3CMAP

The structure of cca and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Peptidyl-CCA deacylation on the ribosome promoted by induced fit and the O3'-hydroxyl group of A76 of the unacylated A-site tRNA.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
total genus 48
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2008-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3cmaP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 3cmaP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 3cmaP02
3G4SP 3CMAP 1VQ9P 3CC4P 1Q81Q 1JJ2O 3OW2O 1VQNP 2OTJP 1YJWP 3CCEP 1VQ4P 1NJIQ 1YJNP 1Q82Q 1VQ8P 1Q7YQ 1YHQP 1YITP 3CXCO 3CCQP 3CMEP 3G6EP 3CCVP 1VQLP 3CC2P 2QEXP 1KD1Q 3CCLP 1VQ6P 1VQ5P 3CD6P 3I56P 3CCUP 1YI2P 1VQPP 1VQKP 3CCJP 1M1KQ 2OTLP 1YJ9P 1Q86Q 1KQSO 1VQMP 1QVFO 3CCRP 1W2BO 1K9MQ 3I55P 3G71P 1K8AQ 3CCMP 1VQOP 1YIJP 1QVGO 1M90Q 1S72P 2QA4P 3CCSP 1VQ7P 3CC7P 1KC8Q 3CPWO 1N8RQ 1K73Q
chains in the Genus database with same CATH superfamily
5AVZB 2K5XA 3FXDA 2Y0EA 1Q81Q 3GW6A 2YMYA 2J5UA 3M9HA 2GZGA 2IZ1A 2VLOA 3WBHA 1IZNB 2O3JA 2WZ7A 1KILA 2OTKE 2ERHA 1EZVG 2GUSA 3L73G 2JDIH 3H4EA 1H0TA 4IPYA 1SQPD 3BVHA 1CZQA 3K5BA 1JMMA 2WMMA 1RE4C 1MZ8A 2OGUA 1MKMA 5KLVK 3AEFC 3F5HA 1PEQA 3S1KA 1N73B 1K73Q 3L75J 2JU2A 1M57D 1RF1B 3B5ND 4I1LA 4BPHA 2FYUG 3CXHE 1AYIA 1H89A 3BCCG 3TDKA 2E75C 2KGCA 3L74G 1DD4A 1D7MA 1NHLA 4HH2A 1JUNA 2XV6A 3BASA 2JR8A 1SQPG 4PV1D 4A7PA 4I6MC 1BDCA 4AQRD 3L35A 2G3AA 5KAIH 2A45H 3H1LE 5CCGA 4RJTA 1MFZA 3FXEA 3H1HJ 2XU6A 1DH3A 5F2NA 2N98A 5K5GB 1F80D 1SQVK 3CCSP 1PZQA 4ZKPA 2KG6A 1NQ4A 5KP7B 2D2CC 3L75D 2H89C 3L71E 1SFCA 1SQXE 2LPKA 2FXPA 2B87A 2N9BA 4PJ0E 3AECC 1IFIA 5AW5B 3AE8C 2H7HA 1UNKA 4GT1A 1N8RQ 3FWNA 2BCCJ 2XZRA 1A02J 2OQQA 3Q2YA 1QEXA 1P84I 1PPJG 1YBKA 2GZJA 1HGZA 4IFDK 1HGVA 2MJZA 2QJKB 3LRYA 3DPHA 2XZ1C 2E5TA 1OW6A 1BE3G 2DNWA 2Y0CA 1BDDA 1JB0J 2WSCH 1JNMA 5KAFH 2EHTA 3NTNA 3CX5H 4COPA 2FYNC 4ZNCA 3SSUA 1U7MA 3AE6C 3HUSB 1T2KD 3B4SA 1EMVA 4ZKUA 3L72D 2YO2A 4PD4I 1QL2A 2GZFA 1NTMD 1RHZB 1YTZI 1BCCG 3AE1C 1KN7A 1N73A 3Q5PA 1SQBJ 1OWAA 3E7KA 3EJEA 2KZIA 1MFTA 3G3ZA 1PEOA 3OAKA 5F2KA 3CCLP 3A0HE 2AXCA 2JBGA 1NU1G 4I7ZB 5AVUB 1ZNVA 1KLPA 2R44A 2LXCB 3LIEA 1VF5D 3MUDC 5DJUB 5B66E 3L73E 1YQ4C 2QSIA 3Q20A 3W68A 2GZIA 1SQPE 3H6PA 3A7OA 1FJPA 1VDFA 1KYOE 1JCCA 2QNWA 3AEEC 1ZLLA 1R5LA 2GA1A 2QJYC 1QRJA 1VQKP 3MZWB 3PP5A 2OYHC 2CPSA 1CI6B 4XFJA 4H2WC 2J59M 1X0TA 3CC4P 3CMAP 1VQ9P 3L73J 1NTME 2QJPB 4QMAA 2WSEH 2K92A 2AXTH 3HE5A 1OXZA 1SQBG 1EXJA 2FVFA 1FOSE 1KORA 1VQ6P 2IFMA 5BS1A 3H1ID 2RMZA 1RF1C 3RL0g 2I8DA 2PEJA 1JY2O 1BSHA 2CG5B 1HY8A 3H1JG 3IAOA 5HVCA 1QX8A 2HG5D 1ZV8A 4COCA 4R0MA 2GM4A 1QGKB 1T6AA 1RE3C 3V2RA 1U57A 4O9BA 3RK2C 2YKQA 4GDOA 3L74J 3U43A 4H13B 4DOJA 2K94A 1HBWA 2KLUA 1URQC 3RL0B 1L0NG 1J1DC 2KSEA 3CWBE 4JBZA 1YHQP 2Y0DA 2LIWA 3LMOA 3RG6C 1OVUA 5APVA 1OR5A 2V7QJ 1HWTC 2V7QH 1IFMA 3CWBJ 2N1TB 3H1HG 4C46A 1SQBE 1KILC 1GPJA 2KORA 4H0LC 3CXHH 1JMBA 2PENA 1JJ2O 1FJKA 1RQVA 3FGAD 3VTPC 4JYBA 1OZHA 2VSQA 5TJHA 1LTIC 2LOLA 5AVRB 3CC2P 2K1AA 4WY4D 2BUOA 2ZVNB 3RBZA 4DT0A 3EJBA 1OVVA 4IL6H 1NTKE 3CCMP 1NYHA 4OH8B 5AW0B 2BCCG 1NU1K 1S3JA 4IFMA 1LT1A 2QM7A 4XROA 1FZGA 2KYVA 4HYTB 2KOOA 3HUSC 4DG9A 1NTZG 1S9KD 1BE3J 3RGUA 5KP6B 3MTUE 3L70E 3M9QA 3GKLC 2N5HA 1YJWP 1FZCB 1NAFA 1KB9I 2YIUC 3RK2D 1FU1A 1NU1E 2FFDA 4JYCA 1VQ5P 1JY3O 2B87B 2BHVA 2FYUD 2UWJE 3E1RA 4L74A 5APTA 2OTLP 3U59A 4PWVB 3LW5J 2JEEA 2KR5A 3IR9A 1FDMA 1YJNP 2O01J 4XFXA 1L4AC 2WT7B 2K0XA 1W5CE 3MD0A 3HTKA 5KLIC 2MY5A 3NTEA 2FHSC 1ACPA 2LKMA 3QWOC 2NPSD 2Q3IA 1K8AQ 5APUA 2WPTA 2KZJA 2PEKA 1P84H 2XT1A 3V2PA 3H1KD 3G9RA 1M7LA 2FYZA 2IDBA 2KGDA 5AW2B 1YYCA 3CX5D 1Q86Q 2O1KA 1VL2A 2M3EA 3H32A 3H1LJ 3EWKA 3VP9A 1UIXA 2IZ0A 2O01H 3B5NA 5KAIE 2JO0A 1AVOA 2FXOA 1IJDB 4C7RA 2OYHB 4GOFA 4PH0A 1PP9G 1NKNA 3M06A 3L36A 3L72J 1XTCC 2FY8A 3H25A 3D71A 1N7SC 3O6QA 3L71G 2AEFA 2E1MA 2I1KA 5H2FH 5BVZA 1NTMK 1NTKG 5KLVG 1H88A 3CCVP 3EQ2A 3BCCE 3LIDA 3SFDC 3II6A 1KQFB 2ZYGA 3H1HE 5B5EE 2W6AA 2EHSA 3L70J 2Q5UA 4F37A 5HGNA 4Z1MH 3S9OA 4WBAA 2GDWA 1GK6A 1N73C 1SQPK 1L0NE 2PEQA 1L0LG 3HD7A 4H2XC 2GDXA 3H1IG 2XZ0D 5EFWB 2WT7A 3H47A 3VRLC 4K35A 3V2QA 4HKGA 2KSJA 2FACA 2M5AA 5KLVD 5APXA 2JO1A 1FZFA 2SPZA 3BRTB 5GTHH 5APQA 4H13D 1L0NK 3HRNA 3T97B 3L74D 1NTMJ 2L0QA 1L0LK 1PEUA 2WPVB 5APWA 2HFED 1EXIA 3A5TA 2MR8A 2D2CB 4PV1B 3V6IA 1AF8A 2JAZA 1P84D 2IBZG 4MRTC 3Q3DA 3TGUJ 1XTGB 2VLQA 4WVZA 3CPWO 2HYNA 2E76B 3B4QA 1PGOA 5CCHD 1K05A 4WY4C 1USEA 4JF7A 1GW4A 2R5DA 1NWQA 2A06G 2KI7B 2AEJA 5KP8B 1HJBA 1S5LE 2NZ2A 1AVYA 2BEQD 1FZCC 1KYOI 5KJ7C 3VMZA 4PD4D 1FOSF 1DX7A 4D6TG 2CK3H 2FYNB 1SQQK 2IBZD 3BATA 2YKOA 2KODA 4DZOA 2BCCE 4U3FD 3EFFK 2YKPA 1Y47A 2MD9A 1W2EA 4IOIH 1SQXD 1KB9H 1T3JA 2KOSA 5AW1B 4L73A 3HE5B 1IMPA 1T8KA 1M1JB 2WWWA 4W7ZA 1X79B 3TGUG 3Q5RA 4ASWA 4I7ZC 2LMLA 2GYKA 2KS1A 1GXHA 5B66H 3CCJP 1AQTA 1OMIA 2WTYA 2MF4A 5JPAA 1JTHB 1VQ7P 4U3FG 4C7NB 3H1LG 2PNGA 3CI9A 2W27A 4XFYA 2PEMA 1CW5A 1SQXG 5EW5E 4Y99C 1BXIA 2KLVA 3NY7B 3SWYA 2QEXP 2FAEA 1SQVE 1GL2D 5AW3B 1N7SB 4D6TJ 2K0DX 3G1GA 1KQSO 2XXMA 5AVQB 2P2UA 4PXHB 2N50A 3B8EB 1KYOD 1GL2A 2H88C 3GHGB 3MP7B 1FAVA 4HKZH 2FYUE 5EJDA 3A2AA 2EG5A 1LGHB 5BU8B 2KIKA 2M8RA 3B71A 4KHXA 4U0DA 1K30A 4IL6X 5KLVJ 2QJPC 2KUBA 1N7SD 1BGYJ 2A06E 3M91A 1KC8Q 3U1AA 3O6QB 3G4SP 1S1CX 2KB7P 1M6EX 3RBXA 1GXGA 1PEMA 1FDOA 2KWLA 2AFEA 4LC1A 2MR7A 5CJ4A 1A8OA 1YI2P 2GZEA 1FBMA 1BCCJ 2CPBA 2JWDA 5CBOA 4UB6H 2W6BA 4NPDA 4WWIA 2PY8A 4YXWH 2L9FA 3C8VA 1E5WA 1LT9B 1GZLA 1KV4A 2WSCJ 1JY3N 1SS1A 2ZT9D 3A3YB 3L4FA 1Z56A 2Q1KA 1R8EA 4DJGA 2N5IA 2FFDC 1URQB 3RL0C 1A43A 1ZOYC 2PEOA 3AEAC 2AXTE 4L76A 3L75G 1CSBA 3MIWA 2GUVA 1NTZD 1EIAA 2K88A 2IBZE 3MUDA 4R4LA 3OW2O 5APSA 4PV1C 1FZBA 3L75E 1ZRTD 4NPFX 1OIPA 2ZT9B 1KILB 2OYIA 3VP8A 1KTMA 4U0EA 1G2CB 4WY4B 3P8CD 1DV5A 2C0XA 2ZVOB 3PJSK 2QE7H 1AA0A 1JEKA 1T3UA 1PGQA 1RF0A 2XNDH 2C9NY 4LLHA 3I56P 1RO2A 1G2CA 1WMKA 2FVEA 3HTKB 2EFJA 5HGMA 2CWOA 3Q1MA 1IFJA 2AVAA 2Z44A 3B5IA 1IFNA 2FQ2A 3JSVC 4BRYB 3VN0A 2IPPA 2C0WA 2FXMA 5AVXB 2W6JH 4N78E 3KHUA 1QVFO 1OVRA 5CHXA 2CNRA 2KG8A 1PL5A 2OYIB 1VHNA 3AE4C 2JB0A 1GU4A 1IC2A 1PP9E 2K9JB 5CJ0A 2WPRA 3P05A 4UB6E 2BQ1E 5L8RJ 4QKOA 3L70D 3G6EP 1T2KC 1S9KE 1NAYA 2RKLA 2PRRA 2HODA 2AFDA 4NEOA 1OW7A 2B88A 3U1CA 1L0NJ 5KLIB 1KYOH 1L0ND 2IYPA 1GTWA 3B5NB 1VF5B 1PP9D 1L0LE 2ITAA 3H32B 3CCUP 4U7JA 3DS5A 2E43A 4XRQA 4WB4A 3H1HD 5CCGC 4Y99B 2PP6A 2OYOA 2MVUA 2JJLA 5HV8A 3G0VA 3HD7B 1UJZA 2Q9IA 1LWUC 3MGNA 3V2NA 2P9XA 1NU1J 5DJTB 5AVSB 4GIFA 3AEDC 1EOQA 2M8NA 2WVRA 2P10A 1SQBD 5F2OA 2Y9YA 1GL2B 1NTZK 2ZJSE 5AW6B 2G8YA 3BCCJ 1ZN5A 3UIAA 1LJ2A 2YXRB 3H1JE 1DIPA 3ZDMA 1GD2E 1S5LX 3HE4B 1RE4A 1DD3A 3PRJA 2A45I 3L72E 2M0BA 5KAFE 2LF4A 3TYYA 3EJDA 3AE5C 2POHA 4HB1A 2PEIA 1AQ5A 3M9BA 3HZQA 3P8MC 1DEBA 3V4WA 2IYOA 3CLQA 3CC7P 3QH9A 4M0IA 2NPSC 1N7LA 1SQQG 1UIIA 2NRGA 3D6ZA 2KK7A 2NO8A 3CCQP 4EDFA 2KOGA 1VPCA 3H1IE 4I2LC 2KNCA 2P7JA 4YXDC 2QRXA 3L37A 2QIWA 5CCGD 3TGUD 5DCKA 1S72P 2ZT9C 2PAJA 2WPQA 2ZFCA 1OFCX 1HQBA 3DS3A 1VQ4P 2JU1A 1S5LH 1VKUA 1VQ8P 1MUUA 3H1LD 1URQD 4OVNF 1FR2A 2L22A 1RY3A 3EFGA 3CD6P 2OARA 3GLMA 2Y9ZA 5AW4B 4CPGA 4U0AA 5BS2A 1FE6A 1SQBK 3H0DA 1JCDA 4R4MA 3P7KA 1J2JB 3OJAB 1T8ZA 1PFIA 1GU5A 1KILD 1EDLA 4H0LD 3HYBA 1BGYD 3AE2C 3L74E 1PGJA 2E76C 4ZMDA 4GKGA 1NTKK 1Y9BA 4N3YB 3CCRP 1AUMA 1FZAA 2R5BA 4JPZB 2HPCA 2OTJP 4PH1A 1LTJA 3ABVC 2FVAA 4N6JA 5KLVE 2AEMA 1EDJA 1SQVD 1KFNA 1M74A 1NKZB 5AW9B 2VLPA 1ZXGA 5APYA 3W67A 1EDKA 1PV3A 3BRVB 3E1IA 1KQGB 3VMXA 2P67A 1OW8A 2VRSA 3WUTA 1LT9A 4D6TE 1SQQD 2ZXEB 3MHVA 3G28A 2HPCB 1LTAC 1M1JA 2FQ1A 1PGPA 2M5AB 1AV1A 3VOPA 2K9YA 2LKIA 2E74B 1G1JA 2J58A 3GG2A 3FWLA 4GR2A 1EQ7A 1NTZJ 3TK1A 1YJ9P 1H8AA 5TISE 2FYUK 2ZYDA 4YTPC 1X8YA 1YQ3C 3KDPB 2QA4P 3AEGC 3B5NC 3GF3A 1VF5C 4KJMA 2W90A 1J1EC 2X2BA 4AYCA 3P32A 2P58A 2KW2A 5AVTB 1BCCE 3PTZA 1KQLA 1M1JC 1GW3A 1A02F 4MN4C 3WMM0 5AVWB 2QG4A 2L5GB 1L4AD 1HF9A 5KKZB 5AW7B 1NTMG 4CA3A 1SQXK 3VMYA 1QVGO 1ZR2A 1KZUB 3IFMA 1NVOA 4D6TD 1NJIQ 1JM0A 2QVAA 2V4HA 3OA7A 3M0AA 3NFQA 3SFEC 3TSIA 5CZDB 5E79E 4B86A 2O01N 2YNYA 4OGQB 2R32A 3L71D 2D2CD 1X9VA 3H1KE 2W8ZA 1PPJD 1Q90D 1HTLC 5KJ7D 3H1JJ 1PPJE 2CQ8A 3CMEP 2HR3A 1VQLP 1SVFA 2A06D 3GHGC 2BASA 2GDYA 1RQUA 1JY2N 3D6YA 1YIJP 2Q3EA 1P84E 3KZIE 3USSA 3MGEA 2JP3A 2RN0A 3IN6A 3PH0A 1ZP0C 2QM8A 1Y8AA 2Z5IA 2HLOA 2YXQB 1NGMB 2FKWB 2LIUA 1ZR4A 3L72G 3M0DA 4PD4H 1KB9D 1LTSC 4BPGA 4ASVA 2Z46A 2YO3A 3L71J 1AJYA 1NTKJ 1E0HA 1SQQJ 3CX5I 1IO4A 2Q6QA 4EYYQ 1LT9C 3SWKA 4GR6A 2ZXXA 2E42A 3FX0A 2N1TD 1EZVD 3WUVA 1NTZE 2C9LY 2H43A 1R5SA 3GMAA 2WSEJ 4IZ6A 2FFDB 3AE3C 3WUUA 4U3FE 1HJ0A 2BCCD 4GODA 1SP4A 2XDJA 1QL1A 2MKVA 2M8PA 1LTJC 2K37A 1RF0C 4M3LA 4XE5B 2FBWC 3H1IJ 2JYLA 3AE7C 2JKVA 1E79H 4H44B 4U3FJ 1IFDA 3DS2A 1QLED 2K9JA 5C39A 5KJ7A 5HGOA 3TNUA 1LP1B 2LL8A 3BCCD 4IL6E 3GJNA 2HODB 2Z4EA 4UB8E 1EDIA 4OGQD 1RH5B 1K9MQ 1LTBC 2R3CA 1M90Q 2PGDA 3N4XA 2KOPA 2B89A 4DCKA 3JCUE 1AFOA 1MZ9A 3RG2A 2IFNA 4H2YC 1IK9A 1SFCC 1EZVE 2I1JA 2N1TA 2K3RA 3KQGA 1L0HA 3L73D 2Z5HA 1L2PA 3DTJA 1NOHA 2KXPB 3WU2H 1X22A 5GTIH 1EC5A 5M1BA 3KZIH 2ZYAA 3IF4A 3C1LA 4WY4A 3H1KG 5CBNA 3CE7A 1YITP 2OYIC 1HH0A 2KP8A 4N78D 1H0TB 3A0BH 2DW3A 3TGUE 1M6NA 1J1EB 1LNQA 1W2BO 3CL3D 3E2DA 1N7SA 2WSFH 3G26A 4KT0J 5E79H 1FC2C 2E5YA 3S4RA 1KD1Q 4C7NA 1URQA 4LGDE 2LXBA 4BXLA 4GOEA 2N6YA 1MV8A 3KXDA 1FZCA 3G71P 1VQOP 1FS0E 3RK3C 2KOQA 2JYGA 2KS1B 1LTGC 3CWBG 1BSNA 1ZMBA 1CEIA 3PLNA 4OGQC 2ZAEB 3HE4A 1BAJA 2O1JA 3G29A 3VMAA 1G1IA 2JWAA 4Y28J 1K04A 2NPSA 1D1DA 1Q2NA 3O8ZA 4BPFA 2EIAA 1CI6A 4XFZA 2JQ4A 2M3BA 3T97A 3HD7C 1ZMEC 1RF1A 3G21A 3Q5SA 3ITKA 1LWUB 4W80A 2L6EA 2LR2A 2K2QA 2QJYB 1GDTA 4HJGH 1FZEA 1SFCD 3SWFA 4RESB 2CGQA 1JOCA 1L4AA 1RNIA 2P1JA 2FADA 3RK3E 2KGAA 4TLFA 3CXHI 3NMDA 1GL2C 3JC22 1RO0A 3R2PA 1JY2P 3H1JD 3M0DC 3A0BE 2ROQA 3D70A 1IMQA 4RKUJ 3GZLA 2A45G 3C9IA 3P8CE 1DNYA 2IBZI 2KGEA 1SLQA 2L4BA 3A0HH 4EI2A 4UHPB 2E75D 3GF7A 1Z6MA 3GHGA 4U0BA 1WRGA 1FDIA 1S4XA 1WT6A 1BCCD 2ONTA 1S2EA 2FYUJ 1JTHA 1LWUA 1VQNP 3RK2B 3JCUH 2L91A 2NPSB 4H13C 4PD4E 2XV5A 1M56D 2Z45A 1BGYG 3GZMA 4YPCA 1KMIZ 3RK3D 1J1DB 2DGYA 5I4TG 3VYIA 1SQPJ 2E75B 3DS0A 2Q7CA 2XKMA 4UB8H 1LTJB 2E74D 2RH0A 1IUQA 2VLNA 2OYHA 3PHLA 2WQYC 1X3OA 2H8PD 2BEZF 3R4YA 1SQVG 3KPEA 4H44C 2N1TC 2M5RA 2K0YA 1NO4A 2N6ZA 3HD7D 1NU1D 4H0LB 4U0FA 1BGYE 4OWFA 4JQ0D 3RL0D 1HVVA 1USDA 3KYQA 1KILE 5CCHC 3G1IA 1BE3E 3HUSA 1U7JA 1GK4A 4AUWA 1Q7YQ 2FQ0A 1N86A 4PJ0H 2M8LA 5B5EH 1OX3A 4BWNA 1DEEG 1VQMP 3CXHD 3AEBC 1PP9J 3LW5H 5BU5A 1LTTC 1IK7A 3N7NA 1GMJA 1KB9E 1SFCB 3V5BA 1NTKD 5H2FE 3AE9C 5AW8B 1HUCA 2N9YB 2KNCB 2LTEA 1VQPP 5HGLA 5CMZA 5AVVB 4K3AA 4EOTA 4L75A 1EZVI 5AVYB 3TF5A 2KG9A 2QJKC 3I55P 2YIUB 2R3SA 4U0CA 1N2DC 3L70G 1ZRTE 2YMKA 5TISH 1Q82Q 2WSSH 4NPEA 2B9BA 3H1KJ 2MVVA 3DS1A 1SQVJ 4TT3H 4EIJA 1L0LJ 2E74C 4W7YA 1JO5A 4QNBA 1BE3D 3CWBD 1L4AB 2WSFJ 1NH4A 7CEIA 2PFXA 2IX7C 3NXSA 4H44D 1IFPA 3I5CA 4RO0A 2W83C 1ZW0A 4IFFA 3F89A 1SQXJ 5GTIE 1JY3P 1L0IA 3WU2E 3RK3B 2AF8A 1M8OB 1SQQE 4BRYA 2JGPA 3DS4A 2WPSA 2K93A 3V4QA 5CCHA 4XA4A 3M1MA 5KKZC 1LP1A 3TNUB 4WYMA 1KFMA 2WITA 3CCEP 3CXCO 5KTBA 1PIXA 1E6JP 1TU3F 1M1KQ 1YTZT 2E76D 5GTHE 2XNXA 1L0LD 1RE3A 3CX5E
chains in the Genus database with same CATH topology
5HGNA 1Q81Q 3DS3A 1VQ4P 2EG5A 3G0VA 1YJNP 1VQ8P 1YHQP 1YITP 4XFXA 4U0DA 1K30A 3WBHA 3CD6P 3I56P 3RG6C 2OARA 1VQPP 5HGLA 2P9XA 2PEQA 4GR6A 1RO2A 3NTEA 1M6NA 4U0AA 3Q20A 5BS2A 3H0DA 2KODA 2EFJA 3E2DA 1W2BO 3I55P 5HGMA 1K8AQ 1QVGO 3H4EA 1EOQA 2CWOA 3H47A 2M8NA 2PEKA 4IPYA 4U0BA 3VRLC 1KC8Q 1N8RQ 4U0CA 3G4SP 2ONTA 1M6EX 2PENA 2XT1A 1JJ2O 1VQNP 5F2OA 1PEMA 3G26A 1NJIQ 1Q82Q 2Z44A 3B5IA 3HYBA 2M8PA 3CC2P 3DS1A 3LRYA 1KD1Q 3DPHA 1QRJA 1A8OA 1YI2P 2Z45A 1VQKP 2BUOA 2JYLA 1Q86Q 2DGYA 5I4TG 1QVFO 3CCRP 1AUMA 2PY8A 3DS2A 1PEQA 4QNBA 3G71P 3CCMP 1VQOP 3DS0A 5HGOA 2JYGA 2OTJP 4PH1A 1K73Q 3CMAP 4COPA 1IUQA 1VQ9P 3CC4P 1ZMBA 2JO0A 1PEUA 3P05A 1M74A 2BQ1E 3CMEP 1BAJA 3G6EP 1VQLP 2LF4A 4PH0A 3G29A 1VQ6P 1A43A 4XROA 5BS1A 3CCJP 4U0FA 1D1DA 2PEOA 2PEIA 2EIAA 3HZQA 4XFZA 3DS4A 1K9MQ 2XV6A 3G21A 1YIJP 1M90Q 3CC7P 5JPAA 2L6EA 4M0IA 1VQ7P 3CPWO 2PEJA 1EIAA 3G1IA 3M1MA 3G28A 3MGEA 3OW2O 4WYMA 2E1MA 4XFYA 1YJWP 3CCEP 2PEMA 1Q7YQ 3CXCO 1PEOA 4COCA 3CCQP 3CCVP 5F2KA 1RNIA 2QEXP 3CCLP 1VQ5P 2M8LA 3CCUP 2BHVA 1E6JP 3G1GA 4GR2A 1M1KQ 2OTLP 1YJ9P 1KQSO 1VQMP 2Z46A 3DS5A 3DTJA 2XXMA 1RO0A 4U0EA 5F2NA 5DCKA 4XRQA 1S72P 2QA4P 3CCSP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G4S P;  3CMA P;  1VQ9 P;  3CC4 P;  1Q81 Q;  1JJ2 O;  3OW2 O;  1VQN P;  2OTJ P;  1YJW P;  3CCE P;  1VQ4 P;  1NJI Q;  1YJN P;  1Q82 Q;  1VQ8 P;  1Q7Y Q;  1YHQ P;  1YIT P;  3CXC O;  3CCQ P;  3CME P;  3G6E P;  3CCV P;  1VQL P;  3CC2 P;  2QEX P;  1KD1 Q;  3CCL P;  1VQ6 P;  1VQ5 P;  3CD6 P;  3I56 P;  3CCU P;  1YI2 P;  1VQP P;  1VQK P;  3CCJ P;  1M1K Q;  2OTL P;  1YJ9 P;  1Q86 Q;  1KQS O;  1VQM P;  1QVF O;  3CCR P;  1W2B O;  1K9M Q;  3I55 P;  3G71 P;  1K8A Q;  3CCM P;  1VQO P;  1YIJ P;  1QVG O;  1M90 Q;  1S72 P;  2QA4 P;  3CCS P;  1VQ7 P;  3CC7 P;  1KC8 Q;  3CPW O;  1N8R Q;  1K73 Q; 
#chains in the Genus database with same CATH topology
 5AVZ B;  2K5X A;  3FXD A;  2Y0E A;  1Q81 Q;  3GW6 A;  2YMY A;  2J5U A;  3M9H A;  2GZG A;  2IZ1 A;  2VLO A;  3WBH A;  1IZN B;  2O3J A;  2WZ7 A;  1KIL A;  2OTK E;  2ERH A;  1EZV G;  2GUS A;  3L73 G;  2JDI H;  3H4E A;  1H0T A;  4IPY A;  1SQP D;  3BVH A;  1CZQ A;  3K5B A;  1JMM A;  2WMM A;  1RE4 C;  1MZ8 A;  2OGU A;  1MKM A;  5KLV K;  3AEF C;  3F5H A;  1PEQ A;  3S1K A;  1N73 B;  1K73 Q;  3L75 J;  2JU2 A;  1M57 D;  1RF1 B;  3B5N D;  4I1L A;  4BPH A;  2FYU G;  3CXH E;  1AYI A;  1H89 A;  3BCC G;  3TDK A;  2E75 C;  2KGC A;  3L74 G;  1DD4 A;  1D7M A;  1NHL A;  4HH2 A;  1JUN A;  2XV6 A;  3BAS A;  2JR8 A;  1SQP G;  4PV1 D;  4A7P A;  4I6M C;  1BDC A;  4AQR D;  3L35 A;  2G3A A;  5KAI H;  2A45 H;  3H1L E;  5CCG A;  4RJT A;  1MFZ A;  3FXE A;  3H1H J;  2XU6 A;  1DH3 A;  5F2N A;  2N98 A;  5K5G B;  1F80 D;  1SQV K;  3CCS P;  1PZQ A;  4ZKP A;  2KG6 A;  1NQ4 A;  5KP7 B;  2D2C C;  3L75 D;  2H89 C;  3L71 E;  1SFC A;  1SQX E;  2LPK A;  2FXP A;  2B87 A;  2N9B A;  4PJ0 E;  3AEC C;  1IFI A;  5AW5 B;  3AE8 C;  2H7H A;  1UNK A;  4GT1 A;  1N8R Q;  3FWN A;  2BCC J;  2XZR A;  1A02 J;  2OQQ A;  3Q2Y A;  1QEX A;  1P84 I;  1PPJ G;  1YBK A;  2GZJ A;  1HGZ A;  4IFD K;  1HGV A;  2MJZ A;  2QJK B;  3LRY A;  3DPH A;  2XZ1 C;  2E5T A;  1OW6 A;  1BE3 G;  2DNW A;  2Y0C A;  1BDD A;  1JB0 J;  2WSC H;  1JNM A;  5KAF H;  2EHT A;  3NTN A;  3CX5 H;  4COP A;  2FYN C;  4ZNC A;  3SSU A;  1U7M A;  3AE6 C;  3HUS B;  1T2K D;  3B4S A;  1EMV A;  4ZKU A;  3L72 D;  2YO2 A;  4PD4 I;  1QL2 A;  2GZF A;  1NTM D;  1RHZ B;  1YTZ I;  1BCC G;  3AE1 C;  1KN7 A;  1N73 A;  3Q5P A;  1SQB J;  1OWA A;  3E7K A;  3EJE A;  2KZI A;  1MFT A;  3G3Z A;  1PEO A;  3OAK A;  5F2K A;  3CCL P;  3A0H E;  2AXC A;  2JBG A;  1NU1 G;  4I7Z B;  5AVU B;  1ZNV A;  1KLP A;  2R44 A;  2LXC B;  3LIE A;  1VF5 D;  3MUD C;  5DJU B;  5B66 E;  3L73 E;  1YQ4 C;  2QSI A;  3Q20 A;  3W68 A;  2GZI A;  1SQP E;  3H6P A;  3A7O A;  1FJP A;  1VDF A;  1KYO E;  1JCC A;  2QNW A;  3AEE C;  1ZLL A;  1R5L A;  2GA1 A;  2QJY C;  1QRJ A;  1VQK P;  3MZW B;  3PP5 A;  2OYH C;  2CPS A;  1CI6 B;  4XFJ A;  4H2W C;  2J59 M;  1X0T A;  3CC4 P;  3CMA P;  1VQ9 P;  3L73 J;  1NTM E;  2QJP B;  4QMA A;  2WSE H;  2K92 A;  2AXT H;  3HE5 A;  1OXZ A;  1SQB G;  1EXJ A;  2FVF A;  1FOS E;  1KOR A;  1VQ6 P;  2IFM A;  5BS1 A;  3H1I D;  2RMZ A;  1RF1 C;  3RL0 g;  2I8D A;  2PEJ A;  1JY2 O;  1BSH A;  2CG5 B;  1HY8 A;  3H1J G;  3IAO A;  5HVC A;  1QX8 A;  2HG5 D;  1ZV8 A;  4COC A;  4R0M A;  2GM4 A;  1QGK B;  1T6A A;  1RE3 C;  3V2R A;  1U57 A;  4O9B A;  3RK2 C;  2YKQ A;  4GDO A;  3L74 J;  3U43 A;  4H13 B;  4DOJ A;  2K94 A;  1HBW A;  2KLU A;  1URQ C;  3RL0 B;  1L0N G;  1J1D C;  2KSE A;  3CWB E;  4JBZ A;  1YHQ P;  2Y0D A;  2LIW A;  3LMO A;  3RG6 C;  1OVU A;  5APV A;  1OR5 A;  2V7Q J;  1HWT C;  2V7Q H;  1IFM A;  3CWB J;  2N1T B;  3H1H G;  4C46 A;  1SQB E;  1KIL C;  1GPJ A;  2KOR A;  4H0L C;  3CXH H;  1JMB A;  2PEN A;  1JJ2 O;  1FJK A;  1RQV A;  3FGA D;  3VTP C;  4JYB A;  1OZH A;  2VSQ A;  5TJH A;  1LTI C;  2LOL A;  5AVR B;  3CC2 P;  2K1A A;  4WY4 D;  2BUO A;  2ZVN B;  3RBZ A;  4DT0 A;  3EJB A;  1OVV A;  4IL6 H;  1NTK E;  3CCM P;  1NYH A;  4OH8 B;  5AW0 B;  2BCC G;  1NU1 K;  1S3J A;  4IFM A;  1LT1 A;  2QM7 A;  4XRO A;  1FZG A;  2KYV A;  4HYT B;  2KOO A;  3HUS C;  4DG9 A;  1NTZ G;  1S9K D;  1BE3 J;  3RGU A;  5KP6 B;  3MTU E;  3L70 E;  3M9Q A;  3GKL C;  2N5H A;  1YJW P;  1FZC B;  1NAF A;  1KB9 I;  2YIU C;  3RK2 D;  1FU1 A;  1NU1 E;  2FFD A;  4JYC A;  1VQ5 P;  1JY3 O;  2B87 B;  2BHV A;  2FYU D;  2UWJ E;  3E1R A;  4L74 A;  5APT A;  2OTL P;  3U59 A;  4PWV B;  3LW5 J;  2JEE A;  2KR5 A;  3IR9 A;  1FDM A;  1YJN P;  2O01 J;  4XFX A;  1L4A C;  2WT7 B;  2K0X A;  1W5C E;  3MD0 A;  3HTK A;  5KLI C;  2MY5 A;  3NTE A;  2FHS C;  1ACP A;  2LKM A;  3QWO C;  2NPS D;  2Q3I A;  1K8A Q;  5APU A;  2WPT A;  2KZJ A;  2PEK A;  1P84 H;  2XT1 A;  3V2P A;  3H1K D;  3G9R A;  1M7L A;  2FYZ A;  2IDB A;  2KGD A;  5AW2 B;  1YYC A;  3CX5 D;  1Q86 Q;  2O1K A;  1VL2 A;  2M3E A;  3H32 A;  3H1L J;  3EWK A;  3VP9 A;  1UIX A;  2IZ0 A;  2O01 H;  3B5N A;  5KAI E;  2JO0 A;  1AVO A;  2FXO A;  1IJD B;  4C7R A;  2OYH B;  4GOF A;  4PH0 A;  1PP9 G;  1NKN A;  3M06 A;  3L36 A;  3L72 J;  1XTC C;  2FY8 A;  3H25 A;  3D71 A;  1N7S C;  3O6Q A;  3L71 G;  2AEF A;  2E1M A;  2I1K A;  5H2F H;  5BVZ A;  1NTM K;  1NTK G;  5KLV G;  1H88 A;  3CCV P;  3EQ2 A;  3BCC E;  3LID A;  3SFD C;  3II6 A;  1KQF B;  2ZYG A;  3H1H E;  5B5E E;  2W6A A;  2EHS A;  3L70 J;  2Q5U A;  4F37 A;  5HGN A;  4Z1M H;  3S9O A;  4WBA A;  2GDW A;  1GK6 A;  1N73 C;  1SQP K;  1L0N E;  2PEQ A;  1L0L G;  3HD7 A;  4H2X C;  2GDX A;  3H1I G;  2XZ0 D;  5EFW B;  2WT7 A;  3H47 A;  3VRL C;  4K35 A;  3V2Q A;  4HKG A;  2KSJ A;  2FAC A;  2M5A A;  5KLV D;  5APX A;  2JO1 A;  1FZF A;  2SPZ A;  3BRT B;  5GTH H;  5APQ A;  4H13 D;  1L0N K;  3HRN A;  3T97 B;  3L74 D;  1NTM J;  2L0Q A;  1L0L K;  1PEU A;  2WPV B;  5APW A;  2HFE D;  1EXI A;  3A5T A;  2MR8 A;  2D2C B;  4PV1 B;  3V6I A;  1AF8 A;  2JAZ A;  1P84 D;  2IBZ G;  4MRT C;  3Q3D A;  3TGU J;  1XTG B;  2VLQ A;  4WVZ A;  3CPW O;  2HYN A;  2E76 B;  3B4Q A;  1PGO A;  5CCH D;  1K05 A;  4WY4 C;  1USE A;  4JF7 A;  1GW4 A;  2R5D A;  1NWQ A;  2A06 G;  2KI7 B;  2AEJ A;  5KP8 B;  1HJB A;  1S5L E;  2NZ2 A;  1AVY A;  2BEQ D;  1FZC C;  1KYO I;  5KJ7 C;  3VMZ A;  4PD4 D;  1FOS F;  1DX7 A;  4D6T G;  2CK3 H;  2FYN B;  1SQQ K;  2IBZ D;  3BAT A;  2YKO A;  2KOD A;  4DZO A;  2BCC E;  4U3F D;  3EFF K;  2YKP A;  1Y47 A;  2MD9 A;  1W2E A;  4IOI H;  1SQX D;  1KB9 H;  1T3J A;  2KOS A;  5AW1 B;  4L73 A;  3HE5 B;  1IMP A;  1T8K A;  1M1J B;  2WWW A;  4W7Z A;  1X79 B;  3TGU G;  3Q5R A;  4ASW A;  4I7Z C;  2LML A;  2GYK A;  2KS1 A;  1GXH A;  5B66 H;  3CCJ P;  1AQT A;  1OMI A;  2WTY A;  2MF4 A;  5JPA A;  1JTH B;  1VQ7 P;  4U3F G;  4C7N B;  3H1L G;  2PNG A;  3CI9 A;  2W27 A;  4XFY A;  2PEM A;  1CW5 A;  1SQX G;  5EW5 E;  4Y99 C;  1BXI A;  2KLV A;  3NY7 B;  3SWY A;  2QEX P;  2FAE A;  1SQV E;  1GL2 D;  5AW3 B;  1N7S B;  4D6T J;  2K0D X;  3G1G A;  1KQS O;  2XXM A;  5AVQ B;  2P2U A;  4PXH B;  2N50 A;  3B8E B;  1KYO D;  1GL2 A;  2H88 C;  3GHG B;  3MP7 B;  1FAV A;  4HKZ H;  2FYU E;  5EJD A;  3A2A A;  2EG5 A;  1LGH B;  5BU8 B;  2KIK A;  2M8R A;  3B71 A;  4KHX A;  4U0D A;  1K30 A;  4IL6 X;  5KLV J;  2QJP C;  2KUB A;  1N7S D;  1BGY J;  2A06 E;  3M91 A;  1KC8 Q;  3U1A A;  3O6Q B;  3G4S P;  1S1C X;  2KB7 P;  1M6E X;  3RBX A;  1GXG A;  1PEM A;  1FDO A;  2KWL A;  2AFE A;  4LC1 A;  2MR7 A;  5CJ4 A;  1A8O A;  1YI2 P;  2GZE A;  1FBM A;  1BCC J;  2CPB A;  2JWD A;  5CBO A;  4UB6 H;  2W6B A;  4NPD A;  4WWI A;  2PY8 A;  4YXW H;  2L9F A;  3C8V A;  1E5W A;  1LT9 B;  1GZL A;  1KV4 A;  2WSC J;  1JY3 N;  1SS1 A;  2ZT9 D;  3A3Y B;  3L4F A;  1Z56 A;  2Q1K A;  1R8E A;  4DJG A;  2N5I A;  2FFD C;  1URQ B;  3RL0 C;  1A43 A;  1ZOY C;  2PEO A;  3AEA C;  2AXT E;  4L76 A;  3L75 G;  1CSB A;  3MIW A;  2GUV A;  1NTZ D;  1EIA A;  2K88 A;  2IBZ E;  3MUD A;  4R4L A;  3OW2 O;  5APS A;  4PV1 C;  1FZB A;  3L75 E;  1ZRT D;  4NPF X;  1OIP A;  2ZT9 B;  1KIL B;  2OYI A;  3VP8 A;  1KTM A;  4U0E A;  1G2C B;  4WY4 B;  3P8C D;  1DV5 A;  2C0X A;  2ZVO B;  3PJS K;  2QE7 H;  1AA0 A;  1JEK A;  1T3U A;  1PGQ A;  1RF0 A;  2XND H;  2C9N Y;  4LLH A;  3I56 P;  1RO2 A;  1G2C A;  1WMK A;  2FVE A;  3HTK B;  2EFJ A;  5HGM A;  2CWO A;  3Q1M A;  1IFJ A;  2AVA A;  2Z44 A;  3B5I A;  1IFN A;  2FQ2 A;  3JSV C;  4BRY B;  3VN0 A;  2IPP A;  2C0W A;  2FXM A;  5AVX B;  2W6J H;  4N78 E;  3KHU A;  1QVF O;  1OVR A;  5CHX A;  2CNR A;  2KG8 A;  1PL5 A;  2OYI B;  1VHN A;  3AE4 C;  2JB0 A;  1GU4 A;  1IC2 A;  1PP9 E;  2K9J B;  5CJ0 A;  2WPR A;  3P05 A;  4UB6 E;  2BQ1 E;  5L8R J;  4QKO A;  3L70 D;  3G6E P;  1T2K C;  1S9K E;  1NAY A;  2RKL A;  2PRR A;  2HOD A;  2AFD A;  4NEO A;  1OW7 A;  2B88 A;  3U1C A;  1L0N J;  5KLI B;  1KYO H;  1L0N D;  2IYP A;  1GTW A;  3B5N B;  1VF5 B;  1PP9 D;  1L0L E;  2ITA A;  3H32 B;  3CCU P;  4U7J A;  3DS5 A;  2E43 A;  4XRQ A;  4WB4 A;  3H1H D;  5CCG C;  4Y99 B;  2PP6 A;  2OYO A;  2MVU A;  2JJL A;  5HV8 A;  3G0V A;  3HD7 B;  1UJZ A;  2Q9I A;  1LWU C;  3MGN A;  3V2N A;  2P9X A;  1NU1 J;  5DJT B;  5AVS B;  4GIF A;  3AED C;  1EOQ A;  2M8N A;  2WVR A;  2P10 A;  1SQB D;  5F2O A;  2Y9Y A;  1GL2 B;  1NTZ K;  2ZJS E;  5AW6 B;  2G8Y A;  3BCC J;  1ZN5 A;  3UIA A;  1LJ2 A;  2YXR B;  3H1J E;  1DIP A;  3ZDM A;  1GD2 E;  1S5L X;  3HE4 B;  1RE4 A;  1DD3 A;  3PRJ A;  2A45 I;  3L72 E;  2M0B A;  5KAF E;  2LF4 A;  3TYY A;  3EJD A;  3AE5 C;  2POH A;  4HB1 A;  2PEI A;  1AQ5 A;  3M9B A;  3HZQ A;  3P8M C;  1DEB A;  3V4W A;  2IYO A;  3CLQ A;  3CC7 P;  3QH9 A;  4M0I A;  2NPS C;  1N7L A;  1SQQ G;  1UII A;  2NRG A;  3D6Z A;  2KK7 A;  2NO8 A;  3CCQ P;  4EDF A;  2KOG A;  1VPC A;  3H1I E;  4I2L C;  2KNC A;  2P7J A;  4YXD C;  2QRX A;  3L37 A;  2QIW A;  5CCG D;  3TGU D;  5DCK A;  1S72 P;  2ZT9 C;  2PAJ A;  2WPQ A;  2ZFC A;  1OFC X;  1HQB A;  3DS3 A;  1VQ4 P;  2JU1 A;  1S5L H;  1VKU A;  1VQ8 P;  1MUU A;  3H1L D;  1URQ D;  4OVN F;  1FR2 A;  2L22 A;  1RY3 A;  3EFG A;  3CD6 P;  2OAR A;  3GLM A;  2Y9Z A;  5AW4 B;  4CPG A;  4U0A A;  5BS2 A;  1FE6 A;  1SQB K;  3H0D A;  1JCD A;  4R4M A;  3P7K A;  1J2J B;  3OJA B;  1T8Z A;  1PFI A;  1GU5 A;  1KIL D;  1EDL A;  4H0L D;  3HYB A;  1BGY D;  3AE2 C;  3L74 E;  1PGJ A;  2E76 C;  4ZMD A;  4GKG A;  1NTK K;  1Y9B A;  4N3Y B;  3CCR P;  1AUM A;  1FZA A;  2R5B A;  4JPZ B;  2HPC A;  2OTJ P;  4PH1 A;  1LTJ A;  3ABV C;  2FVA A;  4N6J A;  5KLV E;  2AEM A;  1EDJ A;  1SQV D;  1KFN A;  1M74 A;  1NKZ B;  5AW9 B;  2VLP A;  1ZXG A;  5APY A;  3W67 A;  1EDK A;  1PV3 A;  3BRV B;  3E1I A;  1KQG B;  3VMX A;  2P67 A;  1OW8 A;  2VRS A;  3WUT A;  1LT9 A;  4D6T E;  1SQQ D;  2ZXE B;  3MHV A;  3G28 A;  2HPC B;  1LTA C;  1M1J A;  2FQ1 A;  1PGP A;  2M5A B;  1AV1 A;  3VOP A;  2K9Y A;  2LKI A;  2E74 B;  1G1J A;  2J58 A;  3GG2 A;  3FWL A;  4GR2 A;  1EQ7 A;  1NTZ J;  3TK1 A;  1YJ9 P;  1H8A A;  5TIS E;  2FYU K;  2ZYD A;  4YTP C;  1X8Y A;  1YQ3 C;  3KDP B;  2QA4 P;  3AEG C;  3B5N C;  3GF3 A;  1VF5 C;  4KJM A;  2W90 A;  1J1E C;  2X2B A;  4AYC A;  3P32 A;  2P58 A;  2KW2 A;  5AVT B;  1BCC E;  3PTZ A;  1KQL A;  1M1J C;  1GW3 A;  1A02 F;  4MN4 C;  3WMM 0;  5AVW B;  2QG4 A;  2L5G B;  1L4A D;  1HF9 A;  5KKZ B;  5AW7 B;  1NTM G;  4CA3 A;  1SQX K;  3VMY A;  1QVG O;  1ZR2 A;  1KZU B;  3IFM A;  1NVO A;  4D6T D;  1NJI Q;  1JM0 A;  2QVA A;  2V4H A;  3OA7 A;  3M0A A;  3NFQ A;  3SFE C;  3TSI A;  5CZD B;  5E79 E;  4B86 A;  2O01 N;  2YNY A;  4OGQ B;  2R32 A;  3L71 D;  2D2C D;  1X9V A;  3H1K E;  2W8Z A;  1PPJ D;  1Q90 D;  1HTL C;  5KJ7 D;  3H1J J;  1PPJ E;  2CQ8 A;  3CME P;  2HR3 A;  1VQL P;  1SVF A;  2A06 D;  3GHG C;  2BAS A;  2GDY A;  1RQU A;  1JY2 N;  3D6Y A;  1YIJ P;  2Q3E A;  1P84 E;  3KZI E;  3USS A;  3MGE A;  2JP3 A;  2RN0 A;  3IN6 A;  3PH0 A;  1ZP0 C;  2QM8 A;  1Y8A A;  2Z5I A;  2HLO A;  2YXQ B;  1NGM B;  2FKW B;  2LIU A;  1ZR4 A;  3L72 G;  3M0D A;  4PD4 H;  1KB9 D;  1LTS C;  4BPG A;  4ASV A;  2Z46 A;  2YO3 A;  3L71 J;  1AJY A;  1NTK J;  1E0H A;  1SQQ J;  3CX5 I;  1IO4 A;  2Q6Q A;  4EYY Q;  1LT9 C;  3SWK A;  4GR6 A;  2ZXX A;  2E42 A;  3FX0 A;  2N1T D;  1EZV D;  3WUV A;  1NTZ E;  2C9L Y;  2H43 A;  1R5S A;  3GMA A;  2WSE J;  4IZ6 A;  2FFD B;  3AE3 C;  3WUU A;  4U3F E;  1HJ0 A;  2BCC D;  4GOD A;  1SP4 A;  2XDJ A;  1QL1 A;  2MKV A;  2M8P A;  1LTJ C;  2K37 A;  1RF0 C;  4M3L A;  4XE5 B;  2FBW C;  3H1I J;  2JYL A;  3AE7 C;  2JKV A;  1E79 H;  4H44 B;  4U3F J;  1IFD A;  3DS2 A;  1QLE D;  2K9J A;  5C39 A;  5KJ7 A;  5HGO A;  3TNU A;  1LP1 B;  2LL8 A;  3BCC D;  4IL6 E;  3GJN A;  2HOD B;  2Z4E A;  4UB8 E;  1EDI A;  4OGQ D;  1RH5 B;  1K9M Q;  1LTB C;  2R3C A;  1M90 Q;  2PGD A;  3N4X A;  2KOP A;  2B89 A;  4DCK A;  3JCU E;  1AFO A;  1MZ9 A;  3RG2 A;  2IFN A;  4H2Y C;  1IK9 A;  1SFC C;  1EZV E;  2I1J A;  2N1T A;  2K3R A;  3KQG A;  1L0H A;  3L73 D;  2Z5H A;  1L2P A;  3DTJ A;  1NOH A;  2KXP B;  3WU2 H;  1X22 A;  5GTI H;  1EC5 A;  5M1B A;  3KZI H;  2ZYA A;  3IF4 A;  3C1L A;  4WY4 A;  3H1K G;  5CBN A;  3CE7 A;  1YIT P;  2OYI C;  1HH0 A;  2KP8 A;  4N78 D;  1H0T B;  3A0B H;  2DW3 A;  3TGU E;  1M6N A;  1J1E B;  1LNQ A;  1W2B O;  3CL3 D;  3E2D A;  1N7S A;  2WSF H;  3G26 A;  4KT0 J;  5E79 H;  1FC2 C;  2E5Y A;  3S4R A;  1KD1 Q;  4C7N A;  1URQ A;  4LGD E;  2LXB A;  4BXL A;  4GOE A;  2N6Y A;  1MV8 A;  3KXD A;  1FZC A;  3G71 P;  1VQO P;  1FS0 E;  3RK3 C;  2KOQ A;  2JYG A;  2KS1 B;  1LTG C;  3CWB G;  1BSN A;  1ZMB A;  1CEI A;  3PLN A;  4OGQ C;  2ZAE B;  3HE4 A;  1BAJ A;  2O1J A;  3G29 A;  3VMA A;  1G1I A;  2JWA A;  4Y28 J;  1K04 A;  2NPS A;  1D1D A;  1Q2N A;  3O8Z A;  4BPF A;  2EIA A;  1CI6 A;  4XFZ A;  2JQ4 A;  2M3B A;  3T97 A;  3HD7 C;  1ZME C;  1RF1 A;  3G21 A;  3Q5S A;  3ITK A;  1LWU B;  4W80 A;  2L6E A;  2LR2 A;  2K2Q A;  2QJY B;  1GDT A;  4HJG H;  1FZE A;  1SFC D;  3SWF A;  4RES B;  2CGQ A;  1JOC A;  1L4A A;  1RNI A;  2P1J A;  2FAD A;  3RK3 E;  2KGA A;  4TLF A;  3CXH I;  3NMD A;  1GL2 C;  3JC2 2;  1RO0 A;  3R2P A;  1JY2 P;  3H1J D;  3M0D C;  3A0B E;  2ROQ A;  3D70 A;  1IMQ A;  4RKU J;  3GZL A;  2A45 G;  3C9I A;  3P8C E;  1DNY A;  2IBZ I;  2KGE A;  1SLQ A;  2L4B A;  3A0H H;  4EI2 A;  4UHP B;  2E75 D;  3GF7 A;  1Z6M A;  3GHG A;  4U0B A;  1WRG A;  1FDI A;  1S4X A;  1WT6 A;  1BCC D;  2ONT A;  1S2E A;  2FYU J;  1JTH A;  1LWU A;  1VQN P;  3RK2 B;  3JCU H;  2L91 A;  2NPS B;  4H13 C;  4PD4 E;  2XV5 A;  1M56 D;  2Z45 A;  1BGY G;  3GZM A;  4YPC A;  1KMI Z;  3RK3 D;  1J1D B;  2DGY A;  5I4T G;  3VYI A;  1SQP J;  2E75 B;  3DS0 A;  2Q7C A;  2XKM A;  4UB8 H;  1LTJ B;  2E74 D;  2RH0 A;  1IUQ A;  2VLN A;  2OYH A;  3PHL A;  2WQY C;  1X3O A;  2H8P D;  2BEZ F;  3R4Y A;  1SQV G;  3KPE A;  4H44 C;  2N1T C;  2M5R A;  2K0Y A;  1NO4 A;  2N6Z A;  3HD7 D;  1NU1 D;  4H0L B;  4U0F A;  1BGY E;  4OWF A;  4JQ0 D;  3RL0 D;  1HVV A;  1USD A;  3KYQ A;  1KIL E;  5CCH C;  3G1I A;  1BE3 E;  3HUS A;  1U7J A;  1GK4 A;  4AUW A;  1Q7Y Q;  2FQ0 A;  1N86 A;  4PJ0 H;  2M8L A;  5B5E H;  1OX3 A;  4BWN A;  1DEE G;  1VQM P;  3CXH D;  3AEB C;  1PP9 J;  3LW5 H;  5BU5 A;  1LTT C;  1IK7 A;  3N7N A;  1GMJ A;  1KB9 E;  1SFC B;  3V5B A;  1NTK D;  5H2F E;  3AE9 C;  5AW8 B;  1HUC A;  2N9Y B;  2KNC B;  2LTE A;  1VQP P;  5HGL A;  5CMZ A;  5AVV B;  4K3A A;  4EOT A;  4L75 A;  1EZV I;  5AVY B;  3TF5 A;  2KG9 A;  2QJK C;  3I55 P;  2YIU B;  2R3S A;  4U0C A;  1N2D C;  3L70 G;  1ZRT E;  2YMK A;  5TIS H;  1Q82 Q;  2WSS H;  4NPE A;  2B9B A;  3H1K J;  2MVV A;  3DS1 A;  1SQV J;  4TT3 H;  4EIJ A;  1L0L J;  2E74 C;  4W7Y A;  1JO5 A;  4QNB A;  1BE3 D;  3CWB D;  1L4A B;  2WSF J;  1NH4 A;  7CEI A;  2PFX A;  2IX7 C;  3NXS A;  4H44 D;  1IFP A;  3I5C A;  4RO0 A;  2W83 C;  1ZW0 A;  4IFF A;  3F89 A;  1SQX J;  5GTI E;  1JY3 P;  1L0I A;  3WU2 E;  3RK3 B;  2AF8 A;  1M8O B;  1SQQ E;  4BRY A;  2JGP A;  3DS4 A;  2WPS A;  2K93 A;  3V4Q A;  5CCH A;  4XA4 A;  3M1M A;  5KKZ C;  1LP1 A;  3TNU B;  4WYM A;  1KFM A;  2WIT A;  3CCE P;  3CXC O;  5KTB A;  1PIX A;  1E6J P;  1TU3 F;  1M1K Q;  1YTZ T;  2E76 D;  5GTH E;  2XNX A;  1L0L D;  1RE3 A;  3CX5 E; 
#chains in the Genus database with same CATH homology
 5HGN A;  1Q81 Q;  3DS3 A;  1VQ4 P;  2EG5 A;  3G0V A;  1YJN P;  1VQ8 P;  1YHQ P;  1YIT P;  4XFX A;  4U0D A;  1K30 A;  3WBH A;  3CD6 P;  3I56 P;  3RG6 C;  2OAR A;  1VQP P;  5HGL A;  2P9X A;  2PEQ A;  4GR6 A;  1RO2 A;  3NTE A;  1M6N A;  4U0A A;  3Q20 A;  5BS2 A;  3H0D A;  2KOD A;  2EFJ A;  3E2D A;  1W2B O;  3I55 P;  5HGM A;  1K8A Q;  1QVG O;  3H4E A;  1EOQ A;  2CWO A;  3H47 A;  2M8N A;  2PEK A;  4IPY A;  4U0B A;  3VRL C;  1KC8 Q;  1N8R Q;  4U0C A;  3G4S P;  2ONT A;  1M6E X;  2PEN A;  2XT1 A;  1JJ2 O;  1VQN P;  5F2O A;  1PEM A;  3G26 A;  1NJI Q;  1Q82 Q;  2Z44 A;  3B5I A;  3HYB A;  2M8P A;  3CC2 P;  3DS1 A;  3LRY A;  1KD1 Q;  3DPH A;  1QRJ A;  1A8O A;  1YI2 P;  2Z45 A;  1VQK P;  2BUO A;  2JYL A;  1Q86 Q;  2DGY A;  5I4T G;  1QVF O;  3CCR P;  1AUM A;  2PY8 A;  3DS2 A;  1PEQ A;  4QNB A;  3G71 P;  3CCM P;  1VQO P;  3DS0 A;  5HGO A;  2JYG A;  2OTJ P;  4PH1 A;  1K73 Q;  3CMA P;  4COP A;  1IUQ A;  1VQ9 P;  3CC4 P;  1ZMB A;  2JO0 A;  1PEU A;  3P05 A;  1M74 A;  2BQ1 E;  3CME P;  1BAJ A;  3G6E P;  1VQL P;  2LF4 A;  4PH0 A;  3G29 A;  1VQ6 P;  1A43 A;  4XRO A;  5BS1 A;  3CCJ P;  4U0F A;  1D1D A;  2PEO A;  2PEI A;  2EIA A;  3HZQ A;  4XFZ A;  3DS4 A;  1K9M Q;  2XV6 A;  3G21 A;  1YIJ P;  1M90 Q;  3CC7 P;  5JPA A;  2L6E A;  4M0I A;  1VQ7 P;  3CPW O;  2PEJ A;  1EIA A;  3G1I A;  3M1M A;  3G28 A;  3MGE A;  3OW2 O;  4WYM A;  2E1M A;  4XFY A;  1YJW P;  3CCE P;  2PEM A;  1Q7Y Q;  3CXC O;  1PEO A;  4COC A;  3CCQ P;  3CCV P;  5F2K A;  1RNI A;  2QEX P;  3CCL P;  1VQ5 P;  2M8L A;  3CCU P;  2BHV A;  1E6J P;  3G1G A;  4GR2 A;  1M1K Q;  2OTL P;  1YJ9 P;  1KQS O;  1VQM P;  2Z46 A;  3DS5 A;  3DTJ A;  2XXM A;  1RO0 A;  4U0E A;  5F2N A;  5DCK A;  4XRQ A;  1S72 P;  2QA4 P;  3CCS P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...