3CMAP

The structure of cca and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Peptidyl-CCA deacylation on the ribosome promoted by induced fit and the O3'-hydroxyl group of A76 of the unacylated A-site tRNA.
pubmed doi rcsb
molecule tags Ribosome
total genus 48
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2008-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3cmaP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 3cmaP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 3cmaP02
3CCQP 1Q86Q 1N8RQ 3OW2O 1VQ8P 1YITP 1YJWP 3CCLP 1KD1Q 1K8AQ 3I56P 3G4SP 1VQ7P 1KQSO 3CCRP 2OTJP 1NJIQ 1VQPP 1VQOP 1YHQP 1W2BO 3CMAP 1YI2P 1VQLP 2QEXP 1Q81Q 3CC2P 3CCVP 3G6EP 1YJ9P 2QA4P 3CCJP 1M1KQ 3CPWO 1YJNP 1Q7YQ 3CD6P 3CC7P 3G71P 1KC8Q 1VQ5P 1VQ4P 3CCEP 1VQNP 2OTLP 3CCMP 1Q82Q 3CC4P 1M90Q 1VQ6P 3I55P 3CMEP 1QVFO 1K73Q 1YIJP 3CXCO 1K9MQ 1QVGO 1VQKP 1JJ2O 1VQMP 3CCSP 1VQ9P 1S72P 3CCUP
chains in the Genus database with same CATH superfamily
4UHPB 1KYOH 3E7KA 1RE3A 2LXBA 1ZNVA 2OTJP 4HJGH 2K9JB 1YQ4C 4UB6H 2BCCD 5KJ7C 2KORA 1KILD 2ERHA 2KLVA 1M1JA 3HE5A 4YPCA 2IBZG 2D2CC 3L73G 3GF7A 3IFMA 2ZT9B 5I4TG 2QIWA 3H1JG 3PRJA 1KB9E 1KFMA 4GT1A 2JYGA 3N4XA 2WPVB 2J5UA 2WITA 2WVRA 4W7YA 2H7HA 3NMDA 3GF3A 2WPTA 4K3AA 2XKMA 1L0LE 2JU2A 1PPJE 2YMKA 4O9BA 5E79H 4I7ZC 3L71J 1FU1A 3RK3B 4UB8E 2PP6A 1JCCA 1OZHA 3MZWB 1N7SB 1VPCA 2A06D 1GL2A 3OAKA 5AW7B 5C39A 4GOFA 3BASA 5CCGC 2K9YA 4YXDC 1L0NE 1JY3P 3LRYA 2P10A 3RBXA 1ZRTE 5CMZA 3P8MC 1LT1A 1LTIC 2OQQA 2A45H 2QG4A 2RN0A 1NU1J 1SQVJ 5TISH 1N86A 2NPSB 3GHGA 4WB4A 2IX7C 4JF7A 3VMXA 1L0LG 3Q3DA 1PPJG 2PNGA 1Q86Q 1LTAC 3OJAB 1FZBA 2QJYC 3PTZA 4D6TJ 4PJ0H 3DTJA 1J2JB 1Y47A 3SWFA 4JPZB 3HUSB 1M1JB 4IZ6A 4OVNF 4H2WC 1YYCA 2KGCA 2WMMA 1PP9G 1L0NG 5EJDA 3D6ZA 1QVGO 3RL0C 1BDDA 3V6IA 1CSBA 2Q6QA 1SQXK 3A7OA 4I2LC 1HBWA 3MP7B 5KAIH 2P9XA 3G71P 2CQ8A 1EOQA 3LW5J 3B5IA 3Q5SA 4H2XC 4BPFA 3H1IJ 1BCCE 2J58A 3RK2C 3EWKA 3M9QA 2VLPA 2OYOA 1JCDA 3LW5H 2B87A 1BE3J 1AQ5A 4B86A 1VQNP 1LWUA 3I5CA 2ZVOB 4U0BA 1KQLA 4PH1A 3TGUJ 2VLNA 3EFGA 2YKQA 3SWYA 4PWVB 5DJTB 2E42A 3GHGB 2P7JA 1W2BO 1PGPA 3RK3C 1HQBA 1S5LH 5L8RJ 1KILB 3IR9A 2IBZD 2CPSA 3VMZA 2XT1A 1PEMA 1BCCG 1N7SC 5KLVD 3L73D 2JYLA 3H1JD 5AVXB 3RG6C 5CJ0A 1PEQA 1FZGA 4DOJA 2QE7H 3L71E 1DD3A 4NEOA 5DCKA 3AE4C 1OVVA 2NPSC 3P7KA 3LIDA 5K5GB 1RE3C 2WZ7A 4L76A 1G2CB 1OIPA 4WWIA 2EHSA 2XZRA 1L4AA 3H1LJ 2ITAA 4HKGA 1AA0A 2IDBA 1E6JP 4BRYA 1NTKJ 1G1JA 1M1JC 2XDJA 1SQVE 2KR5A 2XNDH 2FAEA 2NRGA 3G28A 2NO8A 2QA4P 2XNXA 1BDCA 3CCEP 1KB9D 2WT7B 5APWA 1JY3O 4C46A 3DS1A 5KKZB 1FZFA 1EZVE 4D6TE 3CWBJ 3L71G 3GLMA 3EJEA 2W83C 1X3OA 3H1HJ 4A7PA 1RNIA 5KP8B 3U59A 2R5BA 2IYOA 1PGQA 1LNQA 1NGMB 2QM8A 5CCHC 1DD4A 2MF4A 1VQ6P 1MZ9A 2WSCJ 3L70J 3CXCO 1SQVG 3WBHA 4LLHA 3MIWA 3FGAD 2M3BA 1S9KE 1IFIA 1HVVA 3HE4A 4N78E 1PP9D 3CC2P 1L0ND 3EJBA 3GJNA 2WSCH 1EZVG 3NXSA 5M1BA 3AE3C 2R3SA 4XROA 3CC4P 3H25A 3CXHD 2YIUB 2FHSC 1M56D 1VHNA 3L75J 3GHGC 2POHA 1BE3E 2YXQB 2DW3A 1KILC 1L4AB 1NH4A 2AXCA 1VQ5P 1M90Q 3CLQA 3W68A 3S9OA 1ZN5A 1CEIA 1JTHA 3W67A 3WUUA 3K5BA 2M0BA 2WSFJ 5F2KA 3G4SP 3C1LA 3CX5H 2FYUG 2Y9YA 1UJZA 1SFCA 2E76B 2E75C 1NU1K 5AW0B 5AVQB 2LKMA 2WSFH 4U7JA 3L35A 1GU5A 2M8NA 4K35A 3WUTA 1HWTC 2GUSA 4EOTA 4EI2A 1BCCD 1ZXGA 2JQ4A 3H32A 2M5AB 2B89A 3LIEA 1HY8A 5KKZC 3USSA 1BSNA 3H1LE 3JC22 1ZMBA 1GXHA 2HFED 1T3UA 1NTKE 3HE4B 3GKLC 4BWNA 1KORA 3QH9A 5HV8A 3A0BE 1KTMA 2FQ2A 2R44A 4PD4E 2NZ2A 3HRNA 2AFEA 1ZR2A 1FR2A 2N5IA 2YO2A 3V2QA 1NTMK 5CCGA 4L75A 3SFDC 4H0LD 4KT0J 2R5DA 2VLQA 1UIIA 2K5XA 2MJZA 1M57D 2N1TD 4WY4D 1R5LA 3NFQA 3H1KJ 3H1LG 3L72E 2YNYA 1NTKG 1AYIA 5AW3B 2AEMA 3A5TA 3CX5I 3DS5A 2AXTH 1SFCB 1MFTA 2PEJA 1OFCX 2ZXXA 2KG9A 1L4AC 1H0TA 3AEAC 2O01J 3F89A 1JY3N 2CNRA 2LF4A 2HYNA 3CC7P 2KOQA 1OMIA 2M5RA 3L75E 3PP5A 4Y99B 1SQQK 2K9JA 1NKZB 3L72G 1SLQA 2MY5A 3O6QB 4H13D 2K37A 3B4QA 1EZVD 2E76C 2KW2A 1JO5A 1IZNB 3CCVP 5HGMA 4COCA 1VDFA 1VF5D 3IF4A 3HTKB 2LR2A 3GG2A 2H8PD 1U57A 1ZP0C 1Z6MA 2KS1B 1K30A 2K92A 1MZ8A 2FYNB 2PENA 2O1KA 3L75G 3WUVA 1IFPA 4QKOA 1Q2NA 4N78D 1OVUA 3RL0g 2FADA 3H47A 3GZLA 4QMAA 1UIXA 2FYUD 3DPHA 4PV1D 3N7NA 3I56P 1DV5A 3CXHH 1N7SA 2E74C 4ZKUA 1P84E 1WRGA 3P05A 2WSSH 2AEFA 1A02J 1IJDB 1YTZI 2N9BA 1NHLA 2GM4A 3PHLA 1KLPA 1K04A 2NPSA 2KZIA 3JSVC 2EFJA 3A3YB 1A8OA 2JWAA 1GPJA 1GL2D 1KB9I 4IFFA 1OR5A 4L74A 1SFCC 2IYPA 4PXHB 4N6JA 4I6MC 3F5HA 3HUSA 4U3FE 1GW4A 1FZEA 3H1KE 5TJHA 1LP1A 1SQXE 4F37A 1KZUB 1URQA 1FAVA 4ASWA 4XRQA 4CA3A 4Y99C 4BXLA 3TYYA 4H0LB 3O8ZA 1VQKP 3VP9A 1HH0A 5KLIB 2XV5A 5DJUB 2N1TB 3DS0A 2YXRB 2DNWA 3MUDC 5CCHA 5HGNA 1DEBA 4OGQD 2JR8A 5B5EE 4U3FG 3KHUA 4PD4D 1HTLC 3H1KG 1SQXG 5AVRB 1X9VA 3CXHI 4U0DA 1VL2A 4OH8B 3TSIA 2FYNC 4XFXA 3JCUE 1PZQA 2PRRA 4Y28J 1BGYJ 2KOPA 2W90A 2QEXP 5KAFE 1GK6A 1FDMA 1IC2A 3L72D 5KP6B 2E43A 1LT9A 2P67A 1AJYA 3AEBC 1TU3F 2GDWA 1RO0A 2SPZA 1KILA 1T6AA 5GTHE 2QNWA 4U0FA 1SQPD 5H2FE 3PJSK 1E0HA 1VQ7P 3HD7D 3L37A 2WTYA 5B66H 5KLVK 1LP1B 1URQB 3Q20A 4C7NB 1SP4A 2FVAA 4ASVA 2QM7A 5JPAA 4AYCA 1KYOE 1G2CA 2W8ZA 3L36A 1OW6A 1X22A 2K1AA 4UB6E 2ZYGA 1USEA 1QL2A 4XA4A 3B5ND 1NTMJ 5AW8B 2FYZA 2JEEA 2PEQA 3M1MA 2XZ1C 1IMQA 2ZT9C 1AF8A 4PV1B 5EW5E 1IFNA 2WT7A 2CG5B 3GZMA 3M9BA 1PEUA 3SSUA 1FBMA 1QL1A 4JQ0D 1H88A 4KHXA 1A02F 5KLIC 1QLED 3BCCJ 2N5HA 1T8ZA 3SFEC 1RF1B 2JKVA 2FQ0A 1ZOYC 2N9YB 1VQ9P 1NVOA 1RY3A 3L74J 2OYHA 1RQUA 1J1EB 1LT9B 2HODB 2AVAA 1JM0A 4RESB 1GZLA 2KOGA 5E79E 1LJ2A 1S1CX 4GR2A 3BVHA 5F2OA 1EC5A 3P32A 2Z5HA 3MTUE 1SQQJ 1SQBJ 1JJ2O 2Y9ZA 1T3JA 5AW2B 2BCCJ 4U0EA 1A43A 1KC8Q 5TISE 2WWWA 3AE2C 1N7LA 4YTPC 1FC2C 3DS2A 1BGYE 2FBWC 1ZW0A 1FDOA 2GZJA 1NAYA 4PJ0E 4M0IA 1EZVI 3MGNA 3M0AA 2I1KA 4U3FD 4EDFA 3HUSC 3WMM0 1NU1E 3RK3E 1SQXD 1RO2A 4COPA 1URQC 3T97A 2R3CA 3U1AA 2GZFA 2KI7B 1LTBC 3MHVA 3AEGC 2A45G 2AFDA 1NAFA 2LKIA 2OGUA 4WYMA 4IL6H 3V4QA 3EFFK 3QWOC 4XE5B 5KAIE 3RBZA 1YJ9P 2VRSA 3FX0A 2MVUA 1YJNP 4AUWA 1BGYG 1L0LD 3FXEA 1PPJD 2KYVA 2JP3A 3Q5RA 5KJ7D 2R32A 2OYHB 3KZIH 3L4FA 4R4MA 2M5AA 2PEKA 1NU1G 2CWOA 2ZFCA 2RKLA 3HD7B 2KOSA 1KD1Q 2P1JA 2D2CD 3H6PA 3FWNA 1VQLP 4BPHA 2XXMA 4JYCA 1NTME 4D6TG 3H1IE 1ZRTD 1OW8A 1RF1C 3H0DA 3D6YA 3AEDC 4U0AA 2MR7A 2FXMA 1J1EC 1LT9C 1DH3A 2PFXA 2VLOA 3KDPB 2JJLA 2O1JA 4MN4C 1D1DA 3BCCE 2Y0CA 1PEOA 1NQ4A 1S5LE 2G3AA 3TGUE 2J59M 3I55P 4ZKPA 2M8PA 1WT6A 3L74E 1YBKA 3A0HH 1GW3A 1XTGB 2K0YA 2FY8A 3T97B 1NTMG 2Q9IA 1HGVA 1D7MA 3H1IG 5CCGD 3TF5A 1LGHB 2ROQA 4QNBA 1KYOD 2N98A 3M9HA 1SQQE 1AVYA 2Q5UA 2PEIA 4M3LA 3S1KA 2OYIB 4GDOA 1BE3G 1MUUA 3LMOA 1KQFB 3G9RA 3BCCG 3AE9C 1KILE 3TGUG 2ZAEB 2I8DA 3L74G 3O6QA 3M91A 4PD4I 1FZCA 1SVFA 2YMYA 3MUDA 1GU4A 1MFZA 2XZ0D 1NWQA 3CCSP 3HTKA 1RH5B 2W6AA 2HLOA 3IAOA 3RL0D 1SQQG 1ZLLA 4IL6E 3EJDA 1YQ3C 2KODA 3G6EP 2KS1A 3G3ZA 2MKVA 1CI6B 2ZXEB 5KLVJ 3L73J 2OYHC 1S3JA 3CWBE 1PFIA 3IN6A 2GYKA 1EIAA 3H1HE 3H1JJ 2QRXA 5HVCA 5BVZA 3HD7C 2BEQD 2JO1A 1JMBA 2P2UA 1EXIA 3WU2H 2DGYA 1IMPA 3RK2D 3L70E 5APYA 2YIUC 2GA1A 3L71D 2FXOA 1FDIA 2CK3H 3S4RA 1CW5A 1JOCA 2FFDB 5GTIH 3VOPA 3GMAA 2QJKB 3B8EB 3CWBG 3UIAA 2XU6A 2BASA 1VQOP 1F80D 2PAJA 3VRLC 1QRJA 2OARA 3AEEC 3H1HG 4H44D 3G26A 1NU1D 1SQVD 5AVSB 3HYBA 3BRVB 3II6A 1NTZK 2YO3A 2KWLA 1SQBK 1N7SD 5APXA 3L70G 1VQ8P 2FVFA 4D6TD 1FZCB 1XTCC 1NJIQ 1KB9H 1PV3A 3CX5E 1Y8AA 4TLFA 3Q5PA 2K0DX 2QJPB 2IFMA 2OYIC 2WSEJ 2C0WA 4XFYA 2JWDA 3P8CE 3AE8C 2KSEA 1DEEG 2P58A 4YXWH 2L22A 1LTJB 2Z44A 1PP9J 1L0NJ 3AE1C 2WSEH 1S5LX 2N1TA 1S9KD 1KMIZ 2K0XA 1GK4A 4IFDK 4UB8H 2IBZI 3VYIA 4RJTA 2V4HA 3H1ID 1YJWP 4LC1A 1EDKA 2IZ0A 1E5WA 2LXCB 1BE3D 5AW6B 4XFJA 2AF8A 2KG6A 1RF0A 5CCHD 2L0QA 2Q1KA 1JMMA 3TGUD 3E1RA 1GMJA 2XV6A 1AFOA 3L74D 2MR8A 4GODA 2QJYB 5KLVE 3L73E 5CHXA 1LTTC 1T8KA 3G1IA 5APUA 1RHZB 3PH0A 3H1JE 5AVTB 4NPDA 1R5SA 2Z4EA 5AVZB 2ZJSE 4WVZA 2JU1A 3B71A 2AXTE 1S4XA 2Q3IA 1NKNA 2QJKC 3ZDMA 1L2PA 1SQPK 5GTIE 1AV1A 3RL0B 3TNUA 3V4WA 2GZIA 2Y0EA 4C7NA 3V2NA 3G21A 4IL6X 1MKMA 1BCCJ 2L91A 2WPQA 1VQPP 1ZV8A 2KGAA 3DS3A 4DCKA 5EFWB 4DJGA 1PGJA 1K9MQ 2HPCA 5KLVG 3H1LD 1OVRA 1FZCC 1N8RQ 4RKUJ 4WY4B 3RK2B 1NTKD 1JY2P 1BAJA 1USDA 2EG5A 3VP8A 1NYHA 2QJPC 1DIPA 3PLNA 2QVAA 2B88A 1M8OB 4HB1A 2E75D 1OXZA 4KJMA 1HJBA 1K73Q 2KLUA 1ZR4A 4H2YC 3CWBD 1LTJC 5F2NA 1LTGC 3GW6A 4XFZA 2EHTA 2KG8A 3H1HD 4RO0A 5APVA 1RF1A 3U1CA 2L5GB 4LGDE 5AVYB 2KIKA 5AW4B 4H44B 3E1IA 1EDJA 5APSA 1N73A 2KNCB 1IFDA 2HODA 2ZYAA 3L70D 1EMVA 4H13B 1PP9E 1Z56A 2Z46A 1RQVA 1AQTA 1G1IA 3CXHE 1JNMA 3E2DA 1EQ7A 4CPGA 2RH0A 1VF5B 2AEJA 1M7LA 4EIJA 1KYOI 1Y9BA 2M3EA 3G1GA 3TNUB 4JYBA 3OA7A 2LMLA 2BUOA 1ACPA 5CBOA 1IO4A 1IUQA 3ITKA 5HGLA 2Z5IA 3KQGA 3L75D 2JAZA 5AW9B 3R2PA 2H89C 4IFMA 3HE5B 4HYTB 2HPCB 3CCJP 3MD0A 2JDIH 3CD6P 4JBZA 1M6EX 3AECC 3CX5D 1OWAA 3VN0A 1FE6A 2Z45A 4C7RA 3TK1A 1AUMA 3NTNA 3AE7C 2ONTA 3P8CD 1K05A 3EQ2A 1AVOA 4NPFX 3RG2A 2E1MA 1JEKA 1HUCA 4H0LC 1L4AD 3VMAA 3C8VA 1KV4A 2Y0DA 1KFNA 3C9IA 2N1TC 4WY4C 1PL5A 1NO4A 2FYUJ 3A2AA 5APQA 1N73B 5APTA 1K8AQ 3M0DA 2K93A 1L0LK 1GL2B 4DT0A 2E76D 1M74A 2Q3EA 3V2RA 3HD7A 4GKGA 2A45I 1QVFO 4TT3H 3CL3D 1QEXA 2JGPA 2MD9A 1NTZJ 1JUNA 1P84D 2KP8A 3OW2O 3SWKA 1RF0C 4H44C 3KYQA 1L0NK 1NOHA 2L6EA 2H88C 3CI9A 1Q7YQ 3KXDA 1LTSC 2N6YA 4H13C 4OWFA 1GXGA 1JY2O 2BHVA 3BRTB 3B5NA 1R8EA 1HGZA 1VF5C 2JBGA 2CGQA 4OGQB 3BATA 3B4SA 2IZ1A 1YI2P 3H1KD 5B66E 5AVWB 2JB0A 1JB0J 4WBAA 2E75B 2E74D 3R4YA 2B9BA 3VTPC 1QX8A 1DNYA 2FKWB 5AW1B 1T2KD 2OYIA 2MVVA 1Q90D 4GIFA 1FZAA 3CCMP 1J1DB 2FQ1A 3V5BA 4IPYA 5CZDB 4PV1C 1N2DC 2OTKE 2B87B 2JO0A 2HR3A 3A0BH 1SFCD 2LIUA 4DZOA 1LWUB 2CPBA 4PD4H 2G8YA 2ZVNB 2C0XA 4ZNCA 1GDTA 3L72J 3ABVC 1YIJP 1RE4A 2L4BA 2GZEA 3AEFC 2BQ1E 1N73C 1IFJA 1H8AA 1CI6A 1S72P 1SQPJ 1KQGB 4L73A 4HH2A 1GL2C 5HGOA 1YHQP 1ZMEC 3B5NB 3FWLA 1QGKB 2FYUE 2PGDA 4U0CA 2O01N 1X8YA 1E79H 2GDXA 2W6BA 2HG5D 4W7ZA 3FXDA 2KSJA 1L0IA 1KN7A 1X79B 2KGDA 3U43A 2LOLA 4Z1MH 3CMAP 1OX3A 2FFDA 1M1KQ 1NTZE 4BRYB 1SQBE 3Q2YA 2K3RA 3AE6C 4R0MA 3G29A 1DX7A 4OGQC 5KJ7A 3NY7B 1WMKA 2BCCE 2M8LA 3CCRP 2WPSA 2K88A 2FACA 2UWJE 3H4EA 1SQVK 1H89A 1Q82Q 2EIAA 2E5TA 1PIXA 2K94A 1VKUA 1HF9A 3TDKA 2N50A 1NTZG 1UNKA 2E5YA 3D71A 5AW5B 1SQBG 1OW7A 2KK7A 2KXPB 1Q81Q 2W6JH 2LTEA 1J1DC 1LTJA 3M0DC 1L0HA 2BCCG 4ZMDA 3KZIE 1LWUC 2C9LY 5BS1A 4AQRD 3MGEA 2LIWA 2KGEA 1BXIA 3CCLP 2H43A 1KQSO 4EYYQ 2KOOA 2ZT9D 3D70A 3CE7A 3AE5C 2GUVA 4IOIH 1MV8A 3NTEA 2E74B 1P84H 5KTBA 2A06E 2RMZA 2GZGA 3G0VA 3Q1MA 1U7JA 1JY2N 2WPRA 3V2PA 2Q7CA 2FYUK 1VQMP 1FJKA 4R4LA 1PGOA 4U3FJ 1YITP 1EXJA 1SQXJ 2C9NY 1FS0E 1BGYD 1IK9A 3B5NC 1JTHB 1S2EA 2LL8A 2O3JA 2FVEA 2YKPA 2KZJA 3CMEP 3RK3D 5AVVB 1SQPE 2IPPA 1YTZT 3A0HE 4DG9A 4N3YB 5BU5A 3CCUP 3CCQP 2D2CB 2A06G 2YKOA 3DS4A 2V7QJ 1L0LJ 2IFNA 1M6NA 5BS2A 5AVUB 2I1JA 2OTLP 1FJPA 1HJ0A 1GTWA 4I1LA 2NPSD 1W5CE 2VSQA 2KUBA 3H32B 2O01H 1IK7A 2PEOA 2V7QH 4HKZH 2LPKA 2ZYDA 3HZQA 3VMYA 2L9FA 5B5EH 1SQPG 5BU8B 2M8RA 4WY4A 1CZQA 2PY8A 5KP7B 4W80A 2X2BA 1URQD 4I7ZB 1FOSE 3M06A 1NTMD 1P84I 5CJ4A 3JCUH 4PH0A 1NTKK 1RE4C 1IFMA 5KAFH 2KB7P 4MRTC 3CPWO 2PEMA 1BSHA 1VQ4P 2BEZF 5CBNA 2FXPA 2W27A 4BPGA 1X0TA 3BCCD 1SS1A 3KPEA 4NPEA 1FOSF 5GTHH 2QSIA 2KNCA 5H2FH 3WU2E 3RGUA 2IBZE 4GOEA 2K2QA 4GR6A 1EDLA 2N6ZA 1EDIA 1U7MA 1GD2E 7CEIA 2WQYC 1H0TB 2GDYA 2FFDC 1NTZD 1T2KC 1W2EA 1SQQD 1SQBD
chains in the Genus database with same CATH topology
3RG6C 3CCQP 1PEQA 1N8RQ 3DPHA 2ONTA 2M8LA 1KD1Q 3I56P 2Z44A 1BAJA 3CCRP 3DTJA 2OTJP 1VQLP 2EG5A 3DS4A 5DCKA 2QEXP 2E1MA 2KODA 2XXMA 3G6EP 3H4EA 1M6NA 3P05A 5BS2A 2OTLP 4GR2A 1VQ5P 3H0DA 3CCMP 1Q82Q 1M90Q 5F2OA 2EIAA 4IPYA 1K73Q 4U0AA 3DS5A 1QVGO 1EIAA 3CCSP 1RO0A 1JJ2O 2JO0A 5F2NA 1E6JP 2PEJA 4XFZA 4U0FA 5F2KA 1YJWP 2PEOA 1K8AQ 2EFJA 5I4TG 3G4SP 1VQ7P 2DGYA 3HZQA 2JYGA 3G28A 1A8OA 1Q81Q 2QA4P 1D1DA 1PEOA 1M74A 2LF4A 4U0EA 1A43A 2P9XA 3CC7P 3G71P 1KC8Q 2PY8A 3CCEP 1EOQA 3Q20A 3B5IA 3I55P 2M8PA 1QVFO 3DS1A 1YIJP 3CCUP 3DS2A 5JPAA 2BQ1E 5BS1A 2M8NA 3MGEA 1S72P 1Q86Q 2XV6A 4PH0A 2Z46A 3OW2O 4M0IA 3CCLP 1RNIA 4XRQA 5HGOA 1KQSO 1VQOP 1YHQP 3E2DA 1RO2A 2L6EA 3VRLC 4COPA 3CCVP 5HGMA 3G1IA 1QRJA 2OARA 4QNBA 4COCA 3NTEA 3CPWO 1Q7YQ 2PEMA 1VQNP 3G1GA 3G0VA 1VQ4P 3G26A 3HYBA 1VQ6P 4U0CA 2PEIA 2BUOA 1ZMBA 3CXCO 2PEQA 1VQKP 4U0BA 1IUQA 3M1MA 3WBHA 4PH1A 2BHVA 1K30A 1VQMP 5HGLA 3DS0A 3LRYA 1VQ8P 1YITP 3G21A 5HGNA 2PENA 4WYMA 1PEUA 1NJIQ 1VQPP 1W2BO 3CMAP 1YI2P 3CC2P 3DS3A 1YJ9P 3CCJP 4GR6A 1M1KQ 1YJNP 3CD6P 4XROA 2XT1A 1PEMA 1M6EX 3CC4P 2Z45A 3CMEP 4U0DA 4XFYA 1K9MQ 2JYLA 3H47A 3G29A 2PEKA 2CWOA 4XFXA 1VQ9P 1AUMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCQ P;  1Q86 Q;  1N8R Q;  3OW2 O;  1VQ8 P;  1YIT P;  1YJW P;  3CCL P;  1KD1 Q;  1K8A Q;  3I56 P;  3G4S P;  1VQ7 P;  1KQS O;  3CCR P;  2OTJ P;  1NJI Q;  1VQP P;  1VQO P;  1YHQ P;  1W2B O;  3CMA P;  1YI2 P;  1VQL P;  2QEX P;  1Q81 Q;  3CC2 P;  3CCV P;  3G6E P;  1YJ9 P;  2QA4 P;  3CCJ P;  1M1K Q;  3CPW O;  1YJN P;  1Q7Y Q;  3CD6 P;  3CC7 P;  3G71 P;  1KC8 Q;  1VQ5 P;  1VQ4 P;  3CCE P;  1VQN P;  2OTL P;  3CCM P;  1Q82 Q;  3CC4 P;  1M90 Q;  1VQ6 P;  3I55 P;  3CME P;  1QVF O;  1K73 Q;  1YIJ P;  3CXC O;  1K9M Q;  1QVG O;  1VQK P;  1JJ2 O;  1VQM P;  3CCS P;  1VQ9 P;  1S72 P;  3CCU P; 
#chains in the Genus database with same CATH topology
 4UHP B;  1KYO H;  3E7K A;  1RE3 A;  2LXB A;  1ZNV A;  2OTJ P;  4HJG H;  2K9J B;  1YQ4 C;  4UB6 H;  2BCC D;  5KJ7 C;  2KOR A;  1KIL D;  2ERH A;  2KLV A;  1M1J A;  3HE5 A;  4YPC A;  2IBZ G;  2D2C C;  3L73 G;  3GF7 A;  3IFM A;  2ZT9 B;  5I4T G;  2QIW A;  3H1J G;  3PRJ A;  1KB9 E;  1KFM A;  4GT1 A;  2JYG A;  3N4X A;  2WPV B;  2J5U A;  2WIT A;  2WVR A;  4W7Y A;  2H7H A;  3NMD A;  3GF3 A;  2WPT A;  4K3A A;  2XKM A;  1L0L E;  2JU2 A;  1PPJ E;  2YMK A;  4O9B A;  5E79 H;  4I7Z C;  3L71 J;  1FU1 A;  3RK3 B;  4UB8 E;  2PP6 A;  1JCC A;  1OZH A;  3MZW B;  1N7S B;  1VPC A;  2A06 D;  1GL2 A;  3OAK A;  5AW7 B;  5C39 A;  4GOF A;  3BAS A;  5CCG C;  2K9Y A;  4YXD C;  1L0N E;  1JY3 P;  3LRY A;  2P10 A;  3RBX A;  1ZRT E;  5CMZ A;  3P8M C;  1LT1 A;  1LTI C;  2OQQ A;  2A45 H;  2QG4 A;  2RN0 A;  1NU1 J;  1SQV J;  5TIS H;  1N86 A;  2NPS B;  3GHG A;  4WB4 A;  2IX7 C;  4JF7 A;  3VMX A;  1L0L G;  3Q3D A;  1PPJ G;  2PNG A;  1Q86 Q;  1LTA C;  3OJA B;  1FZB A;  2QJY C;  3PTZ A;  4D6T J;  4PJ0 H;  3DTJ A;  1J2J B;  1Y47 A;  3SWF A;  4JPZ B;  3HUS B;  1M1J B;  4IZ6 A;  4OVN F;  4H2W C;  1YYC A;  2KGC A;  2WMM A;  1PP9 G;  1L0N G;  5EJD A;  3D6Z A;  1QVG O;  3RL0 C;  1BDD A;  3V6I A;  1CSB A;  2Q6Q A;  1SQX K;  3A7O A;  4I2L C;  1HBW A;  3MP7 B;  5KAI H;  2P9X A;  3G71 P;  2CQ8 A;  1EOQ A;  3LW5 J;  3B5I A;  3Q5S A;  4H2X C;  4BPF A;  3H1I J;  1BCC E;  2J58 A;  3RK2 C;  3EWK A;  3M9Q A;  2VLP A;  2OYO A;  1JCD A;  3LW5 H;  2B87 A;  1BE3 J;  1AQ5 A;  4B86 A;  1VQN P;  1LWU A;  3I5C A;  2ZVO B;  4U0B A;  1KQL A;  4PH1 A;  3TGU J;  2VLN A;  3EFG A;  2YKQ A;  3SWY A;  4PWV B;  5DJT B;  2E42 A;  3GHG B;  2P7J A;  1W2B O;  1PGP A;  3RK3 C;  1HQB A;  1S5L H;  5L8R J;  1KIL B;  3IR9 A;  2IBZ D;  2CPS A;  3VMZ A;  2XT1 A;  1PEM A;  1BCC G;  1N7S C;  5KLV D;  3L73 D;  2JYL A;  3H1J D;  5AVX B;  3RG6 C;  5CJ0 A;  1PEQ A;  1FZG A;  4DOJ A;  2QE7 H;  3L71 E;  1DD3 A;  4NEO A;  5DCK A;  3AE4 C;  1OVV A;  2NPS C;  3P7K A;  3LID A;  5K5G B;  1RE3 C;  2WZ7 A;  4L76 A;  1G2C B;  1OIP A;  4WWI A;  2EHS A;  2XZR A;  1L4A A;  3H1L J;  2ITA A;  4HKG A;  1AA0 A;  2IDB A;  1E6J P;  4BRY A;  1NTK J;  1G1J A;  1M1J C;  2XDJ A;  1SQV E;  2KR5 A;  2XND H;  2FAE A;  2NRG A;  3G28 A;  2NO8 A;  2QA4 P;  2XNX A;  1BDC A;  3CCE P;  1KB9 D;  2WT7 B;  5APW A;  1JY3 O;  4C46 A;  3DS1 A;  5KKZ B;  1FZF A;  1EZV E;  4D6T E;  3CWB J;  3L71 G;  3GLM A;  3EJE A;  2W83 C;  1X3O A;  3H1H J;  4A7P A;  1RNI A;  5KP8 B;  3U59 A;  2R5B A;  2IYO A;  1PGQ A;  1LNQ A;  1NGM B;  2QM8 A;  5CCH C;  1DD4 A;  2MF4 A;  1VQ6 P;  1MZ9 A;  2WSC J;  3L70 J;  3CXC O;  1SQV G;  3WBH A;  4LLH A;  3MIW A;  3FGA D;  2M3B A;  1S9K E;  1IFI A;  1HVV A;  3HE4 A;  4N78 E;  1PP9 D;  3CC2 P;  1L0N D;  3EJB A;  3GJN A;  2WSC H;  1EZV G;  3NXS A;  5M1B A;  3AE3 C;  2R3S A;  4XRO A;  3CC4 P;  3H25 A;  3CXH D;  2YIU B;  2FHS C;  1M56 D;  1VHN A;  3L75 J;  3GHG C;  2POH A;  1BE3 E;  2YXQ B;  2DW3 A;  1KIL C;  1L4A B;  1NH4 A;  2AXC A;  1VQ5 P;  1M90 Q;  3CLQ A;  3W68 A;  3S9O A;  1ZN5 A;  1CEI A;  1JTH A;  3W67 A;  3WUU A;  3K5B A;  2M0B A;  2WSF J;  5F2K A;  3G4S P;  3C1L A;  3CX5 H;  2FYU G;  2Y9Y A;  1UJZ A;  1SFC A;  2E76 B;  2E75 C;  1NU1 K;  5AW0 B;  5AVQ B;  2LKM A;  2WSF H;  4U7J A;  3L35 A;  1GU5 A;  2M8N A;  4K35 A;  3WUT A;  1HWT C;  2GUS A;  4EOT A;  4EI2 A;  1BCC D;  1ZXG A;  2JQ4 A;  3H32 A;  2M5A B;  2B89 A;  3LIE A;  1HY8 A;  5KKZ C;  3USS A;  1BSN A;  3H1L E;  3JC2 2;  1ZMB A;  1GXH A;  2HFE D;  1T3U A;  1NTK E;  3HE4 B;  3GKL C;  4BWN A;  1KOR A;  3QH9 A;  5HV8 A;  3A0B E;  1KTM A;  2FQ2 A;  2R44 A;  4PD4 E;  2NZ2 A;  3HRN A;  2AFE A;  1ZR2 A;  1FR2 A;  2N5I A;  2YO2 A;  3V2Q A;  1NTM K;  5CCG A;  4L75 A;  3SFD C;  4H0L D;  4KT0 J;  2R5D A;  2VLQ A;  1UII A;  2K5X A;  2MJZ A;  1M57 D;  2N1T D;  4WY4 D;  1R5L A;  3NFQ A;  3H1K J;  3H1L G;  3L72 E;  2YNY A;  1NTK G;  1AYI A;  5AW3 B;  2AEM A;  3A5T A;  3CX5 I;  3DS5 A;  2AXT H;  1SFC B;  1MFT A;  2PEJ A;  1OFC X;  2ZXX A;  2KG9 A;  1L4A C;  1H0T A;  3AEA C;  2O01 J;  3F89 A;  1JY3 N;  2CNR A;  2LF4 A;  2HYN A;  3CC7 P;  2KOQ A;  1OMI A;  2M5R A;  3L75 E;  3PP5 A;  4Y99 B;  1SQQ K;  2K9J A;  1NKZ B;  3L72 G;  1SLQ A;  2MY5 A;  3O6Q B;  4H13 D;  2K37 A;  3B4Q A;  1EZV D;  2E76 C;  2KW2 A;  1JO5 A;  1IZN B;  3CCV P;  5HGM A;  4COC A;  1VDF A;  1VF5 D;  3IF4 A;  3HTK B;  2LR2 A;  3GG2 A;  2H8P D;  1U57 A;  1ZP0 C;  1Z6M A;  2KS1 B;  1K30 A;  2K92 A;  1MZ8 A;  2FYN B;  2PEN A;  2O1K A;  3L75 G;  3WUV A;  1IFP A;  4QKO A;  1Q2N A;  4N78 D;  1OVU A;  3RL0 g;  2FAD A;  3H47 A;  3GZL A;  4QMA A;  1UIX A;  2FYU D;  3DPH A;  4PV1 D;  3N7N A;  3I56 P;  1DV5 A;  3CXH H;  1N7S A;  2E74 C;  4ZKU A;  1P84 E;  1WRG A;  3P05 A;  2WSS H;  2AEF A;  1A02 J;  1IJD B;  1YTZ I;  2N9B A;  1NHL A;  2GM4 A;  3PHL A;  1KLP A;  1K04 A;  2NPS A;  2KZI A;  3JSV C;  2EFJ A;  3A3Y B;  1A8O A;  2JWA A;  1GPJ A;  1GL2 D;  1KB9 I;  4IFF A;  1OR5 A;  4L74 A;  1SFC C;  2IYP A;  4PXH B;  4N6J A;  4I6M C;  3F5H A;  3HUS A;  4U3F E;  1GW4 A;  1FZE A;  3H1K E;  5TJH A;  1LP1 A;  1SQX E;  4F37 A;  1KZU B;  1URQ A;  1FAV A;  4ASW A;  4XRQ A;  4CA3 A;  4Y99 C;  4BXL A;  3TYY A;  4H0L B;  3O8Z A;  1VQK P;  3VP9 A;  1HH0 A;  5KLI B;  2XV5 A;  5DJU B;  2N1T B;  3DS0 A;  2YXR B;  2DNW A;  3MUD C;  5CCH A;  5HGN A;  1DEB A;  4OGQ D;  2JR8 A;  5B5E E;  4U3F G;  3KHU A;  4PD4 D;  1HTL C;  3H1K G;  1SQX G;  5AVR B;  1X9V A;  3CXH I;  4U0D A;  1VL2 A;  4OH8 B;  3TSI A;  2FYN C;  4XFX A;  3JCU E;  1PZQ A;  2PRR A;  4Y28 J;  1BGY J;  2KOP A;  2W90 A;  2QEX P;  5KAF E;  1GK6 A;  1FDM A;  1IC2 A;  3L72 D;  5KP6 B;  2E43 A;  1LT9 A;  2P67 A;  1AJY A;  3AEB C;  1TU3 F;  2GDW A;  1RO0 A;  2SPZ A;  1KIL A;  1T6A A;  5GTH E;  2QNW A;  4U0F A;  1SQP D;  5H2F E;  3PJS K;  1E0H A;  1VQ7 P;  3HD7 D;  3L37 A;  2WTY A;  5B66 H;  5KLV K;  1LP1 B;  1URQ B;  3Q20 A;  4C7N B;  1SP4 A;  2FVA A;  4ASV A;  2QM7 A;  5JPA A;  4AYC A;  1KYO E;  1G2C A;  2W8Z A;  3L36 A;  1OW6 A;  1X22 A;  2K1A A;  4UB6 E;  2ZYG A;  1USE A;  1QL2 A;  4XA4 A;  3B5N D;  1NTM J;  5AW8 B;  2FYZ A;  2JEE A;  2PEQ A;  3M1M A;  2XZ1 C;  1IMQ A;  2ZT9 C;  1AF8 A;  4PV1 B;  5EW5 E;  1IFN A;  2WT7 A;  2CG5 B;  3GZM A;  3M9B A;  1PEU A;  3SSU A;  1FBM A;  1QL1 A;  4JQ0 D;  1H88 A;  4KHX A;  1A02 F;  5KLI C;  1QLE D;  3BCC J;  2N5H A;  1T8Z A;  3SFE C;  1RF1 B;  2JKV A;  2FQ0 A;  1ZOY C;  2N9Y B;  1VQ9 P;  1NVO A;  1RY3 A;  3L74 J;  2OYH A;  1RQU A;  1J1E B;  1LT9 B;  2HOD B;  2AVA A;  1JM0 A;  4RES B;  1GZL A;  2KOG A;  5E79 E;  1LJ2 A;  1S1C X;  4GR2 A;  3BVH A;  5F2O A;  1EC5 A;  3P32 A;  2Z5H A;  3MTU E;  1SQQ J;  1SQB J;  1JJ2 O;  2Y9Z A;  1T3J A;  5AW2 B;  2BCC J;  4U0E A;  1A43 A;  1KC8 Q;  5TIS E;  2WWW A;  3AE2 C;  1N7L A;  4YTP C;  1FC2 C;  3DS2 A;  1BGY E;  2FBW C;  1ZW0 A;  1FDO A;  2GZJ A;  1NAY A;  4PJ0 E;  4M0I A;  1EZV I;  3MGN A;  3M0A A;  2I1K A;  4U3F D;  4EDF A;  3HUS C;  3WMM 0;  1NU1 E;  3RK3 E;  1SQX D;  1RO2 A;  4COP A;  1URQ C;  3T97 A;  2R3C A;  3U1A A;  2GZF A;  2KI7 B;  1LTB C;  3MHV A;  3AEG C;  2A45 G;  2AFD A;  1NAF A;  2LKI A;  2OGU A;  4WYM A;  4IL6 H;  3V4Q A;  3EFF K;  3QWO C;  4XE5 B;  5KAI E;  3RBZ A;  1YJ9 P;  2VRS A;  3FX0 A;  2MVU A;  1YJN P;  4AUW A;  1BGY G;  1L0L D;  3FXE A;  1PPJ D;  2KYV A;  2JP3 A;  3Q5R A;  5KJ7 D;  2R32 A;  2OYH B;  3KZI H;  3L4F A;  4R4M A;  2M5A A;  2PEK A;  1NU1 G;  2CWO A;  2ZFC A;  2RKL A;  3HD7 B;  2KOS A;  1KD1 Q;  2P1J A;  2D2C D;  3H6P A;  3FWN A;  1VQL P;  4BPH A;  2XXM A;  4JYC A;  1NTM E;  4D6T G;  3H1I E;  1ZRT D;  1OW8 A;  1RF1 C;  3H0D A;  3D6Y A;  3AED C;  4U0A A;  2MR7 A;  2FXM A;  1J1E C;  1LT9 C;  1DH3 A;  2PFX A;  2VLO A;  3KDP B;  2JJL A;  2O1J A;  4MN4 C;  1D1D A;  3BCC E;  2Y0C A;  1PEO A;  1NQ4 A;  1S5L E;  2G3A A;  3TGU E;  2J59 M;  3I55 P;  4ZKP A;  2M8P A;  1WT6 A;  3L74 E;  1YBK A;  3A0H H;  1GW3 A;  1XTG B;  2K0Y A;  2FY8 A;  3T97 B;  1NTM G;  2Q9I A;  1HGV A;  1D7M A;  3H1I G;  5CCG D;  3TF5 A;  1LGH B;  2ROQ A;  4QNB A;  1KYO D;  2N98 A;  3M9H A;  1SQQ E;  1AVY A;  2Q5U A;  2PEI A;  4M3L A;  3S1K A;  2OYI B;  4GDO A;  1BE3 G;  1MUU A;  3LMO A;  1KQF B;  3G9R A;  3BCC G;  3AE9 C;  1KIL E;  3TGU G;  2ZAE B;  2I8D A;  3L74 G;  3O6Q A;  3M91 A;  4PD4 I;  1FZC A;  1SVF A;  2YMY A;  3MUD A;  1GU4 A;  1MFZ A;  2XZ0 D;  1NWQ A;  3CCS P;  3HTK A;  1RH5 B;  2W6A A;  2HLO A;  3IAO A;  3RL0 D;  1SQQ G;  1ZLL A;  4IL6 E;  3EJD A;  1YQ3 C;  2KOD A;  3G6E P;  2KS1 A;  3G3Z A;  2MKV A;  1CI6 B;  2ZXE B;  5KLV J;  3L73 J;  2OYH C;  1S3J A;  3CWB E;  1PFI A;  3IN6 A;  2GYK A;  1EIA A;  3H1H E;  3H1J J;  2QRX A;  5HVC A;  5BVZ A;  3HD7 C;  2BEQ D;  2JO1 A;  1JMB A;  2P2U A;  1EXI A;  3WU2 H;  2DGY A;  1IMP A;  3RK2 D;  3L70 E;  5APY A;  2YIU C;  2GA1 A;  3L71 D;  2FXO A;  1FDI A;  2CK3 H;  3S4R A;  1CW5 A;  1JOC A;  2FFD B;  5GTI H;  3VOP A;  3GMA A;  2QJK B;  3B8E B;  3CWB G;  3UIA A;  2XU6 A;  2BAS A;  1VQO P;  1F80 D;  2PAJ A;  3VRL C;  1QRJ A;  2OAR A;  3AEE C;  3H1H G;  4H44 D;  3G26 A;  1NU1 D;  1SQV D;  5AVS B;  3HYB A;  3BRV B;  3II6 A;  1NTZ K;  2YO3 A;  2KWL A;  1SQB K;  1N7S D;  5APX A;  3L70 G;  1VQ8 P;  2FVF A;  4D6T D;  1FZC B;  1XTC C;  1NJI Q;  1KB9 H;  1PV3 A;  3CX5 E;  1Y8A A;  4TLF A;  3Q5P A;  2K0D X;  2QJP B;  2IFM A;  2OYI C;  2WSE J;  2C0W A;  4XFY A;  2JWD A;  3P8C E;  3AE8 C;  2KSE A;  1DEE G;  2P58 A;  4YXW H;  2L22 A;  1LTJ B;  2Z44 A;  1PP9 J;  1L0N J;  3AE1 C;  2WSE H;  1S5L X;  2N1T A;  1S9K D;  1KMI Z;  2K0X A;  1GK4 A;  4IFD K;  4UB8 H;  2IBZ I;  3VYI A;  4RJT A;  2V4H A;  3H1I D;  1YJW P;  4LC1 A;  1EDK A;  2IZ0 A;  1E5W A;  2LXC B;  1BE3 D;  5AW6 B;  4XFJ A;  2AF8 A;  2KG6 A;  1RF0 A;  5CCH D;  2L0Q A;  2Q1K A;  1JMM A;  3TGU D;  3E1R A;  1GMJ A;  2XV6 A;  1AFO A;  3L74 D;  2MR8 A;  4GOD A;  2QJY B;  5KLV E;  3L73 E;  5CHX A;  1LTT C;  1T8K A;  3G1I A;  5APU A;  1RHZ B;  3PH0 A;  3H1J E;  5AVT B;  4NPD A;  1R5S A;  2Z4E A;  5AVZ B;  2ZJS E;  4WVZ A;  2JU1 A;  3B71 A;  2AXT E;  1S4X A;  2Q3I A;  1NKN A;  2QJK C;  3ZDM A;  1L2P A;  1SQP K;  5GTI E;  1AV1 A;  3RL0 B;  3TNU A;  3V4W A;  2GZI A;  2Y0E A;  4C7N A;  3V2N A;  3G21 A;  4IL6 X;  1MKM A;  1BCC J;  2L91 A;  2WPQ A;  1VQP P;  1ZV8 A;  2KGA A;  3DS3 A;  4DCK A;  5EFW B;  4DJG A;  1PGJ A;  1K9M Q;  2HPC A;  5KLV G;  3H1L D;  1OVR A;  1FZC C;  1N8R Q;  4RKU J;  4WY4 B;  3RK2 B;  1NTK D;  1JY2 P;  1BAJ A;  1USD A;  2EG5 A;  3VP8 A;  1NYH A;  2QJP C;  1DIP A;  3PLN A;  2QVA A;  2B88 A;  1M8O B;  4HB1 A;  2E75 D;  1OXZ A;  4KJM A;  1HJB A;  1K73 Q;  2KLU A;  1ZR4 A;  4H2Y C;  3CWB D;  1LTJ C;  5F2N A;  1LTG C;  3GW6 A;  4XFZ A;  2EHT A;  2KG8 A;  3H1H D;  4RO0 A;  5APV A;  1RF1 A;  3U1C A;  2L5G B;  4LGD E;  5AVY B;  2KIK A;  5AW4 B;  4H44 B;  3E1I A;  1EDJ A;  5APS A;  1N73 A;  2KNC B;  1IFD A;  2HOD A;  2ZYA A;  3L70 D;  1EMV A;  4H13 B;  1PP9 E;  1Z56 A;  2Z46 A;  1RQV A;  1AQT A;  1G1I A;  3CXH E;  1JNM A;  3E2D A;  1EQ7 A;  4CPG A;  2RH0 A;  1VF5 B;  2AEJ A;  1M7L A;  4EIJ A;  1KYO I;  1Y9B A;  2M3E A;  3G1G A;  3TNU B;  4JYB A;  3OA7 A;  2LML A;  2BUO A;  1ACP A;  5CBO A;  1IO4 A;  1IUQ A;  3ITK A;  5HGL A;  2Z5I A;  3KQG A;  3L75 D;  2JAZ A;  5AW9 B;  3R2P A;  2H89 C;  4IFM A;  3HE5 B;  4HYT B;  2HPC B;  3CCJ P;  3MD0 A;  2JDI H;  3CD6 P;  4JBZ A;  1M6E X;  3AEC C;  3CX5 D;  1OWA A;  3VN0 A;  1FE6 A;  2Z45 A;  4C7R A;  3TK1 A;  1AUM A;  3NTN A;  3AE7 C;  2ONT A;  3P8C D;  1K05 A;  3EQ2 A;  1AVO A;  4NPF X;  3RG2 A;  2E1M A;  1JEK A;  1HUC A;  4H0L C;  1L4A D;  3VMA A;  3C8V A;  1KV4 A;  2Y0D A;  1KFN A;  3C9I A;  2N1T C;  4WY4 C;  1PL5 A;  1NO4 A;  2FYU J;  3A2A A;  5APQ A;  1N73 B;  5APT A;  1K8A Q;  3M0D A;  2K93 A;  1L0L K;  1GL2 B;  4DT0 A;  2E76 D;  1M74 A;  2Q3E A;  3V2R A;  3HD7 A;  4GKG A;  2A45 I;  1QVF O;  4TT3 H;  3CL3 D;  1QEX A;  2JGP A;  2MD9 A;  1NTZ J;  1JUN A;  1P84 D;  2KP8 A;  3OW2 O;  3SWK A;  1RF0 C;  4H44 C;  3KYQ A;  1L0N K;  1NOH A;  2L6E A;  2H88 C;  3CI9 A;  1Q7Y Q;  3KXD A;  1LTS C;  2N6Y A;  4H13 C;  4OWF A;  1GXG A;  1JY2 O;  2BHV A;  3BRT B;  3B5N A;  1R8E A;  1HGZ A;  1VF5 C;  2JBG A;  2CGQ A;  4OGQ B;  3BAT A;  3B4S A;  2IZ1 A;  1YI2 P;  3H1K D;  5B66 E;  5AVW B;  2JB0 A;  1JB0 J;  4WBA A;  2E75 B;  2E74 D;  3R4Y A;  2B9B A;  3VTP C;  1QX8 A;  1DNY A;  2FKW B;  5AW1 B;  1T2K D;  2OYI A;  2MVV A;  1Q90 D;  4GIF A;  1FZA A;  3CCM P;  1J1D B;  2FQ1 A;  3V5B A;  4IPY A;  5CZD B;  4PV1 C;  1N2D C;  2OTK E;  2B87 B;  2JO0 A;  2HR3 A;  3A0B H;  1SFC D;  2LIU A;  4DZO A;  1LWU B;  2CPB A;  4PD4 H;  2G8Y A;  2ZVN B;  2C0X A;  4ZNC A;  1GDT A;  3L72 J;  3ABV C;  1YIJ P;  1RE4 A;  2L4B A;  2GZE A;  3AEF C;  2BQ1 E;  1N73 C;  1IFJ A;  1H8A A;  1CI6 A;  1S72 P;  1SQP J;  1KQG B;  4L73 A;  4HH2 A;  1GL2 C;  5HGO A;  1YHQ P;  1ZME C;  3B5N B;  3FWL A;  1QGK B;  2FYU E;  2PGD A;  4U0C A;  2O01 N;  1X8Y A;  1E79 H;  2GDX A;  2W6B A;  2HG5 D;  4W7Z A;  3FXD A;  2KSJ A;  1L0I A;  1KN7 A;  1X79 B;  2KGD A;  3U43 A;  2LOL A;  4Z1M H;  3CMA P;  1OX3 A;  2FFD A;  1M1K Q;  1NTZ E;  4BRY B;  1SQB E;  3Q2Y A;  2K3R A;  3AE6 C;  4R0M A;  3G29 A;  1DX7 A;  4OGQ C;  5KJ7 A;  3NY7 B;  1WMK A;  2BCC E;  2M8L A;  3CCR P;  2WPS A;  2K88 A;  2FAC A;  2UWJ E;  3H4E A;  1SQV K;  1H89 A;  1Q82 Q;  2EIA A;  2E5T A;  1PIX A;  2K94 A;  1VKU A;  1HF9 A;  3TDK A;  2N50 A;  1NTZ G;  1UNK A;  2E5Y A;  3D71 A;  5AW5 B;  1SQB G;  1OW7 A;  2KK7 A;  2KXP B;  1Q81 Q;  2W6J H;  2LTE A;  1J1D C;  1LTJ A;  3M0D C;  1L0H A;  2BCC G;  4ZMD A;  3KZI E;  1LWU C;  2C9L Y;  5BS1 A;  4AQR D;  3MGE A;  2LIW A;  2KGE A;  1BXI A;  3CCL P;  2H43 A;  1KQS O;  4EYY Q;  2KOO A;  2ZT9 D;  3D70 A;  3CE7 A;  3AE5 C;  2GUV A;  4IOI H;  1MV8 A;  3NTE A;  2E74 B;  1P84 H;  5KTB A;  2A06 E;  2RMZ A;  2GZG A;  3G0V A;  3Q1M A;  1U7J A;  1JY2 N;  2WPR A;  3V2P A;  2Q7C A;  2FYU K;  1VQM P;  1FJK A;  4R4L A;  1PGO A;  4U3F J;  1YIT P;  1EXJ A;  1SQX J;  2C9N Y;  1FS0 E;  1BGY D;  1IK9 A;  3B5N C;  1JTH B;  1S2E A;  2LL8 A;  2O3J A;  2FVE A;  2YKP A;  2KZJ A;  3CME P;  3RK3 D;  5AVV B;  1SQP E;  2IPP A;  1YTZ T;  3A0H E;  4DG9 A;  4N3Y B;  5BU5 A;  3CCU P;  3CCQ P;  2D2C B;  2A06 G;  2YKO A;  3DS4 A;  2V7Q J;  1L0L J;  2IFN A;  1M6N A;  5BS2 A;  5AVU B;  2I1J A;  2OTL P;  1FJP A;  1HJ0 A;  1GTW A;  4I1L A;  2NPS D;  1W5C E;  2VSQ A;  2KUB A;  3H32 B;  2O01 H;  1IK7 A;  2PEO A;  2V7Q H;  4HKZ H;  2LPK A;  2ZYD A;  3HZQ A;  3VMY A;  2L9F A;  5B5E H;  1SQP G;  5BU8 B;  2M8R A;  4WY4 A;  1CZQ A;  2PY8 A;  5KP7 B;  4W80 A;  2X2B A;  1URQ D;  4I7Z B;  1FOS E;  3M06 A;  1NTM D;  1P84 I;  5CJ4 A;  3JCU H;  4PH0 A;  1NTK K;  1RE4 C;  1IFM A;  5KAF H;  2KB7 P;  4MRT C;  3CPW O;  2PEM A;  1BSH A;  1VQ4 P;  2BEZ F;  5CBN A;  2FXP A;  2W27 A;  4BPG A;  1X0T A;  3BCC D;  1SS1 A;  3KPE A;  4NPE A;  1FOS F;  5GTH H;  2QSI A;  2KNC A;  5H2F H;  3WU2 E;  3RGU A;  2IBZ E;  4GOE A;  2K2Q A;  4GR6 A;  1EDL A;  2N6Z A;  1EDI A;  1U7M A;  1GD2 E;  7CEI A;  2WQY C;  1H0T B;  2GDY A;  2FFD C;  1NTZ D;  1T2K C;  1W2E A;  1SQQ D;  1SQB D; 
#chains in the Genus database with same CATH homology
 3RG6 C;  3CCQ P;  1PEQ A;  1N8R Q;  3DPH A;  2ONT A;  2M8L A;  1KD1 Q;  3I56 P;  2Z44 A;  1BAJ A;  3CCR P;  3DTJ A;  2OTJ P;  1VQL P;  2EG5 A;  3DS4 A;  5DCK A;  2QEX P;  2E1M A;  2KOD A;  2XXM A;  3G6E P;  3H4E A;  1M6N A;  3P05 A;  5BS2 A;  2OTL P;  4GR2 A;  1VQ5 P;  3H0D A;  3CCM P;  1Q82 Q;  1M90 Q;  5F2O A;  2EIA A;  4IPY A;  1K73 Q;  4U0A A;  3DS5 A;  1QVG O;  1EIA A;  3CCS P;  1RO0 A;  1JJ2 O;  2JO0 A;  5F2N A;  1E6J P;  2PEJ A;  4XFZ A;  4U0F A;  5F2K A;  1YJW P;  2PEO A;  1K8A Q;  2EFJ A;  5I4T G;  3G4S P;  1VQ7 P;  2DGY A;  3HZQ A;  2JYG A;  3G28 A;  1A8O A;  1Q81 Q;  2QA4 P;  1D1D A;  1PEO A;  1M74 A;  2LF4 A;  4U0E A;  1A43 A;  2P9X A;  3CC7 P;  3G71 P;  1KC8 Q;  2PY8 A;  3CCE P;  1EOQ A;  3Q20 A;  3B5I A;  3I55 P;  2M8P A;  1QVF O;  3DS1 A;  1YIJ P;  3CCU P;  3DS2 A;  5JPA A;  2BQ1 E;  5BS1 A;  2M8N A;  3MGE A;  1S72 P;  1Q86 Q;  2XV6 A;  4PH0 A;  2Z46 A;  3OW2 O;  4M0I A;  3CCL P;  1RNI A;  4XRQ A;  5HGO A;  1KQS O;  1VQO P;  1YHQ P;  3E2D A;  1RO2 A;  2L6E A;  3VRL C;  4COP A;  3CCV P;  5HGM A;  3G1I A;  1QRJ A;  2OAR A;  4QNB A;  4COC A;  3NTE A;  3CPW O;  1Q7Y Q;  2PEM A;  1VQN P;  3G1G A;  3G0V A;  1VQ4 P;  3G26 A;  3HYB A;  1VQ6 P;  4U0C A;  2PEI A;  2BUO A;  1ZMB A;  3CXC O;  2PEQ A;  1VQK P;  4U0B A;  1IUQ A;  3M1M A;  3WBH A;  4PH1 A;  2BHV A;  1K30 A;  1VQM P;  5HGL A;  3DS0 A;  3LRY A;  1VQ8 P;  1YIT P;  3G21 A;  5HGN A;  2PEN A;  4WYM A;  1PEU A;  1NJI Q;  1VQP P;  1W2B O;  3CMA P;  1YI2 P;  3CC2 P;  3DS3 A;  1YJ9 P;  3CCJ P;  4GR6 A;  1M1K Q;  1YJN P;  3CD6 P;  4XRO A;  2XT1 A;  1PEM A;  1M6E X;  3CC4 P;  2Z45 A;  3CME P;  4U0D A;  4XFY A;  1K9M Q;  2JYL A;  3H47 A;  3G29 A;  2PEK A;  2CWO A;  4XFX A;  1VQ9 P;  1AUM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...