3CMAP

The structure of cca and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Peptidyl-CCA deacylation on the ribosome promoted by induced fit and the O3'-hydroxyl group of A76 of the unacylated A-site tRNA.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
total genus 48
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2008-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3cmaP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 3cmaP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 3cmaP02
1YHQP 3CCRP 2OTLP 3CCEP 3G6EP 1VQ7P 1KQSO 1VQPP 1S72P 1K8AQ 1N8RQ 1VQNP 1NJIQ 2QA4P 1QVGO 3CC4P 3CD6P 3CCQP 2QEXP 3CCLP 3CC7P 1VQKP 3CXCO 1JJ2O 1VQMP 1VQ5P 1YJWP 1Q86Q 3I55P 1VQ9P 3G4SP 1YI2P 1YITP 1QVFO 3CCSP 1YJNP 1VQ4P 1VQ8P 2OTJP 3CMAP 1YIJP 1K9MQ 3CCVP 3I56P 1VQLP 3CCUP 3G71P 1M90Q 3CCJP 1KD1Q 1K73Q 1VQOP 1Q82Q 3CMEP 1KC8Q 1VQ6P 1M1KQ 3CC2P 3CCMP 3OW2O 1Q81Q 1W2BO 1YJ9P 1Q7YQ 3CPWO
chains in the Genus database with same CATH superfamily
5CZDB 2FAEA 2JWDA 3H1JG 5APQA 2FQ2A 4XRQA 2QM7A 3Q1MA 1LTJC 1HBWA 1SQVD 2N98A 5B66H 3FGAD 2KNCB 1M90Q 2WT7A 1LWUB 5I4TG 3FWLA 3LMOA 3GHGC 1IK9A 2P9XA 2KYVA 2XNDH 3P8CD 5KLVE 3PJSK 2XV6A 5HVCA 2ITAA 3U1AA 1FZCC 3KZIE 3HRNA 2KWLA 5KKZC 3L73J 2P67A 1D7MA 2WPQA 3L71J 1L0ND 4BXLA 1ZOYC 3E1IA 1CEIA 2OYHB 1S9KE 1SQBE 1SQBJ 3AE3C 1SQVJ 3AEGC 2YXRB 5GTHE 1NQ4A 2ZVNB 1H89A 2NPSA 3H1HJ 4U0CA 2N5HA 3TSIA 2L22A 5KLVJ 2WSFH 2OQQA 1VQ4P 2PEIA 4H2WC 2D2CC 1GW3A 4NPFX 2JB0A 1EIAA 4L74A 2CNRA 1G1IA 2Q3IA 2HR3A 1YQ3C 5AW7B 3GF7A 5AVTB 2BASA 2RMZA 3AEAC 2XU6A 1FZAA 3H1HE 1L0NJ 3MUDC 1VDFA 1P84I 1EXIA 5CCGD 5KP6B 2HG5D 5B5EH 2RKLA 1RQUA 1HGVA 1Q90D 1VQKP 2AXCA 1EDLA 1YJWP 2XDJA 2KNCA 1YYCA 2R44A 1F80D 1LT9C 2E76C 2JDIH 5DJUB 1JY3P 3KPEA 4JYCA 2FXMA 2W8ZA 4YXDC 1L0NG 2L4BA 3WMM0 5DCKA 1N7SD 3CCEP 3T97B 3KZIH 2N5IA 1ZMBA 3I5CA 2XV5A 2LKMA 2KGCA 1Z6MA 2H88C 3MZWB 5AW2B 5AW4B 4W7YA 1JM0A 1NU1J 1PGJA 1PEUA 3L74J 4C7NA 2YO3A 2WWWA 3VMXA 1RE3C 1NH4A 1RQVA 1UIXA 1URQD 3B5NC 3OJAB 3G9RA 1RF1C 3TF5A 2I1KA 2JO1A 2LOLA 2Q9IA 2M8NA 1PPJE 4HYTB 3V2PA 2R5BA 5EFWB 1RE4C 1SQPD 1R5LA 4MN4C 1JB0J 1IC2A 2IZ0A 2OARA 3WU2E 3H0DA 2A06G 2MD9A 5BU8B 1J1EB 3QH9A 3G4SP 1USEA 4UHPB 5CMZA 3GZLA 1FC2C 1SQQK 4PV1C 3AE4C 2I1JA 2YNYA 2K3RA 3AE6C 2YKPA 1CZQA 4C46A 1VKUA 1RY3A 1KYOE 2KS1A 4R4LA 1Q86Q 2KZIA 1KYOI 4UB6E 1OX3A 1PIXA 2Z5IA 4IZ6A 2QJYC 3G29A 1PGQA 2H43A 5AW8B 4GR6A 1WT6A 3IAOA 1T8KA 1NHLA 3CX5D 1KN7A 2CGQA 1UNKA 3L72E 1Z56A 1A02F 3GZMA 1NTZE 4H44B 1L2PA 7CEIA 4C7NB 2W27A 1JEKA 2N6YA 3H1IG 1EMVA 2FADA 4NEOA 1FZEA 1YHQP 1JY2O 2CG5B 1IFPA 1SQVK 3BCCG 1HJBA 2OYIA 2QJKB 3H1ID 1URQB 4B86A 1L0IA 4I7ZC 4D6TG 1SFCA 3EJEA 3MIWA 3ABVC 3TNUB 1LTGC 4ZMDA 2BCCE 1VF5B 2W6AA 3H1JE 3H1KE 3CCLP 3TGUG 2KK7A 3U59A 5HGMA 3W67A 2MVVA 3SWYA 1KV4A 1KILE 2FFDA 5APWA 3DS4A 5AVUB 1U7JA 3A3YB 1HF9A 2QG4A 2QM8A 5GTIE 2VRSA 3E1RA 4H13D 1NTKK 1NU1E 2WTYA 2PRRA 3DS5A 1AYIA 1D1DA 1JY2N 4BRYA 1HQBA 1YBKA 1FZCA 1GK6A 2Y9ZA 1X22A 1SFCB 2BEQD 3TK1A 2MR8A 3PLNA 1PEMA 2AXTH 2HODA 2Z46A 3G71P 1CW5A 1LP1A 1R5SA 3SFEC 1Q2NA 3L70G 2KZJA 4PV1D 2CPSA 1FOSE 1IK7A 2AFEA 1MKMA 1VHNA 1N7SB 1N73C 2XZ1C 3H1LE 2NPSC 2EHSA 4WY4C 1AV1A 2OTKE 4W7ZA 2IBZG 3PTZA 5M1BA 1PP9E 4AYCA 2WPVB 1YI2P 2IBZD 1A02J 1RHZB 2N9BA 2XKMA 4BPGA 1BAJA 3Q5RA 1L0LG 2L6EA 1NTMD 4I2LC 1KC8Q 2M5RA 3HUSA 2WSFJ 2P1JA 4IL6H 1L0NE 5KJ7A 2WMMA 1EZVD 2GZIA 1QEXA 1JJ2O 5C39A 2WT7B 3VMAA 1VQLP 2WZ7A 2AVAA 5BU5A 5KLVK 2LF4A 2LTEA 1T8ZA 2GDXA 3H1IE 5AW9B 1E79H 1S2EA 5TISE 2Y0DA 2QEXP 3T97A 4KHXA 2KOGA 3G28A 1LTAC 3I55P 2KR5A 2NRGA 4NPDA 3V2RA 2K5XA 2O1JA 2Z44A 1FZCB 3VTPC 4U3FD 3L72D 2VSQA 4IFMA 2GDYA 1VQ9P 1M8OB 1N86A 2JR8A 3V4QA 1PP9J 4U0FA 2AFDA 1YIJP 5AW5B 3RK3B 1NOHA 4U3FG 1YTZI 2JKVA 3H1LJ 1HGZA 1GZLA 4PD4E 3RBXA 1GXHA 5CBNA 1SQBG 1WRGA 3C1LA 3TYYA 4JPZB 4UB8E 4QMAA 2IYOA 2M3BA 2J58A 2FYUD 2H7HA 1SQPJ 1L4AB 4Y28J 4F37A 2M5AB 3H1LG 3M0DA 3CCMP 2YKOA 4U0EA 1SQPG 1KFMA 4COCA 4U0AA 4K3AA 3CX5H 1JUNA 4RESB 1OMIA 3DTJA 2IFNA 1MUUA 1NU1K 2K2QA 3HE5B 2BCCD 1DV5A 3AEFC 4U7JA 3AE7C 4PWVB 1ZV8A 1DEEG 1IFJA 1KQSO 3L4FA 4GDOA 1OWAA 1LT9B 1U7MA 3GLMA 2GUSA 1RH5B 5CBOA 4JQ0D 1FZBA 4L76A 3NTEA 4O9BA 2FYUJ 3EJDA 1GMJA 3RK3D 3TGUJ 1NYHA 2K93A 2HPCA 2SPZA 2C0XA 2V7QJ 2MKVA 2WSEH 2QJPC 1M1JB 1ZW0A 1M6EX 2FYZA 1DD3A 1EZVI 3P05A 3MP7B 3MUDA 1S5LE 2FYUG 5AW3B 2Y0EA 4GOFA 4IL6X 1MZ9A 1K8AQ 3B71A 4UB8H 1A8OA 1RF1B 2IZ1A 5KLIB 5AVRB 1NWQA 1SLQA 3H32B 3NXSA 4I6MC 2FFDB 2R3SA 1K73Q 1YTZT 4GR2A 4K35A 3TGUD 2JU1A 3R4YA 2JU2A 3M1MA 3H1HD 1RO2A 5KAFE 3CWBE 1IFNA 3AEBC 1KQGB 2JJLA 1VQ5P 1LTTC 4XFXA 2KORA 4COPA 1JCDA 3U43A 1EDJA 4H2YC 1N2DC 3CL3D 3LW5J 2R32A 1OIPA 1KILD 2J5UA 1MZ8A 4RKUJ 1FDIA 4Y99B 3M0AA 3L70J 3B8EB 4DCKA 2PEQA 1NKNA 3A0HH 3N4XA 2O3JA 2KG6A 5BS2A 5BS1A 2QE7H 4U0DA 3O8ZA 5K5GB 2YKQA 5CJ0A 4OGQD 1JOCA 1K05A 1K04A 3RBZA 3L75E 3WUUA 3RG6C 3AE1C 4WBAA 1BGYJ 2KG9A 3AE5C 2O01J 3RK3E 1URQA 2E5TA 1JO5A 1IJDB 1NTKJ 3M9HA 2HLOA 1L0HA 2FKWB 3NFQA 5F2NA 2E43A 3CXHH 4JBZA 3V2NA 1Y8AA 2MF4A 3PH0A 1FR2A 3HUSC 3H4EA 2OTLP 1AQ5A 2H89C 1GL2A 1IFIA 4ASWA 2N1TC 3CXHD 4EIJA 3LRYA 1FOSF 2KB7P 5DJTB 2B89A 3BCCE 4H13C 1X0TA 2BQ1E 1KQFB 2ZJSE 2DW3A 1YJ9P 5CCHD 3G26A 1GW4A 2PEMA 2V4HA 3L35A 3DPHA 1NTKG 1SP4A 2K0DX 5KAFH 1DEBA 3IN6A 3HE5A 2P7JA 1UJZA 1M7LA 2ZXXA 1KD1Q 4GODA 4HH2A 1OVRA 1IMQA 1NTZK 1PV3A 4XFJA 2WSEJ 4W80A 5HGLA 1GK4A 2W83C 1GPJA 2NPSD 2O01H 4NPEA 3L75D 3EJBA 1SQXJ 4H44D 5KJ7D 2WPTA 4PD4H 1SQPE 1HWTC 2L91A 3P8MC 1T2KD 5F2OA 1KTMA 1N73B 3RK2B 1NKZB 2NPSB 2EHTA 2IDBA 1S9KD 2NO8A 1G1JA 3Q20A 5HGOA 5HGNA 3A5TA 4H0LC 1SVFA 3G3ZA 1SQQJ 2MY5A 2A45G 1FZFA 3L71E 1RF0C 3EFGA 3SFDC 3L73E 4AUWA 3CMAP 1P84E 5CJ4A 4CPGA 1M57D 1SQQE 2MR7A 1AJYA 2K9JB 2H8PD 2WVRA 4CA3A 1FU1A 2E42A 2KLVA 1RE3A 1MFTA 4OH8B 2KOSA 5AVYB 3PP5A 1DH3A 4EDFA 2E75B 2PAJA 2BCCJ 3M9QA 1YJNP 3DS1A 2OTJP 2Q5UA 1GXGA 2KGAA 3KXDA 4M3LA 3GHGA 2A06E 5KTBA 4JF7A 2FACA 1EQ7A 3HD7A 1S4XA 3RL0D 2LPKA 1WMKA 2N9YB 2FVFA 2PEKA 2GZGA 3H1KD 5CCHA 2M8LA 1PGOA 1PP9D 1YQ4C 2I8DA 1IFDA 1NTZG 4RO0A 1KILB 2Q7CA 1L0LJ 2QSIA 2NZ2A 1P84D 1M6NA 3V6IA 1LTJB 3CC7P 2KOOA 3EFFK 1NTMK 1BXIA 2K0XA 2MJZA 1MFZA 2FYNC 2KSEA 2GZFA 2K0YA 1R8EA 4PXHB 4U0BA 1G2CA 4D6TE 4DT0A 4Z1MH 3CX5E 1NAFA 2IX7C 3HD7B 5KLVG 3GJNA 1LTIC 5EJDA 1KB9H 2OYHC 2LXBA 2FXOA 2LMLA 1BGYG 5AVVB 1CSBA 1QL1A 2CK3H 2HODB 2Y0CA 1PEOA 1KLPA 1L0LD 1NTMG 3CWBJ 5TISH 3CXHI 3N7NA 2POHA 3O6QA 3L72J 2HFED 3TDKA 4WYMA 1SQQG 1NTMJ 1LT9A 2KOQA 3FWNA 5CCGC 1EDKA 1GU4A 1QRJA 3K5BA 3AE8C 3HTKB 2KIKA 1HH0A 3L70E 4HJGH 2WPRA 3MGEA 3II6A 1GU5A 3L36A 5KKZB 3CCVP 2FHSC 2ZT9B 2ZT9D 2GZEA 1S5LX 1BSHA 1AVOA 2Z4EA 1ZRTD 3B5NA 1IUQA 2MVUA 3USSA 2JAZA 2LKIA 1ZR2A 3D6YA 2E74B 1JCCA 4N78D 5APUA 1U57A 2FVAA 2D2CB 4WVZA 3A2AA 2ZYGA 3H1KG 3G1GA 4RJTA 2G8YA 3SWFA 4EOTA 1L0LE 2GYKA 1YITP 1KQLA 4TT3H 1Q82Q 3VMZA 1DD4A 1IZNB 1W2BO 3CI9A 1IMPA 3GF3A 2DGYA 1E5WA 3RL0B 4IOIH 5KJ7C 3A7OA 1N7LA 4YTPC 3OAKA 5AVZB 2WPSA 1BE3J 4EI2A 5APXA 4Y99C 2ONTA 1JMBA 2AXTE 2M0BA 2E76B 1QL2A 1J1DC 2W90A 2ZFCA 3LIDA 1ZP0C 1VQPP 3P7KA 3G1IA 4EYYQ 1AFOA 5APTA 3E7KA 4WB4A 2VLPA 3M91A 3S4RA 2XZRA 4MRTC 2GM4A 1T6AA 2ERHA 4N78E 2K94A 1SQPK 3KHUA 1FS0E 1GD2E 1M56D 4WWIA 1SQBK 3ZDMA 1W2EA 3IR9A 2IFMA 1LWUA 5H2FE 5E79E 4WY4D 3GG2A 2LIUA 2L0QA 3L75G 3L73G 2N1TD 2Q3EA 4KJMA 5AVXB 1BDCA 1EC5A 4N3YB 2OYIC 1AF8A 5AVSB 3L37A 1KB9D 3B5NB 4ZKPA 2A06D 3H1IJ 1G2CB 2WSCH 1OW8A 3Q3DA 1PZQA 4GIFA 3F5HA 1EXJA 1M1JA 3U1CA 3BVHA 2HPCB 1SQXE 3H1JD 1VQNP 4YXWH 2ZYDA 1PP9G 1ZXGA 4HKZH 3D70A 3SSUA 2E75D 2QVAA 1OVUA 4C7RA 1J1EC 3CCSP 1VQ8P 3L74D 3CCJP 4OGQB 1FAVA 4H2XC 3NY7B 1X3OA 3KDPB 4PV1B 3QWOC 2PP6A 2KSJA 3CCRP 3RG2A 2W6JH 1L0NK 2KGDA 3RL0g 5APYA 1URQC 5CCHC 1JMMA 4I7ZB 2Q6QA 2Q1KA 1LTJA 1RF1A 1X9VA 2B87A 1H0TA 1NO4A 1VF5C 1NTZD 2C0WA 3OA7A 2P2UA 1JY2P 1PGPA 1BCCG 4H0LD 2LIWA 3AEDC 4HB1A 3CLQA 1N73A 2QJYB 1NAYA 4GOEA 1HUCA 4D6TD 3GKLC 1GL2C 2IBZI 2N50A 3RK2C 4H44C 3H1LD 1BCCE 1PL5A 2K92A 1K30A 3DS3A 1VF5D 4R0MA 1KMIZ 3AECC 3KQGA 5APVA 2GUVA 4IFDK 2ROQA 2BUOA 1VL2A 3VOPA 3CXCO 2BEZF 3CWBG 3L75J 1Y47A 1FJPA 1NGMB 4R4MA 4U3FE 2PFXA 2QJKC 3L74G 1CI6A 3LIEA 1KORA 1NU1D 3A0HE 5B66E 5EW5E 4DZOA 2X2BA 4XFYA 2JGPA 3HYBA 2JO0A 3GMAA 2EIAA 3E2DA 1S72P 2CPBA 3BCCJ 2E75C 1NTKD 1E6JP 1SS1A 1ZN5A 3CX5I 1W5CE 1BE3E 1LP1B 2G3AA 1VPCA 2E1MA 2B9BA 1DNYA 4BPFA 3MTUE 5JPAA 5CCGA 1FBMA 2D2CD 3V5BA 3WUTA 2DNWA 2FBWC 4ZKUA 2P10A 5GTIH 2IPPA 2ZYAA 1ZR4A 2B87B 1RNIA 4L73A 2LL8A 3RGUA 1NTKE 3DS2A 2QNWA 2FVEA 3L70D 3WU2H 1SFCC 1ZNVA 3JC22 3VMYA 2AEMA 1DIPA 1LGHB 1S1CX 2FQ1A 1S3JA 4LC1A 1S5LH 1KYOH 2YXQB 2BHVA 1XTCC 4WY4B 1MV8A 2FQ0A 2PY8A 2VLQA 2FYNB 2A45I 3B5ND 3EWKA 4GKGA 3MGNA 1USDA 5GTHH 1AA0A 1UIIA 2YMYA 4TLFA 2FXPA 3M0DC 3CC2P 4GT1A 5B5EE 1T3UA 2CWOA 4ASVA 1VQMP 3HD7C 4XROA 2JP3A 2QA4P 1GL2D 2YIUC 2M8PA 3A0BH 3CWBD 4XFZA 3RK3C 3P32A 3TGUE 1AUMA 1E0HA 1JY3N 2Y9YA 1KB9I 2K1AA 3G21A 1Q81Q 1OXZA 2LR2A 3D71A 1ACPA 4WY4A 2KLUA 3B5IA 4IPYA 2O01N 1FDMA 3HTKA 2LXCB 1L4AC 2XZ0D 3B4SA 2JWAA 3H1HG 3UIAA 5AW1B 2JYGA 4XA4A 4PD4D 1HVVA 1ZRTE 3VP9A 1OVVA 3L74E 2K37A 2A45H 3A0BE 2VLNA 3NMDA 4M0IA 3Q2YA 2M8RA 2XNXA 3Q5PA 4BPHA 2KUBA 2GZJA 1SQBD 1AVYA 2IYPA 1BCCJ 1FE6A 1QGKB 1SQXK 3IF4A 2ZT9C 1OZHA 3D6ZA 1H0TB 2Z5HA 4ZNCA 3AEEC 4BRYB 3B4QA 1LWUC 1KB9E 2CQ8A 3GHGB 2O1KA 3HD7D 1GDTA 2J59M 1M74A 2QRXA 2QIWA 2E74C 2AEJA 1EZVG 1KILA 1HTLC 2E5YA 2PGDA 2KOPA 1X8YA 5AVQB 1SQQD 2QJPB 2JBGA 2L9FA 4U3FJ 1M1JC 2PENA 3NTNA 1H88A 4OWFA 2JYLA 1OW6A 2V7QH 4A7PA 3F89A 2K9JA 3KYQA 3L73D 3CD6P 1N7SA 3S9OA 2N6ZA 1RF0A 2XT1A 3VN0A 2C9NY 1BSNA 1T2KC 2HYNA 1XTGB 5L8RJ 2ZVOB 1EDIA 4PJ0E 4UB6H 4OVNF 3CPWO 3SWKA 3RL0C 2XXMA 1LNQA 3PHLA 2BCCG 4I1LA 1OW7A 2FY8A 1LT1A 4JYBA 2FFDC 3GW6A 1ZLLA 4QKOA 1J1DB 3CMEP 5KP7B 1LTSC 2VLOA 2B88A 1Q7YQ 3O6QB 3CC4P 2YMKA 3CCQP 4AQRD 1L4AD 1SQXD 2W6BA 3BASA 3IFMA 1X79B 1A43A 1FJKA 2K88A 4L75A 3AE2C 1JNMA 2WSSH 3BRVB 4LGDE 3BCCD 3BATA 2OYIB 1NJIQ 3L72G 1P84H 5F2KA 3MHVA 3AE9C 2AF8A 1OR5A 1QX8A 1LTBC 1PFIA 5KLIC 1JTHB 1IFMA 1NU1G 1VQOP 2AEFA 5KAIE 1FDOA 2EG5A 2RH0A 5AW0B 1SQVE 3L71G 2C9LY 2OYOA 5AW6B 2OYHA 1BGYE 2JQ4A 2Z45A 4OGQC 1KFNA 1K9MQ 2P58A 2KODA 2GA1A 2KP8A 3EQ2A 3FXEA 2KG8A 3C8VA 3JSVC 3FX0A 2KGEA 3MD0A 2N1TB 4QNBA 1Y9BA 3H1KJ 3JCUE 3H1JJ 4KT0J 1NVOA 4N6JA 1EOQA 2JEEA 1JTHA 3VP8A 1GL2B 4PH1A 2FYUK 1KYOD 1BE3G 2KXPB 3VRLC 3W68A 5CHXA 4IFFA 5H2FH 1L0LK 1CI6B 3H47A 3R2PA 1DX7A 1PPJG 4XE5B 3LW5H 1M1KQ 1OFCX 1NTZJ 2WITA 3CE7A 1TU3F 2M3EA 3CXHE 1QVGO 3HUSB 3BRTB 1SFCD 3TNUA 2KS1B 3P8CE 2E74D 4PH0A 3I56P 5KLVD 3DS0A 1PPJD 1QLED 4IL6E 2EFJA 4H0LB 4H13B 3VYIA 4LLHA 3RK2D 3FXDA 2OGUA 1N8RQ 1L4AA 4DJGA 4HKGA 2L5GB 5TJHA 1JY3O 3WBHA 2PEOA 1RE4A 1BGYD 1RO0A 3ITKA 5E79H 1EZVE 1GTWA 4PD4I 1SQVG 2YO2A 1VQ7P 2E76D 3HE4A 1HY8A 1J2JB 1HJ0A 3PRJA 1BDDA 2PEJA 1KZUB 2KI7B 3JCUH 2GDWA 1NTME 2N1TA 3S1KA 2IBZE 5KP8B 3CCUP 3H6PA 4DOJA 1AQTA 2K9YA 3G6EP 3L71D 4DG9A 4YPCA 4BWNA 2WSCJ 1SQXG 3M9BA 1H8AA 2R5DA 1KILC 3H25A 1ZMEC 2R3CA 2M5AA 2PNGA 2ZXEB 3OW2O 4D6TJ 3M06A 2YIUB 3V2QA 3C9IA 1N7SC 2FYUE 2RN0A 1BCCD 3WUVA 1IO4A 4PJ0H 1VQ6P 2KW2A 2WQYC 5AVWB 1FZGA 2UWJE 3H32A 3G0VA 1T3JA 5BVZA 1PEQA 1QVFO 5KAIH 5HV8A 2ZAEB 3Q5SA 1BE3D 3HZQA 3V4WA 5APSA 3HE4B 1LJ2A
chains in the Genus database with same CATH topology
3HYBA 2Z44A 2JO0A 2XXMA 3Q20A 3DS5A 2EIAA 5HGOA 1VQ7P 5HGNA 3E2DA 1S72P 3G1GA 1D1DA 1VQNP 3B5IA 1E6JP 4IPYA 1M6EX 4QNBA 1VQKP 2PEJA 4XRQA 1YJWP 1Q86Q 1VQ9P 3P05A 1YITP 3CCSP 4U0FA 1VQ8P 1PEMA 2E1MA 2JYGA 5F2NA 3CMAP 1YIJP 2Z46A 3G71P 3CCUP 1M90Q 3CCJP 1Q82Q 3CMEP 1EOQA 5I4TG 5JPAA 3G29A 1W2BO 2P9XA 1Q7YQ 5DCKA 4GR6A 3H4EA 3CCRP 4M0IA 3CCEP 3G6EP 2XV6A 2OTLP 1PEOA 2DGYA 1K8AQ 4PH1A 1A8OA 3CC4P 1RNIA 3CCQP 3VRLC 1ZMBA 4WYMA 3DS2A 1YI2P 3H47A 3LRYA 1YJNP 3DS1A 2OTJP 1BAJA 1A43A 2ONTA 2L6EA 2BQ1E 1K73Q 1KC8Q 1M1KQ 4GR2A 3CCMP 1PEUA 1QRJA 1YJ9P 3OW2O 3M1MA 1YHQP 1RO2A 4U0EA 3G26A 2PEMA 1VQPP 3G1IA 1NJIQ 1QVGO 2BHVA 2PEKA 4U0CA 3DPHA 5F2KA 4COCA 4U0AA 2PY8A 1M74A 1JJ2O 3MGEA 1VQ5P 2M8LA 4XFXA 3DTJA 2M8NA 4COPA 1VQ4P 2PEIA 4PH0A 3CCVP 3I56P 1VQLP 3DS0A 1KD1Q 1EIAA 1K30A 1VQOP 1VQ6P 3CC2P 3DS3A 2CWOA 2EFJA 2EG5A 2LF4A 1VQMP 3CCLP 2PEQA 2PENA 5HGLA 2JYLA 1M6NA 1KQSO 4XROA 2OARA 5HGMA 1N8RQ 3G0VA 5BS2A 5BS1A 2QA4P 3H0DA 3CD6P 2QEXP 3CC7P 2BUOA 4U0DA 3CXCO 1IUQA 2M8PA 3G28A 1PEQA 3I55P 3DS4A 4XFZA 3G4SP 2Z45A 2XT1A 1QVFO 3WBHA 2PEOA 3NTEA 5F2OA 1AUMA 1K9MQ 1RO0A 2KODA 3HZQA 3RG6C 3G21A 1Q81Q 4XFYA 4U0BA 3CPWO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YHQ P;  3CCR P;  2OTL P;  3CCE P;  3G6E P;  1VQ7 P;  1KQS O;  1VQP P;  1S72 P;  1K8A Q;  1N8R Q;  1VQN P;  1NJI Q;  2QA4 P;  1QVG O;  3CC4 P;  3CD6 P;  3CCQ P;  2QEX P;  3CCL P;  3CC7 P;  1VQK P;  3CXC O;  1JJ2 O;  1VQM P;  1VQ5 P;  1YJW P;  1Q86 Q;  3I55 P;  1VQ9 P;  3G4S P;  1YI2 P;  1YIT P;  1QVF O;  3CCS P;  1YJN P;  1VQ4 P;  1VQ8 P;  2OTJ P;  3CMA P;  1YIJ P;  1K9M Q;  3CCV P;  3I56 P;  1VQL P;  3CCU P;  3G71 P;  1M90 Q;  3CCJ P;  1KD1 Q;  1K73 Q;  1VQO P;  1Q82 Q;  3CME P;  1KC8 Q;  1VQ6 P;  1M1K Q;  3CC2 P;  3CCM P;  3OW2 O;  1Q81 Q;  1W2B O;  1YJ9 P;  1Q7Y Q;  3CPW O; 
#chains in the Genus database with same CATH topology
 5CZD B;  2FAE A;  2JWD A;  3H1J G;  5APQ A;  2FQ2 A;  4XRQ A;  2QM7 A;  3Q1M A;  1LTJ C;  1HBW A;  1SQV D;  2N98 A;  5B66 H;  3FGA D;  2KNC B;  1M90 Q;  2WT7 A;  1LWU B;  5I4T G;  3FWL A;  3LMO A;  3GHG C;  1IK9 A;  2P9X A;  2KYV A;  2XND H;  3P8C D;  5KLV E;  3PJS K;  2XV6 A;  5HVC A;  2ITA A;  3U1A A;  1FZC C;  3KZI E;  3HRN A;  2KWL A;  5KKZ C;  3L73 J;  2P67 A;  1D7M A;  2WPQ A;  3L71 J;  1L0N D;  4BXL A;  1ZOY C;  3E1I A;  1CEI A;  2OYH B;  1S9K E;  1SQB E;  1SQB J;  3AE3 C;  1SQV J;  3AEG C;  2YXR B;  5GTH E;  1NQ4 A;  2ZVN B;  1H89 A;  2NPS A;  3H1H J;  4U0C A;  2N5H A;  3TSI A;  2L22 A;  5KLV J;  2WSF H;  2OQQ A;  1VQ4 P;  2PEI A;  4H2W C;  2D2C C;  1GW3 A;  4NPF X;  2JB0 A;  1EIA A;  4L74 A;  2CNR A;  1G1I A;  2Q3I A;  2HR3 A;  1YQ3 C;  5AW7 B;  3GF7 A;  5AVT B;  2BAS A;  2RMZ A;  3AEA C;  2XU6 A;  1FZA A;  3H1H E;  1L0N J;  3MUD C;  1VDF A;  1P84 I;  1EXI A;  5CCG D;  5KP6 B;  2HG5 D;  5B5E H;  2RKL A;  1RQU A;  1HGV A;  1Q90 D;  1VQK P;  2AXC A;  1EDL A;  1YJW P;  2XDJ A;  2KNC A;  1YYC A;  2R44 A;  1F80 D;  1LT9 C;  2E76 C;  2JDI H;  5DJU B;  1JY3 P;  3KPE A;  4JYC A;  2FXM A;  2W8Z A;  4YXD C;  1L0N G;  2L4B A;  3WMM 0;  5DCK A;  1N7S D;  3CCE P;  3T97 B;  3KZI H;  2N5I A;  1ZMB A;  3I5C A;  2XV5 A;  2LKM A;  2KGC A;  1Z6M A;  2H88 C;  3MZW B;  5AW2 B;  5AW4 B;  4W7Y A;  1JM0 A;  1NU1 J;  1PGJ A;  1PEU A;  3L74 J;  4C7N A;  2YO3 A;  2WWW A;  3VMX A;  1RE3 C;  1NH4 A;  1RQV A;  1UIX A;  1URQ D;  3B5N C;  3OJA B;  3G9R A;  1RF1 C;  3TF5 A;  2I1K A;  2JO1 A;  2LOL A;  2Q9I A;  2M8N A;  1PPJ E;  4HYT B;  3V2P A;  2R5B A;  5EFW B;  1RE4 C;  1SQP D;  1R5L A;  4MN4 C;  1JB0 J;  1IC2 A;  2IZ0 A;  2OAR A;  3WU2 E;  3H0D A;  2A06 G;  2MD9 A;  5BU8 B;  1J1E B;  3QH9 A;  3G4S P;  1USE A;  4UHP B;  5CMZ A;  3GZL A;  1FC2 C;  1SQQ K;  4PV1 C;  3AE4 C;  2I1J A;  2YNY A;  2K3R A;  3AE6 C;  2YKP A;  1CZQ A;  4C46 A;  1VKU A;  1RY3 A;  1KYO E;  2KS1 A;  4R4L A;  1Q86 Q;  2KZI A;  1KYO I;  4UB6 E;  1OX3 A;  1PIX A;  2Z5I A;  4IZ6 A;  2QJY C;  3G29 A;  1PGQ A;  2H43 A;  5AW8 B;  4GR6 A;  1WT6 A;  3IAO A;  1T8K A;  1NHL A;  3CX5 D;  1KN7 A;  2CGQ A;  1UNK A;  3L72 E;  1Z56 A;  1A02 F;  3GZM A;  1NTZ E;  4H44 B;  1L2P A;  7CEI A;  4C7N B;  2W27 A;  1JEK A;  2N6Y A;  3H1I G;  1EMV A;  2FAD A;  4NEO A;  1FZE A;  1YHQ P;  1JY2 O;  2CG5 B;  1IFP A;  1SQV K;  3BCC G;  1HJB A;  2OYI A;  2QJK B;  3H1I D;  1URQ B;  4B86 A;  1L0I A;  4I7Z C;  4D6T G;  1SFC A;  3EJE A;  3MIW A;  3ABV C;  3TNU B;  1LTG C;  4ZMD A;  2BCC E;  1VF5 B;  2W6A A;  3H1J E;  3H1K E;  3CCL P;  3TGU G;  2KK7 A;  3U59 A;  5HGM A;  3W67 A;  2MVV A;  3SWY A;  1KV4 A;  1KIL E;  2FFD A;  5APW A;  3DS4 A;  5AVU B;  1U7J A;  3A3Y B;  1HF9 A;  2QG4 A;  2QM8 A;  5GTI E;  2VRS A;  3E1R A;  4H13 D;  1NTK K;  1NU1 E;  2WTY A;  2PRR A;  3DS5 A;  1AYI A;  1D1D A;  1JY2 N;  4BRY A;  1HQB A;  1YBK A;  1FZC A;  1GK6 A;  2Y9Z A;  1X22 A;  1SFC B;  2BEQ D;  3TK1 A;  2MR8 A;  3PLN A;  1PEM A;  2AXT H;  2HOD A;  2Z46 A;  3G71 P;  1CW5 A;  1LP1 A;  1R5S A;  3SFE C;  1Q2N A;  3L70 G;  2KZJ A;  4PV1 D;  2CPS A;  1FOS E;  1IK7 A;  2AFE A;  1MKM A;  1VHN A;  1N7S B;  1N73 C;  2XZ1 C;  3H1L E;  2NPS C;  2EHS A;  4WY4 C;  1AV1 A;  2OTK E;  4W7Z A;  2IBZ G;  3PTZ A;  5M1B A;  1PP9 E;  4AYC A;  2WPV B;  1YI2 P;  2IBZ D;  1A02 J;  1RHZ B;  2N9B A;  2XKM A;  4BPG A;  1BAJ A;  3Q5R A;  1L0L G;  2L6E A;  1NTM D;  4I2L C;  1KC8 Q;  2M5R A;  3HUS A;  2WSF J;  2P1J A;  4IL6 H;  1L0N E;  5KJ7 A;  2WMM A;  1EZV D;  2GZI A;  1QEX A;  1JJ2 O;  5C39 A;  2WT7 B;  3VMA A;  1VQL P;  2WZ7 A;  2AVA A;  5BU5 A;  5KLV K;  2LF4 A;  2LTE A;  1T8Z A;  2GDX A;  3H1I E;  5AW9 B;  1E79 H;  1S2E A;  5TIS E;  2Y0D A;  2QEX P;  3T97 A;  4KHX A;  2KOG A;  3G28 A;  1LTA C;  3I55 P;  2KR5 A;  2NRG A;  4NPD A;  3V2R A;  2K5X A;  2O1J A;  2Z44 A;  1FZC B;  3VTP C;  4U3F D;  3L72 D;  2VSQ A;  4IFM A;  2GDY A;  1VQ9 P;  1M8O B;  1N86 A;  2JR8 A;  3V4Q A;  1PP9 J;  4U0F A;  2AFD A;  1YIJ P;  5AW5 B;  3RK3 B;  1NOH A;  4U3F G;  1YTZ I;  2JKV A;  3H1L J;  1HGZ A;  1GZL A;  4PD4 E;  3RBX A;  1GXH A;  5CBN A;  1SQB G;  1WRG A;  3C1L A;  3TYY A;  4JPZ B;  4UB8 E;  4QMA A;  2IYO A;  2M3B A;  2J58 A;  2FYU D;  2H7H A;  1SQP J;  1L4A B;  4Y28 J;  4F37 A;  2M5A B;  3H1L G;  3M0D A;  3CCM P;  2YKO A;  4U0E A;  1SQP G;  1KFM A;  4COC A;  4U0A A;  4K3A A;  3CX5 H;  1JUN A;  4RES B;  1OMI A;  3DTJ A;  2IFN A;  1MUU A;  1NU1 K;  2K2Q A;  3HE5 B;  2BCC D;  1DV5 A;  3AEF C;  4U7J A;  3AE7 C;  4PWV B;  1ZV8 A;  1DEE G;  1IFJ A;  1KQS O;  3L4F A;  4GDO A;  1OWA A;  1LT9 B;  1U7M A;  3GLM A;  2GUS A;  1RH5 B;  5CBO A;  4JQ0 D;  1FZB A;  4L76 A;  3NTE A;  4O9B A;  2FYU J;  3EJD A;  1GMJ A;  3RK3 D;  3TGU J;  1NYH A;  2K93 A;  2HPC A;  2SPZ A;  2C0X A;  2V7Q J;  2MKV A;  2WSE H;  2QJP C;  1M1J B;  1ZW0 A;  1M6E X;  2FYZ A;  1DD3 A;  1EZV I;  3P05 A;  3MP7 B;  3MUD A;  1S5L E;  2FYU G;  5AW3 B;  2Y0E A;  4GOF A;  4IL6 X;  1MZ9 A;  1K8A Q;  3B71 A;  4UB8 H;  1A8O A;  1RF1 B;  2IZ1 A;  5KLI B;  5AVR B;  1NWQ A;  1SLQ A;  3H32 B;  3NXS A;  4I6M C;  2FFD B;  2R3S A;  1K73 Q;  1YTZ T;  4GR2 A;  4K35 A;  3TGU D;  2JU1 A;  3R4Y A;  2JU2 A;  3M1M A;  3H1H D;  1RO2 A;  5KAF E;  3CWB E;  1IFN A;  3AEB C;  1KQG B;  2JJL A;  1VQ5 P;  1LTT C;  4XFX A;  2KOR A;  4COP A;  1JCD A;  3U43 A;  1EDJ A;  4H2Y C;  1N2D C;  3CL3 D;  3LW5 J;  2R32 A;  1OIP A;  1KIL D;  2J5U A;  1MZ8 A;  4RKU J;  1FDI A;  4Y99 B;  3M0A A;  3L70 J;  3B8E B;  4DCK A;  2PEQ A;  1NKN A;  3A0H H;  3N4X A;  2O3J A;  2KG6 A;  5BS2 A;  5BS1 A;  2QE7 H;  4U0D A;  3O8Z A;  5K5G B;  2YKQ A;  5CJ0 A;  4OGQ D;  1JOC A;  1K05 A;  1K04 A;  3RBZ A;  3L75 E;  3WUU A;  3RG6 C;  3AE1 C;  4WBA A;  1BGY J;  2KG9 A;  3AE5 C;  2O01 J;  3RK3 E;  1URQ A;  2E5T A;  1JO5 A;  1IJD B;  1NTK J;  3M9H A;  2HLO A;  1L0H A;  2FKW B;  3NFQ A;  5F2N A;  2E43 A;  3CXH H;  4JBZ A;  3V2N A;  1Y8A A;  2MF4 A;  3PH0 A;  1FR2 A;  3HUS C;  3H4E A;  2OTL P;  1AQ5 A;  2H89 C;  1GL2 A;  1IFI A;  4ASW A;  2N1T C;  3CXH D;  4EIJ A;  3LRY A;  1FOS F;  2KB7 P;  5DJT B;  2B89 A;  3BCC E;  4H13 C;  1X0T A;  2BQ1 E;  1KQF B;  2ZJS E;  2DW3 A;  1YJ9 P;  5CCH D;  3G26 A;  1GW4 A;  2PEM A;  2V4H A;  3L35 A;  3DPH A;  1NTK G;  1SP4 A;  2K0D X;  5KAF H;  1DEB A;  3IN6 A;  3HE5 A;  2P7J A;  1UJZ A;  1M7L A;  2ZXX A;  1KD1 Q;  4GOD A;  4HH2 A;  1OVR A;  1IMQ A;  1NTZ K;  1PV3 A;  4XFJ A;  2WSE J;  4W80 A;  5HGL A;  1GK4 A;  2W83 C;  1GPJ A;  2NPS D;  2O01 H;  4NPE A;  3L75 D;  3EJB A;  1SQX J;  4H44 D;  5KJ7 D;  2WPT A;  4PD4 H;  1SQP E;  1HWT C;  2L91 A;  3P8M C;  1T2K D;  5F2O A;  1KTM A;  1N73 B;  3RK2 B;  1NKZ B;  2NPS B;  2EHT A;  2IDB A;  1S9K D;  2NO8 A;  1G1J A;  3Q20 A;  5HGO A;  5HGN A;  3A5T A;  4H0L C;  1SVF A;  3G3Z A;  1SQQ J;  2MY5 A;  2A45 G;  1FZF A;  3L71 E;  1RF0 C;  3EFG A;  3SFD C;  3L73 E;  4AUW A;  3CMA P;  1P84 E;  5CJ4 A;  4CPG A;  1M57 D;  1SQQ E;  2MR7 A;  1AJY A;  2K9J B;  2H8P D;  2WVR A;  4CA3 A;  1FU1 A;  2E42 A;  2KLV A;  1RE3 A;  1MFT A;  4OH8 B;  2KOS A;  5AVY B;  3PP5 A;  1DH3 A;  4EDF A;  2E75 B;  2PAJ A;  2BCC J;  3M9Q A;  1YJN P;  3DS1 A;  2OTJ P;  2Q5U A;  1GXG A;  2KGA A;  3KXD A;  4M3L A;  3GHG A;  2A06 E;  5KTB A;  4JF7 A;  2FAC A;  1EQ7 A;  3HD7 A;  1S4X A;  3RL0 D;  2LPK A;  1WMK A;  2N9Y B;  2FVF A;  2PEK A;  2GZG A;  3H1K D;  5CCH A;  2M8L A;  1PGO A;  1PP9 D;  1YQ4 C;  2I8D A;  1IFD A;  1NTZ G;  4RO0 A;  1KIL B;  2Q7C A;  1L0L J;  2QSI A;  2NZ2 A;  1P84 D;  1M6N A;  3V6I A;  1LTJ B;  3CC7 P;  2KOO A;  3EFF K;  1NTM K;  1BXI A;  2K0X A;  2MJZ A;  1MFZ A;  2FYN C;  2KSE A;  2GZF A;  2K0Y A;  1R8E A;  4PXH B;  4U0B A;  1G2C A;  4D6T E;  4DT0 A;  4Z1M H;  3CX5 E;  1NAF A;  2IX7 C;  3HD7 B;  5KLV G;  3GJN A;  1LTI C;  5EJD A;  1KB9 H;  2OYH C;  2LXB A;  2FXO A;  2LML A;  1BGY G;  5AVV B;  1CSB A;  1QL1 A;  2CK3 H;  2HOD B;  2Y0C A;  1PEO A;  1KLP A;  1L0L D;  1NTM G;  3CWB J;  5TIS H;  3CXH I;  3N7N A;  2POH A;  3O6Q A;  3L72 J;  2HFE D;  3TDK A;  4WYM A;  1SQQ G;  1NTM J;  1LT9 A;  2KOQ A;  3FWN A;  5CCG C;  1EDK A;  1GU4 A;  1QRJ A;  3K5B A;  3AE8 C;  3HTK B;  2KIK A;  1HH0 A;  3L70 E;  4HJG H;  2WPR A;  3MGE A;  3II6 A;  1GU5 A;  3L36 A;  5KKZ B;  3CCV P;  2FHS C;  2ZT9 B;  2ZT9 D;  2GZE A;  1S5L X;  1BSH A;  1AVO A;  2Z4E A;  1ZRT D;  3B5N A;  1IUQ A;  2MVU A;  3USS A;  2JAZ A;  2LKI A;  1ZR2 A;  3D6Y A;  2E74 B;  1JCC A;  4N78 D;  5APU A;  1U57 A;  2FVA A;  2D2C B;  4WVZ A;  3A2A A;  2ZYG A;  3H1K G;  3G1G A;  4RJT A;  2G8Y A;  3SWF A;  4EOT A;  1L0L E;  2GYK A;  1YIT P;  1KQL A;  4TT3 H;  1Q82 Q;  3VMZ A;  1DD4 A;  1IZN B;  1W2B O;  3CI9 A;  1IMP A;  3GF3 A;  2DGY A;  1E5W A;  3RL0 B;  4IOI H;  5KJ7 C;  3A7O A;  1N7L A;  4YTP C;  3OAK A;  5AVZ B;  2WPS A;  1BE3 J;  4EI2 A;  5APX A;  4Y99 C;  2ONT A;  1JMB A;  2AXT E;  2M0B A;  2E76 B;  1QL2 A;  1J1D C;  2W90 A;  2ZFC A;  3LID A;  1ZP0 C;  1VQP P;  3P7K A;  3G1I A;  4EYY Q;  1AFO A;  5APT A;  3E7K A;  4WB4 A;  2VLP A;  3M91 A;  3S4R A;  2XZR A;  4MRT C;  2GM4 A;  1T6A A;  2ERH A;  4N78 E;  2K94 A;  1SQP K;  3KHU A;  1FS0 E;  1GD2 E;  1M56 D;  4WWI A;  1SQB K;  3ZDM A;  1W2E A;  3IR9 A;  2IFM A;  1LWU A;  5H2F E;  5E79 E;  4WY4 D;  3GG2 A;  2LIU A;  2L0Q A;  3L75 G;  3L73 G;  2N1T D;  2Q3E A;  4KJM A;  5AVX B;  1BDC A;  1EC5 A;  4N3Y B;  2OYI C;  1AF8 A;  5AVS B;  3L37 A;  1KB9 D;  3B5N B;  4ZKP A;  2A06 D;  3H1I J;  1G2C B;  2WSC H;  1OW8 A;  3Q3D A;  1PZQ A;  4GIF A;  3F5H A;  1EXJ A;  1M1J A;  3U1C A;  3BVH A;  2HPC B;  1SQX E;  3H1J D;  1VQN P;  4YXW H;  2ZYD A;  1PP9 G;  1ZXG A;  4HKZ H;  3D70 A;  3SSU A;  2E75 D;  2QVA A;  1OVU A;  4C7R A;  1J1E C;  3CCS P;  1VQ8 P;  3L74 D;  3CCJ P;  4OGQ B;  1FAV A;  4H2X C;  3NY7 B;  1X3O A;  3KDP B;  4PV1 B;  3QWO C;  2PP6 A;  2KSJ A;  3CCR P;  3RG2 A;  2W6J H;  1L0N K;  2KGD A;  3RL0 g;  5APY A;  1URQ C;  5CCH C;  1JMM A;  4I7Z B;  2Q6Q A;  2Q1K A;  1LTJ A;  1RF1 A;  1X9V A;  2B87 A;  1H0T A;  1NO4 A;  1VF5 C;  1NTZ D;  2C0W A;  3OA7 A;  2P2U A;  1JY2 P;  1PGP A;  1BCC G;  4H0L D;  2LIW A;  3AED C;  4HB1 A;  3CLQ A;  1N73 A;  2QJY B;  1NAY A;  4GOE A;  1HUC A;  4D6T D;  3GKL C;  1GL2 C;  2IBZ I;  2N50 A;  3RK2 C;  4H44 C;  3H1L D;  1BCC E;  1PL5 A;  2K92 A;  1K30 A;  3DS3 A;  1VF5 D;  4R0M A;  1KMI Z;  3AEC C;  3KQG A;  5APV A;  2GUV A;  4IFD K;  2ROQ A;  2BUO A;  1VL2 A;  3VOP A;  3CXC O;  2BEZ F;  3CWB G;  3L75 J;  1Y47 A;  1FJP A;  1NGM B;  4R4M A;  4U3F E;  2PFX A;  2QJK C;  3L74 G;  1CI6 A;  3LIE A;  1KOR A;  1NU1 D;  3A0H E;  5B66 E;  5EW5 E;  4DZO A;  2X2B A;  4XFY A;  2JGP A;  3HYB A;  2JO0 A;  3GMA A;  2EIA A;  3E2D A;  1S72 P;  2CPB A;  3BCC J;  2E75 C;  1NTK D;  1E6J P;  1SS1 A;  1ZN5 A;  3CX5 I;  1W5C E;  1BE3 E;  1LP1 B;  2G3A A;  1VPC A;  2E1M A;  2B9B A;  1DNY A;  4BPF A;  3MTU E;  5JPA A;  5CCG A;  1FBM A;  2D2C D;  3V5B A;  3WUT A;  2DNW A;  2FBW C;  4ZKU A;  2P10 A;  5GTI H;  2IPP A;  2ZYA A;  1ZR4 A;  2B87 B;  1RNI A;  4L73 A;  2LL8 A;  3RGU A;  1NTK E;  3DS2 A;  2QNW A;  2FVE A;  3L70 D;  3WU2 H;  1SFC C;  1ZNV A;  3JC2 2;  3VMY A;  2AEM A;  1DIP A;  1LGH B;  1S1C X;  2FQ1 A;  1S3J A;  4LC1 A;  1S5L H;  1KYO H;  2YXQ B;  2BHV A;  1XTC C;  4WY4 B;  1MV8 A;  2FQ0 A;  2PY8 A;  2VLQ A;  2FYN B;  2A45 I;  3B5N D;  3EWK A;  4GKG A;  3MGN A;  1USD A;  5GTH H;  1AA0 A;  1UII A;  2YMY A;  4TLF A;  2FXP A;  3M0D C;  3CC2 P;  4GT1 A;  5B5E E;  1T3U A;  2CWO A;  4ASV A;  1VQM P;  3HD7 C;  4XRO A;  2JP3 A;  2QA4 P;  1GL2 D;  2YIU C;  2M8P A;  3A0B H;  3CWB D;  4XFZ A;  3RK3 C;  3P32 A;  3TGU E;  1AUM A;  1E0H A;  1JY3 N;  2Y9Y A;  1KB9 I;  2K1A A;  3G21 A;  1Q81 Q;  1OXZ A;  2LR2 A;  3D71 A;  1ACP A;  4WY4 A;  2KLU A;  3B5I A;  4IPY A;  2O01 N;  1FDM A;  3HTK A;  2LXC B;  1L4A C;  2XZ0 D;  3B4S A;  2JWA A;  3H1H G;  3UIA A;  5AW1 B;  2JYG A;  4XA4 A;  4PD4 D;  1HVV A;  1ZRT E;  3VP9 A;  1OVV A;  3L74 E;  2K37 A;  2A45 H;  3A0B E;  2VLN A;  3NMD A;  4M0I A;  3Q2Y A;  2M8R A;  2XNX A;  3Q5P A;  4BPH A;  2KUB A;  2GZJ A;  1SQB D;  1AVY A;  2IYP A;  1BCC J;  1FE6 A;  1QGK B;  1SQX K;  3IF4 A;  2ZT9 C;  1OZH A;  3D6Z A;  1H0T B;  2Z5H A;  4ZNC A;  3AEE C;  4BRY B;  3B4Q A;  1LWU C;  1KB9 E;  2CQ8 A;  3GHG B;  2O1K A;  3HD7 D;  1GDT A;  2J59 M;  1M74 A;  2QRX A;  2QIW A;  2E74 C;  2AEJ A;  1EZV G;  1KIL A;  1HTL C;  2E5Y A;  2PGD A;  2KOP A;  1X8Y A;  5AVQ B;  1SQQ D;  2QJP B;  2JBG A;  2L9F A;  4U3F J;  1M1J C;  2PEN A;  3NTN A;  1H88 A;  4OWF A;  2JYL A;  1OW6 A;  2V7Q H;  4A7P A;  3F89 A;  2K9J A;  3KYQ A;  3L73 D;  3CD6 P;  1N7S A;  3S9O A;  2N6Z A;  1RF0 A;  2XT1 A;  3VN0 A;  2C9N Y;  1BSN A;  1T2K C;  2HYN A;  1XTG B;  5L8R J;  2ZVO B;  1EDI A;  4PJ0 E;  4UB6 H;  4OVN F;  3CPW O;  3SWK A;  3RL0 C;  2XXM A;  1LNQ A;  3PHL A;  2BCC G;  4I1L A;  1OW7 A;  2FY8 A;  1LT1 A;  4JYB A;  2FFD C;  3GW6 A;  1ZLL A;  4QKO A;  1J1D B;  3CME P;  5KP7 B;  1LTS C;  2VLO A;  2B88 A;  1Q7Y Q;  3O6Q B;  3CC4 P;  2YMK A;  3CCQ P;  4AQR D;  1L4A D;  1SQX D;  2W6B A;  3BAS A;  3IFM A;  1X79 B;  1A43 A;  1FJK A;  2K88 A;  4L75 A;  3AE2 C;  1JNM A;  2WSS H;  3BRV B;  4LGD E;  3BCC D;  3BAT A;  2OYI B;  1NJI Q;  3L72 G;  1P84 H;  5F2K A;  3MHV A;  3AE9 C;  2AF8 A;  1OR5 A;  1QX8 A;  1LTB C;  1PFI A;  5KLI C;  1JTH B;  1IFM A;  1NU1 G;  1VQO P;  2AEF A;  5KAI E;  1FDO A;  2EG5 A;  2RH0 A;  5AW0 B;  1SQV E;  3L71 G;  2C9L Y;  2OYO A;  5AW6 B;  2OYH A;  1BGY E;  2JQ4 A;  2Z45 A;  4OGQ C;  1KFN A;  1K9M Q;  2P58 A;  2KOD A;  2GA1 A;  2KP8 A;  3EQ2 A;  3FXE A;  2KG8 A;  3C8V A;  3JSV C;  3FX0 A;  2KGE A;  3MD0 A;  2N1T B;  4QNB A;  1Y9B A;  3H1K J;  3JCU E;  3H1J J;  4KT0 J;  1NVO A;  4N6J A;  1EOQ A;  2JEE A;  1JTH A;  3VP8 A;  1GL2 B;  4PH1 A;  2FYU K;  1KYO D;  1BE3 G;  2KXP B;  3VRL C;  3W68 A;  5CHX A;  4IFF A;  5H2F H;  1L0L K;  1CI6 B;  3H47 A;  3R2P A;  1DX7 A;  1PPJ G;  4XE5 B;  3LW5 H;  1M1K Q;  1OFC X;  1NTZ J;  2WIT A;  3CE7 A;  1TU3 F;  2M3E A;  3CXH E;  1QVG O;  3HUS B;  3BRT B;  1SFC D;  3TNU A;  2KS1 B;  3P8C E;  2E74 D;  4PH0 A;  3I56 P;  5KLV D;  3DS0 A;  1PPJ D;  1QLE D;  4IL6 E;  2EFJ A;  4H0L B;  4H13 B;  3VYI A;  4LLH A;  3RK2 D;  3FXD A;  2OGU A;  1N8R Q;  1L4A A;  4DJG A;  4HKG A;  2L5G B;  5TJH A;  1JY3 O;  3WBH A;  2PEO A;  1RE4 A;  1BGY D;  1RO0 A;  3ITK A;  5E79 H;  1EZV E;  1GTW A;  4PD4 I;  1SQV G;  2YO2 A;  1VQ7 P;  2E76 D;  3HE4 A;  1HY8 A;  1J2J B;  1HJ0 A;  3PRJ A;  1BDD A;  2PEJ A;  1KZU B;  2KI7 B;  3JCU H;  2GDW A;  1NTM E;  2N1T A;  3S1K A;  2IBZ E;  5KP8 B;  3CCU P;  3H6P A;  4DOJ A;  1AQT A;  2K9Y A;  3G6E P;  3L71 D;  4DG9 A;  4YPC A;  4BWN A;  2WSC J;  1SQX G;  3M9B A;  1H8A A;  2R5D A;  1KIL C;  3H25 A;  1ZME C;  2R3C A;  2M5A A;  2PNG A;  2ZXE B;  3OW2 O;  4D6T J;  3M06 A;  2YIU B;  3V2Q A;  3C9I A;  1N7S C;  2FYU E;  2RN0 A;  1BCC D;  3WUV A;  1IO4 A;  4PJ0 H;  1VQ6 P;  2KW2 A;  2WQY C;  5AVW B;  1FZG A;  2UWJ E;  3H32 A;  3G0V A;  1T3J A;  5BVZ A;  1PEQ A;  1QVF O;  5KAI H;  5HV8 A;  2ZAE B;  3Q5S A;  1BE3 D;  3HZQ A;  3V4W A;  5APS A;  3HE4 B;  1LJ2 A; 
#chains in the Genus database with same CATH homology
 3HYB A;  2Z44 A;  2JO0 A;  2XXM A;  3Q20 A;  3DS5 A;  2EIA A;  5HGO A;  1VQ7 P;  5HGN A;  3E2D A;  1S72 P;  3G1G A;  1D1D A;  1VQN P;  3B5I A;  1E6J P;  4IPY A;  1M6E X;  4QNB A;  1VQK P;  2PEJ A;  4XRQ A;  1YJW P;  1Q86 Q;  1VQ9 P;  3P05 A;  1YIT P;  3CCS P;  4U0F A;  1VQ8 P;  1PEM A;  2E1M A;  2JYG A;  5F2N A;  3CMA P;  1YIJ P;  2Z46 A;  3G71 P;  3CCU P;  1M90 Q;  3CCJ P;  1Q82 Q;  3CME P;  1EOQ A;  5I4T G;  5JPA A;  3G29 A;  1W2B O;  2P9X A;  1Q7Y Q;  5DCK A;  4GR6 A;  3H4E A;  3CCR P;  4M0I A;  3CCE P;  3G6E P;  2XV6 A;  2OTL P;  1PEO A;  2DGY A;  1K8A Q;  4PH1 A;  1A8O A;  3CC4 P;  1RNI A;  3CCQ P;  3VRL C;  1ZMB A;  4WYM A;  3DS2 A;  1YI2 P;  3H47 A;  3LRY A;  1YJN P;  3DS1 A;  2OTJ P;  1BAJ A;  1A43 A;  2ONT A;  2L6E A;  2BQ1 E;  1K73 Q;  1KC8 Q;  1M1K Q;  4GR2 A;  3CCM P;  1PEU A;  1QRJ A;  1YJ9 P;  3OW2 O;  3M1M A;  1YHQ P;  1RO2 A;  4U0E A;  3G26 A;  2PEM A;  1VQP P;  3G1I A;  1NJI Q;  1QVG O;  2BHV A;  2PEK A;  4U0C A;  3DPH A;  5F2K A;  4COC A;  4U0A A;  2PY8 A;  1M74 A;  1JJ2 O;  3MGE A;  1VQ5 P;  2M8L A;  4XFX A;  3DTJ A;  2M8N A;  4COP A;  1VQ4 P;  2PEI A;  4PH0 A;  3CCV P;  3I56 P;  1VQL P;  3DS0 A;  1KD1 Q;  1EIA A;  1K30 A;  1VQO P;  1VQ6 P;  3CC2 P;  3DS3 A;  2CWO A;  2EFJ A;  2EG5 A;  2LF4 A;  1VQM P;  3CCL P;  2PEQ A;  2PEN A;  5HGL A;  2JYL A;  1M6N A;  1KQS O;  4XRO A;  2OAR A;  5HGM A;  1N8R Q;  3G0V A;  5BS2 A;  5BS1 A;  2QA4 P;  3H0D A;  3CD6 P;  2QEX P;  3CC7 P;  2BUO A;  4U0D A;  3CXC O;  1IUQ A;  2M8P A;  3G28 A;  1PEQ A;  3I55 P;  3DS4 A;  4XFZ A;  3G4S P;  2Z45 A;  2XT1 A;  1QVF O;  3WBH A;  2PEO A;  3NTE A;  5F2O A;  1AUM A;  1K9M Q;  1RO0 A;  2KOD A;  3HZQ A;  3RG6 C;  3G21 A;  1Q81 Q;  4XFY A;  4U0B A;  3CPW O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...