A B;  3A0B E;  1ZME C;  1N7L A;  2WSE H;  2EHT A;  1JTH B;  3O6Q B;  1HTL C;  3FXD A;  3FX0 A;  3Q5P A;  2B87 A;  2RH0 A;  4WY4 C;  1NKN A;  2K94 A;  5F2N A;  2AEJ A;  3WBH A;  2JGP A;  3DS1 A;  4O9B A;  1GMJ A;  1NGM B;  1WMK A;  1EDL A;  3TNU B;  1PEU A;  4UB8 E;  1OR5 A;  3CL3 D;  1EOQ A;  1MZ9 A;  2BEQ D;  1T8K A;  2JDI H;  2GZE A;  1VQL P;  2KG9 A;  2IPP A;  1MFZ A;  3HZQ A;  2W90 A;  1KYO E;  2KG8 A;  1RF1 C;  4NEO A;  3F5H A;  2H88 C;  2J59 M;  1LT9 A;  3CC4 P;  1EC5 A;  2DGY A;  1OXZ A;  3MIW A;  1FDO A;  3MGE A;  4RKU J;  3H1L G;  3CX5 I;  2P7J A;  3LW5 H;  1IFI A;  1N73 A;  1FE6 A;  2FYU K;  2BCC E;  3Q3D A;  1EZV I;  3V4Q A;  4XA4 A;  1BDD A;  2JU2 A;  1EZV G;  1LNQ A;  2Q5U A;  1VQN P;  1M90 Q;  1Q2N A;  1RNI A;  1X8Y A;  3AEC C;  1UNK A;  1HH0 A;  3CC2 P;  1YJ9 P;  1NTM J;  2JYG A;  3BCC J;  5H2F E;  3AEB C;  4YPC A;  3TGU G;  1BCC E;  4RJT A;  5AVW B;  2Q9I A;  2EIA A;  3Q5S A;  1RQV A;  2V7Q J;  1AJY A;  3H1I J;  3G29 A;  2FFD A;  2WTY A;  1ZOY C;  1DH3 A;  1JY3 N;  3CLQ A;  1X9V A;  5CHX A;  2HFE D;  3H1K D;  2GDW A;  3SWY A;  5KLV G;  3H32 A;  3MUD C;  5HGN A;  2AVA A;  3USS A;  4BPG A;  1RQU A;  1DEB A;  4Y99 C;  3RL0 B;  3CCR P;  1VF5 B;  3UIA A;  3CCL P;  1SQV K;  2POH A;  1YQ3 C;  1GL2 A;  2JWA A;  1YHQ P;  1QX8 A;  3HD7 D;  2MVV A;  2Z44 A;  5CJ4 A;  5KKZ B;  3CCJ P;  4MN4 C;  1GDT A;  2FYN C;  3L70 J;  2HPC B;  3AE4 C;  2ZYD A;  2E5Y A;  3QWO C;  3L71 D;  4OH8 B;  1FAV A;  4C7N A;  2PEO A;  5AVT B;  5KLV K;  1RE3 C;  4TT3 H;  3L37 A;  3I55 P;  2GA1 A;  2QJP B;  3G9R A;  1M1J C;  3H1H J;  1NWQ A;  2Y0D A;  5CCG D;  1VDF A;  2WPT A;  1S3J A;  2A45 G;  4ZMD A;  2KOR A;  2JJL A;  1T8Z A;  5DJT B;  3L73 D;  1S9K D;  7CEI A;  4U0A A;  3D6Y A;  1SFC B;  2R44 A;  3C8V A;  1NTK D;  4QNB A;  4OWF A;  3H1L E;  1SQB J;  2N50 A;  1J1E C;  1KTM A;  1VQ9 P;  2KSJ A;  2OTJ P;  1LTA C;  1EZV E;  1VQ6 P;  2YO2 A;  3RK3 C;  1NTZ J;  1JB0 J;  2K92 A;  2AXT H;  2CPB A;  2WPS A;  4L74 A;  5KP6 B;  4U0F A;  1CI6 B;  5CZD B;  1LTJ B;  2FQ2 A;  1KQS O;  1GXH A;  4DJG A;  3CC7 P;  4BRY B;  4IL6 X;  1K04 A;  3TGU E;  2XT1 A;  1VQ5 P;  1IFJ A;  1M8O B;  3I56 P;  4PJ0 E;  5AVX B;  1PPJ D;  2E76 B;  3PH0 A;  2C9N Y;  3CXH E;  1T3U A;  2X2B A;  1JOC A;  1RE4 A;  1AV1 A;  3M0D C;  5KJ7 A;  2OTL P;  5KLV E;  4XFY A;  1IC2 A;  2AFE A;  3CI9 A;  2W8Z A;  1YI2 P;  4I7Z B;  3HTK B;  1SQP E;  3B5I A;  2QG4 A;  1G1I A;  2L0Q A;  3HUS C;  3CXH D;  1NU1 G;  3RG2 A;  3RK2 D;  3CCS P;  2FY8 A;  2FXO A;  4H0L C;  1SVF A;  1SQP D;  1SQX G;  3A0H E;  5KAF H;  4D6T G;  1LP1 A;  1ZP0 C;  2RKL A;  2XV5 A;  1M1K Q;  1FJK A;  4PJ0 H;  3VOP A;  2WSC J;  2WSF J;  4JYC A;  2Z5H A;  2LOL A;  2KS1 A;  3PP5 A;  2FVE A;  4WBA A;  4DOJ A;  1WT6 A;  3CXH H;  3GJN A;  1HJB A;  1ZR4 A;  2N6Y A;  1NO4 A;  2KXP B;  2QJY B;  2KW2 A;  1PP9 J;  4U7J A;  4PV1 C;  1JMM A;  2KI7 B;  3H1J J;  1NTM D;  2MR7 A;  4H13 D;  3QH9 A;  1USD A;  3BCC D;  5GTH E;  2OYH A;  4ZKU A;  2K0X A;  2XV6 A;  3HD7 A;  3H1I D;  1KB9 E;  1VL2 A;  3VMY A;  1H0T B;  2YKP A;  1SQQ K;  3A0H H;  4I1L A;  1L0N E;  3EJB A;  2CG5 B;  1A8O A;  4L76 A;  4GIF A;  3L74 J;  1BE3 J;  2QJK C;  4GOD A;  2PEK A;  3G1G A;  3W67 A;  1FZE A;  4JQ0 D;  1L4A D;  1IFN A;  1FDI A;  1FZC A;  2C0X A;  2CPS A;  3M9B A;  2L22 A;  3FGA D;  3L72 J;  1RF0 A;  3T97 B;  1L0N D;  1N7S B;  4EOT A;  4I6M C;  2DNW A;  1LT9 C;  2V7Q H;  2YO3 A;  2MKV A;  1NAF A;  2MF4 A;  1T2K C;  2WQY C;  1M6E X;  1J1E B;  4GT1 A;  1SLQ A;  1ZR2 A;  2ZAE B;  3B4Q A;  3RK3 B;  2ERH A;  2NPS B;  2JU1 A;  1CZQ A;  1N73 C;  3H1H D;  4HB1 A;  1OIP A;  1NU1 E;  2I1K A;  1YBK A;  2SPZ A;  1FJP A;  2E75 D;  1M57 D;  2FXM A;  3WU2 E;  2P9X A;  5HVC A;  2XKM A;  4DT0 A;  1LWU A;  1SQX E;  5AW1 B;  3AEA C;  4D6T E;  5KAI E;  1PIX A;  2PGD A;  5AVV B;  3JSV C;  2XZR A;  1H89 A;  5HGL A;  2WT7 A;  2MY5 A;  2I8D A;  4HH2 A;  2OYI C;  3CE7 A;  1SQB D;  1FZA A;  4M3L A;  1Z6M A;  2E74 C;  2L91 A;  3B5N B;  1SQX D;  1NKZ B;  4GOF A;  1KIL B;  5AVR B;  4I2L C;  2FFD C;  2M8R A;  4CA3 A;  1FC2 C;  2R32 A;  3M0D A;  4KJM A;  2B89 A;  3VMX A;  2MVU A;  3CMA P;  3BAS A;  5BVZ A;  2RN0 A;  2W6A A;  1PGO A;  3CWB J;  4ZKP A;  3BRT B;  3KXD A;  3AE9 C;  2N1T B;  2BQ1 E;  3HUS A;  1GW4 A;  3Q1M A;  3G4S P;  2Q3E A;  2EG5 A;  4H44 C;  4U3F J;  2K0Y A;  1GL2 C;  2ZT9 C;  5TIS H;  3RBZ A;  2R3C A;  3V6I A;  4XFZ A;  1TU3 F;  3WU2 H;  3L35 A;  4OGQ C;  2D2C C;  2IX7 C;  2K3R A;  2O01 N;  1YIT P;  3H1K G;  1H88 A;  4JPZ B;  1L0L J;  2YMK A;  3CCU P;  5AVS B;  1FS0 E;  1JUN A;  3RL0 D;  1VF5 D;  3AED C;  4BWN A;  5CCH D;  2FYU J;  2H89 C;  2OQQ A;  2XNX A;  4XFX A;  1EDK A;  1OVV A;  1URQ A;  5EJD A;  1X0T A;  1NVO A;  2KIK A;  1OW7 A;  2GYK A;  2IBZ D;  3N7N A;  1LTB C;  3L71 G;  2B87 B;  3HE5 A;  2M5A B;  3EJD A;  3SFE C;  1KOR A;  2NRG A;  3L75 J;  2YKO A;  2KGD A;  1R5L A;  3LIE A;  1VQ8 P;  2KOD A;  1JY2 O;  3M9Q A;  3A5T A;  1ZN5 A;  2B88 A;  2AEM A;  1SFC D;  1L4A A;  2K0D X;  3L73 G;  3TDK A;  1HVV A;  3II6 A;  2GZJ A;  1N8R Q;  3V2P A;  2QE7 H;  1SQV J;  1NTK G;  4PH0 A;  1JTH A;  1OVR A;  3SSU A;  2OTK E;  3O6Q A;  2WIT A;  1CEI A;  3JCU E;  3H6P A;  1QGK B;  2WSC H;  1HUC A;  1U7M A;  4QMA A;  2CQ8 A;  2E75 B;  2WSF H;  2W6B A;  4U0D A;  4GR6 A;  3ITK A;  2KOQ A;  1RE4 C;  1G2C B;  3TNU A;  1K73 Q;  5KJ7 C;  2QIW A;  1PZQ A;  1XTG B;  2YMY A;  1NAY A;  3L74 D;  1BE3 D;  2VLO A;  3LID A;  4AQR D;  2KUB A;  2Z4E A;  1VQO P;  2KSE A;  2AF8 A;  2PEM A;  3KZI E;  2JWD A;  4BPH A;  3L4F A;  2KLV A;  5KTB A;  3GHG B;  4OVN F;  1WRG A;  1S5L E;  2JR8 A;  2E76 D;  2C9L Y;  2KOS A;  1VQP P;  1PPJ G;  3NY7 B;  1JEK A;  2KOP A;  3K5B A;  2IZ1 A;  2FAE A;  3MP7 B;  3V2N A;  3VYI A;  2AEF A;  3BVH A;  1ZRT D;  3H1K E;  5KP8 B;  5KLI C;  2OYI A;  1AYI A;  2KLU A;  1A02 F;  1MUU A;  2WPQ A;  4R4M A;  3JCU H;  1RY3 A;  3L36 A;  2L5G B;  1VQM P;  3NTN A;  1S4X A;  1S2E A;  3CXH I;  2XDJ A;  3I5C A;  2FAC A;  3H32 B;  4EI2 A;  5AVZ B;  3DTJ A;  1IJD B;  1LJ2 A;  2K9J B;  1XTC C;  1SQP G;  2LF4 A;  2LIU A;  2FXP A;  2OYH C;  3GW6 A;  3KZI H;  3L71 E;  3M91 A;  1J2J B;  4ZNC A;  1LTI C;  1S5L H;  4ASW A;  2FKW B;  3HD7 C;  5APV A;  2N9B A;  2A06 D;  4C7N B;  1HY8 A;  1DNY A;  1RH5 B;  5APX A;  2KYV A;  2AXT E;  1GD2 E;  1T3J A;  2H8P D;  1OVU A;  1YJN P;  1OMI A;  3CWB D;  3L73 E;  2M0B A;  1S9K E;  1NTM G;  1VQ4 P;  1SQP K;  3BCC G;  2LML A;  2GZF A;  5E79 E;  1NTK E;  1FZC C;  2K9Y A;  2OAR A;  5CCG C;  2CWO A;  4YXW H;  4IFD K;  3HE4 B;  1RF0 C;  4N78 E;  1JCC A;  2A45 I;  1K8A Q;  1VKU A;  3TK1 A;  3H1I G;  3B71 A;  3A3Y B;  3D6Z A;  2HPC A;  3OW2 O;  3CME P;  2ZYG A;  3PHL A;  2WZ7 A;  2E43 A;  1K30 A;  1J1D C;  1M56 D;  1AFO A;  1L0L D;  2AXC A;  2KNC B;  4WY4 B;  4N78 D;  5JPA A;  2YIU C;  2FBW C;  1KB9 I;  2O01 J;  2WVR A;  1KMI Z;  2P58 A;  3DS0 A;  1N7S D;  3AE7 C;  2MJZ A;  1PPJ E;  1X3O A;  1L0N G;  4HJG H;  1SFC A;  5APQ A;  5KAF E;  1LWU C;  5C39 A;  5APY A;  1RF1 B;  1RO2 A;  1BSH A;  5AW4 B;  3VP9 A;  2QM8 A;  3TSI A;  2XZ0 D;  1KQG B;  3L70 G;  3FXE A;  1KLP A;  2GUS A;  5E79 H;  2ZFC A;  3RK3 D;  4EIJ A;  2NPS D;  3RL0 g;  3S4R A;  1GK6 A;  3BRV B;  2L6E A;  2GZG A;  1LTS C;  3D70 A;  5L8R J;  3Q5R A;  3L75 D;  1PEO A;  1AQ5 A;  3H1H G;  4BXL A;  2Z46 A;  4IL6 H;  1SS1 A;  1SQQ J;  2Y9Y A;  1JY2 N;  3C9I A;  5AW8 B;  3IF4 A;  1CI6 A;  2YXQ B;  4XE5 B;  1LTJ A;  1KIL E;  4M0I A;  1L0N K;  1N86 A;  1EIA A;  3CPW O;  3GF7 A;  4BRY A;  3H47 A;  1L2P A;  1BGY J;  3ABV C;  1KQF B;  4CPG A;  2HLO A;  2KP8 A;  2FVA A;  4PH1 A;  1SQV D;  3RK2 C;  1QEX A;  1KC8 Q;  4BPF A;  2CK3 H;  2ZXE B;  3PRJ A;  1CSB A;  3B4S A;  3P7K A;  1SQB G;  3R2P A;  1R5S A;  3B5N D;  4GDO A;  1KIL D;  2FQ1 A;  3P8M C;  4L75 A;  2JEE A;  2HYN A;  2KWL A;  1NHL A;  1MKM A;  3U43 A;  2R5D A;  3S9O A;  3ZDM A;  1AUM A;  2J5U A;  2E5T A;  1NTZ G;  1X22 A;  1PFI A;  1NTM E;  1F80 D;  2N1T D;  2BHV A;  3BCC E;  2P67 A;  2K93 A;  1IMQ A;  2Q7C A;  3G71 P;  1YQ4 C;  1OW6 A;  2GDY A;  2GM4 A;  1URQ C;  1NU1 K;  3RBX A;  4Y99 B;  1ZW0 A;  3H1I E;  2MD9 A;  2HOD B;  3WUT A;  2OYH B;  3C1L A;  4H13 C;  3NXS A;  3G26 A;  1SQX K;  2NZ2 A;  5DCK A;  5B5E H;  1Y47 A;  2Q1K A;  2PY8 A;  3A2A A;  1PEM A;  1Y8A A;  1QL2 A;  2FYN B;  5CMZ A;  2WPR A;  3GZL A;  3LW5 J;  1USE A;  1YJW P;  3AE3 C;  2J58 A;  1W5C E;  1M1J B;  4N6J A;  2LKI A;  1L4A C;  3SFD C;  3L70 E;  1VQ7 P;  2IBZ I;  1NYH A;  2IBZ G;  3B8E B;  4Z1M H;  1EDI A;  1YYC A;  5CCG A;  4U0B A;  2V4H A;  3VMA A;  3MGN A;  1H0T A;  4UHP B;  3H1H E;  5M1B A;  3EQ2 A;  2KGC A;  3L70 D;  3IR9 A;  1AF8 A;  4ASV A;  1AA0 A;  1EXI A;  1Q81 Q;  2KOG A;  1PP9 G;  3MZW B;  3H1J G;  2YXR B;  2LIW A;  1NH4 A;  4GR2 A;  4DCK A;  1Q90 D;  4WB4 A;  4IOI H;  3T97 A;  3H4E A;  1N7S A;  3M1M A;  1SQB E;  2BCC J;  3F89 A;  5TIS E;  3G21 A;  3AE2 C;  2PNG A;  3V2Q A;  3DS2 A;  2FVF A;  3DS5 A;  2FHS C;  1DEE G;  1ZLL A;  1NTZ E;  4XRQ A;  1Q82 Q;  2NPS A;  4KT0 J;  3L74 G;  1BE3 G;  1S1C X;  1BCC J;  3G0V A;  2ZJS E; 
#chains in the Genus database with same CATH homology
 2EG5 A;  1PEO A;  2ONT A;  1YJW P;  2Z46 A;  3G6E P;  1E6J P;  3CCS P;  4U0D A;  4GR6 A;  4XFZ A;  2QEX P;  1VQN P;  2PEN A;  1M90 Q;  3CXC O;  3G1I A;  1RNI A;  4WYM A;  5BS2 A;  1K73 Q;  1VQK P;  1D1D A;  1M6E X;  4M0I A;  1Q86 Q;  1YJN P;  1EIA A;  3CPW O;  3H47 A;  3CC2 P;  1YJ9 P;  4U0A A;  1BAJ A;  3CCQ P;  1YIT P;  1W2B O;  1VQ7 P;  1M1K Q;  1VQO P;  1VQ4 P;  2M8N A;  3RG6 C;  2JYG A;  1S72 P;  4PH1 A;  4QNB A;  2PEM A;  2JO0 A;  3CCU P;  1KC8 Q;  1A43 A;  4U0B A;  3CCM P;  4U0C A;  2OAR A;  2EFJ A;  1M74 A;  3CCV P;  2CWO A;  2QA4 P;  2BUO A;  3VRL C;  5HGO A;  1Q7Y Q;  2EIA A;  4COP A;  5I4T G;  4XFX A;  1K8A Q;  1VQ9 P;  2M8L A;  5F2K A;  1ZMB A;  2PEQ A;  1VQP P;  1QRJ A;  2OTJ P;  3G29 A;  1VQ6 P;  3HYB A;  3CD6 P;  3NTE A;  1AUM A;  1QVG O;  3OW2 O;  3CME P;  2P9X A;  4U0E A;  2M8P A;  5F2N A;  3WBH A;  1K30 A;  5BS1 A;  1Q81 Q;  3DS3 A;  1K9M Q;  3DS1 A;  3P05 A;  2XXM A;  4XRO A;  4U0F A;  1RO0 A;  3Q20 A;  1PEU A;  3DS4 A;  5HGN A;  1PEQ A;  4GR2 A;  5JPA A;  3H0D A;  1KQS O;  1EOQ A;  5HGL A;  3CC7 P;  2BHV A;  2JYL A;  2PEI A;  3E2D A;  1NJI Q;  2XT1 A;  3H4E A;  3CCR P;  1VQ5 P;  3CCL P;  1VQL P;  3I56 P;  1VQM P;  3M1M A;  3G71 P;  2XV6 A;  4IPY A;  3G21 A;  3HZQ A;  5HGM A;  3DS0 A;  4COC A;  3I55 P;  3DS2 A;  3DS5 A;  1JJ2 O;  1QVF O;  3DTJ A;  1YHQ P;  2E1M A;  1VQ8 P;  2KOD A;  2Z45 A;  2Z44 A;  3CC4 P;  2PEJ A;  3CMA P;  1RO2 A;  3G26 A;  4XRQ A;  3CCJ P;  3G28 A;  1YIJ P;  1A8O A;  2OTL P;  5DCK A;  2LF4 A;  2PY8 A;  4XFY A;  5F2O A;  1Q82 Q;  1M6N A;  1PEM A;  3LRY A;  2PEK A;  3CCE P;  2DGY A;  1YI2 P;  3G1G A;  2PEO A;  3B5I A;  3G0V A;  1N8R Q;  2BQ1 E;  3MGE A;  1KD1 Q;  4PH0 A;  2L6E A;  3DPH A;  1IUQ A;  3G4S P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...