3G71P

Co-crystal structure of bruceantin bound to the large ribosomal subunit
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title U2504 determines the species specificity of the A-site cleft antibiotics: the structures of tiamulin, homoharringtonine, and bruceantin bound to the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal RNA
total genus 44
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2009-02-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3g71P03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 3g71P01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 3g71P02
3CC7P 3G6EP 1K9MQ 1YIJP 1YITP 1Q7YQ 1YHQP 3G71P 3CC4P 1VQNP 1VQ4P 3CCSP 1M1KQ 3CCRP 1S72P 2OTLP 2QEXP 3CCEP 1W2BO 3CD6P 1K8AQ 3CCLP 1K73Q 3CXCO 1KQSO 3CCUP 1VQ9P 1VQ8P 1VQ7P 2QA4P 1QVGO 3CMAP 1VQOP 3CCQP 1M90Q 1KD1Q 1JJ2O 1VQMP 1NJIQ 1VQLP 1VQ6P 1N8RQ 3CPWO 3CMEP 2OTJP 3I55P 3CCVP 1KC8Q 1YJ9P 1VQPP 1QVFO 3I56P 1Q86Q 3CCJP 1VQ5P 3CCMP 1VQKP 3CC2P 3OW2O 1Q81Q 1YJWP 3G4SP 1YJNP 1YI2P 1Q82Q
chains in the Genus database with same CATH superfamily
1KN7A 1ZW0A 1G2CA 5KTBA 1JY3P 3GW6A 2GZFA 2XXMA 4GIFA 4I1LA 4XFYA 4COCA 4U0EA 5KKZB 5BU8B 2KI7B 1KYOE 1EMVA 1M57D 2HYNA 1Q81Q 2OYIA 2K9YA 2JO0A 1WRGA 2N6YA 4KT0J 3HE4B 3O6QA 1MZ8A 3CCUP 3H1IJ 2BUOA 5CCGA 2IPPA 1FZGA 2OTJP 2JU2A 2WSCJ 5TISH 3E1RA 4H13B 1SQXK 2OYOA 2PEJA 4EIJA 1E79H 4HH2A 1K9MQ 2P9XA 2B9BA 1YTZI 2JU1A 1JNMA 1PP9D 1EDLA 3D71A 5CHXA 4PV1C 3NFQA 3LIEA 1GMJA 2JYLA 2NRGA 2ZT9C 3AEBC 1EOQA 5HGOA 3H1ID 3GF7A 1RO2A 1JB0J 3N7NA 3PTZA 4H2YC 3CCJP 1OW6A 3AECC 1OXZA 1VDFA 1KLPA 2NPSC 2FXPA 1EC5A 1Q7YQ 2OARA 3Q20A 3NTNA 4H0LC 2Q9IA 1JY2O 1K73Q 2KLVA 4IL6E 2AXCA 3RL0C 1N7SD 4WWIA 2Y9ZA 1RF0C 5H2FH 4EI2A 1IFDA 1H0TB 5BU5A 1VF5B 2JO1A 4DT0A 4H0LB 2P1JA 1HWTC 1A02F 2N5HA 1FDOA 1KB9E 1SP4A 1PGPA 2WPRA 2Q5UA 2MR8A 2YMKA 3Q2YA 5H2FE 3L35A 4L73A 1LWUA 2MKVA 5JPAA 3VMXA 1IJDB 3CE7A 4DJGA 3IR9A 4RJTA 3MP7B 1DEEG 4U0DA 1LTJB 3M06A 2M8PA 3SSUA 1LT9A 3CL3D 1PGQA 5AW7B 1KMIZ 1M7LA 2AFDA 1QLED 1QX8A 5F2KA 3DS5A 4H0LD 2GZJA 3BRVB 3GHGA 1N73B 1GK6A 1IFNA 3HD7C 2PNGA 1NJIQ 2IBZI 1LTSC 4W7ZA 2P2UA 3CX5I 1IUQA 3CLQA 3AE1C 1EDJA 4PWVB 2QJYC 2OTKE 1XTCC 2FHSC 1YHQP 5AVRB 3H1LG 2C0XA 3DS1A 1W2BO 1ZMBA 1EZVD 1DEBA 1SQBE 4RKUJ 2M8NA 5APYA 2K37A 4U3FD 4ZKUA 4QKOA 1Q82Q 2QVAA 5CCHD 2L91A 2FYNC 2QM8A 3Q5RA 1NTMD 2KG6A 3B5NA 1X3OA 1AVYA 1NQ4A 4ASWA 1HUCA 1JJ2O 5E79E 2FKWB 4ZMDA 3R4YA 3HTKB 2IZ0A 5APXA 1YJ9P 2AXTE 1NTMG 2E1MA 1BCCD 1U7MA 3WUVA 5F2OA 2DW3A 3EQ2A 2ZJSE 3EFGA 1G2CB 4CA3A 1JCDA 2BCCG 3R2PA 1K8AQ 3SFDC 5TJHA 2R3CA 5CCGC 3G1GA 1L0LD 4R4MA 3CCQP 1LTIC 4UB6E 3VP8A 1RH5B 4D6TE 2FFDC 2RKLA 1N2DC 3M9BA 1IZNB 4JYCA 4BRYA 3Q3DA 1ZR2A 1VHNA 2PEQA 5AW0B 3W67A 4XA4A 1FR2A 2H88C 1NYHA 1DX7A 3C8VA 1VPCA 2ZYGA 1LTTC 1YYCA 1QVFO 1ZXGA 4F37A 3C9IA 1BSHA 4U3FG 2XU6A 2AEFA 2AVAA 2NO8A 1GW4A 1RNIA 4W80A 1KILE 1USEA 1G1JA 2V4HA 1SQBJ 4COPA 1M74A 2ROQA 2H43A 1NTKE 2Q3EA 3CPWO 2HPCA 2N5IA 3M0AA 3U59A 3PRJA 2QJYB 3KQGA 1LTJC 2KR5A 1EXJA 1U57A 3DS3A 1SQXE 3H1JG 1Q90D 3II6A 4D6TJ 3JSVC 1VQ8P 2EHTA 1LT9C 3L70G 1L4AD 1BSNA 1RF1B 3OW2O 2PEKA 2FADA 2GDYA 2JB0A 5K5GB 1M8OB 3L72G 3OA7A 3SWFA 3F5HA 2B89A 1L0LE 1VQ7P 2Y9YA 3CMAP 2CPSA 1JTHB 4XRQA 1L4AA 1IK7A 1AV1A 2WWWA 2Q6QA 2PEOA 1NKZB 1LWUC 3IN6A 3L72J 2BEQD 3AE3C 2XV6A 3RK2D 1GPJA 1T6AA 1VQMP 1KQFB 5APSA 2LPKA 2D2CD 2LOLA 3I5CA 2DNWA 2FFDB 2KW2A 1TU3F 2E5YA 1OW8A 3L74G 2EG5A 1VF5C 3DS4A 3L75J 4WY4D 1IO4A 2K0YA 3EJBA 1ZOYC 1NTKJ 1EZVE 1VQOP 2E75B 3AEFC 1KC8Q 2QIWA 5KLVD 2P7JA 2KOGA 3CC2P 1GL2A 2RH0A 5KLVE 3RK3E 4QMAA 2B88A 3TNUA 2W6AA 1FAVA 3RL0g 2ZAEB 2LKIA 2ZXEB 3H1IG 3L74J 4H44B 1KFMA 3ZDMA 3MHVA 1KD1Q 2WSCH 2HFED 3B4QA 3CCVP 3TGUE 3I56P 4D6TD 1L0IA 4R4LA 2X2BA 3H1KE 2XT1A 2LXCB 2E43A 3FWNA 4C7NA 2GZEA 1T3UA 1X9VA 1ZN5A 1PEMA 4DG9A 1OR5A 2WT7A 3A7OA 1VKUA 2EIAA 1RY3A 3KZIH 2N1TB 5APTA 3B4SA 3KDPB 4XROA 1ZR4A 1WT6A 4PD4D 3M0DC 1URQB 5L8RJ 3H0DA 4PV1D 1M1JA 4BPGA 3WU2H 3CCSP 1S72P 1Y9BA 2KGEA 1JMBA 3CD6P 3G26A 4K35A 2KSJA 1BGYE 4YXWH 1KFNA 4NPFX 3HUSB 5HGMA 1NTMJ 2KXPB 1JY2N 2KOOA 2WVRA 2ITAA 4WY4A 2SPZA 2CK3H 3CWBJ 3N4XA 1URQC 4DCKA 5AW9B 3AE4C 3A0BE 1W5CE 1IMPA 1L0NE 4JQ0D 1AUMA 3RL0D 3LW5H 7CEIA 1RQUA 4AUWA 3QWOC 3GG2A 3L73D 3LRYA 1LT9B 2W8ZA 1R8EA 4ASVA 3H47A 3L73J 3G21A 3GMAA 5AVTB 3PH0A 1N7SC 1SQPK 3TYYA 4NPDA 2KS1A 4GR2A 1GU5A 1H8AA 1DD3A 5HV8A 1UIXA 2CQ8A 1FDIA 3MTUE 2K9JB 5DCKA 2WSFH 1UIIA 2RN0A 4H44D 2PRRA 3Q5SA 5KLVJ 1RE4C 4DOJA 3E1IA 4WBAA 3L71G 1SQPD 1BDDA 2NPSB 2WSEJ 2Z46A 3FGAD 3MZWB 5APVA 3S4RA 5HGNA 3H6PA 1A02J 3MUDC 2E74D 1L2PA 3VTPC 3CCLP 1EXIA 3RL0B 1SFCD 3CWBE 4LGDE 1QVGO 1EZVG 2VSQA 5AVQB 1NAYA 1FC2C 3VMZA 1YI2P 1SFCB 4GR6A 3CC4P 3L74E 1NVOA 1PPJE 1RF1A 1CSBA 2KB7P 3MIWA 1RE3C 4PJ0H 1SQBD 3H1JD 2AEJA 1NTZE 5EJDA 2KK7A 2ZFCA 2YKQA 4JPZB 3RBZA 3WUUA 3RK3D 4H44C 1QL2A 1L0HA 2Z44A 1SQPJ 1GD2E 3QH9A 1OFCX 4JBZA 1RF0A 4XFZA 1FU1A 2EHSA 1T3JA 1KILC 1IFPA 2I1KA 5KAIH 3GZLA 3RG6C 3BCCD 4PXHB 2MR7A 1KZUB 2A06E 2P58A 4BRYB 3JCUH 1PP9E 2N1TD 1LTGC 3AE8C 5AVYB 3G28A 2PP6A 2VRSA 3S9OA 2P67A 5APWA 2ERHA 1EZVI 5AW1B 2VLQA 2KOPA 1NU1K 1BE3E 1BE3G 1GXHA 4XFXA 1S5LH 1NHLA 3M9QA 3BCCJ 2QRXA 3M0DA 4I2LC 3HD7D 1LWUB 4N78D 2XZRA 3G9RA 1L0LG 3UIAA 2JR8A 1IK9A 2FYUG 1YQ4C 2KNCA 2H89C 2E75D 3HRNA 2PGDA 2AFEA 1LTAC 2JP3A 2JDIH 3H1HJ 2POHA 2W6BA 2O1JA 1D7MA 1QL1A 3DS2A 2J5UA 2L5GB 2KOSA 1SQBK 5KJ7C 1S4XA 2I1JA 3Q1MA 2JJLA 1PP9J 2N98A 1VQKP 2Q7CA 5KJ7D 5APQA 2M3BA 2XZ0D 3U1AA 2BASA 1CEIA 3MGNA 1GL2C 3P8MC 5HVCA 1CI6B 4BWNA 1SLQA 2XNXA 2K92A 5KLIC 5AVXB 1YQ3C 2A45I 2BHVA 2IFMA 3HUSA 1L0NJ 1NU1G 4PJ0E 2QJPC 5BS2A 3T97B 1DNYA 2KWLA 1JOCA 2ZXXA 3H1KD 4XFJA 2KLUA 3H1KJ 5F2NA 1T8ZA 3TK1A 2FYZA 1OIPA 1H89A 1FZAA 2FVEA 2E42A 2Z4EA 5DJTB 1NTZD 2M8LA 2LTEA 5C39A 1BCCE 1LT1A 2A06G 1AJYA 2B87B 5GTIE 2IZ1A 4Y28J 2MVUA 1SQVD 1CW5A 3FWLA 1D1DA 2ZYAA 3SWYA 1P84E 1SQXJ 4BXLA 1KQSO 4YPCA 2YKOA 1LTBC 4ZKPA 2R44A 3F89A 2CWOA 4PD4I 1FZCA 4OGQC 2KGDA 1J2JB 3KYQA 1GZLA 2HODB 1HBWA 3RK2C 1R5SA 5BVZA 1DIPA 2LR2A 1FZCB 4B86A 1MZ9A 1NTKG 5AVVB 1N7SA 3V2RA 1RO0A 2LL8A 1SQQJ 5M1BA 3P32A 3CMEP 4JYBA 2DGYA 2LKMA 2NZ2A 5BS1A 5KLVK 4ZNCA 1M1JB 2O01H 2KZJA 1NAFA 2MF4A 1ZRTD 1GK4A 1KTMA 1KV4A 2K88A 4WY4C 3JC22 4RO0A 5AW8B 3LIDA 1S9KD 1SQQG 2N9BA 1S3JA 2FY8A 3BRTB 2PAJA 1URQA 1VQNP 2R5DA 2A45G 3CX5H 5KAIE 4GT1A 1GL2B 5TISE 3P05A 2NPSD 4M0IA 1X0TA 3L70E 2A45H 2PENA 2Q1KA 2E76D 3V2NA 1NWQA 3HE4A 2WPSA 4H2XC 1MUUA 3AEEC 1N73A 2E76C 4Z1MH 1SQQD 2HG5D 1NTME 1IC2A 2W27A 1AVOA 5AVZB 1FOSE 2OYIC 1A43A 1ZRTE 2QJKC 3DPHA 3A0HH 2N6ZA 1YBKA 2K2QA 5CZDB 2WSEH 3L75D 1ZMEC 2WT7B 1UJZA 2MJZA 4EDFA 3V4QA 3B5NC 2Y0EA 3SWKA 2KS1B 1OX3A 1SQXD 4H2WC 3CXCO 3AEAC 2JBGA 1JO5A 3GF3A 1NGMB 1NU1E 4EOTA 1HJBA 3B5NB 4PD4E 3W68A 4OH8B 4OGQB 3TGUG 5EW5E 1BGYD 3D6YA 1KILA 4UB8E 3K5BA 3D6ZA 2K94A 1EIAA 3L73E 3L71D 3LW5J 4A7PA 3WUTA 4KHXA 2JKVA 2Z45A 2GA1A 1ZP0C 3DTJA 3V5BA 2FXOA 5B5EH 2IBZD 4C7RA 1IMQA 2FQ1A 3L70J 1T2KD 1FZEA 2M8RA 3E7KA 5AVSB 1T2KC 3HE5A 4PH0A 2K93A 3L37A 2KG8A 3B5IA 1U7JA 2E74B 2CNRA 1RF1C 3HE5B 3Q5PA 4JF7A 3L73G 3B5ND 2QE7H 2WPVB 3RK2B 3VRLC 1PGJA 4U3FE 3MGEA 1GTWA 1X8YA 1FZCC 3EJEA 3L72D 2K0XA 5CCHC 2GZIA 4PD4H 3H1HD 1FE6A 3CWBD 2QA4P 4WYMA 3A0HE 1NOHA 2E74C 1JUNA 1VL2A 2FXMA 2GDXA 4IFDK 1VQ5P 1CI6A 2VLNA 5CJ0A 2OYHB 4BPHA 3PP5A 3G6EP 1JEKA 3GLMA 4NPEA 3WBHA 3IFMA 2E76B 2KOQA 1KB9D 1PEOA 1RE4A 3HZQA 3GZMA 2QJKB 1M90Q 1N7LA 2BEZF 3CXHE 3CXHH 4L76A 1SQVK 1NTZK 1JTHA 1JCCA 1NU1J 5CCGD 2WSSH 3TSIA 1S1CX 1ZV8A 1LTJA 2HODA 2O01N 1W2EA 4LLHA 2FVFA 4GOFA 2KGCA 2W6JH 2E75C 2W90A 3RK3C 3H1JE 1P84I 3L75E 4HKGA 1Q86Q 2GDWA 1HJ0A 3RBXA 1CZQA 2Z5HA 2GUSA 5GTHH 2WPQA 3VMYA 3PLNA 2IYPA 3L4FA 3E2DA 4C46A 4UB6H 3VYIA 1PPJG 4GODA 2FVAA 5KKZC 2E5TA 4EYYQ 1E6JP 1DH3A 3BVHA 2HLOA 3V2QA 2C0WA 1KYOI 2WITA 3TDKA 2K0DX 3CWBG 5B5EE 4C7NB 1S5LE 5AW2B 3A3YB 2FACA 1USDA 1DD4A 1H0TA 4U0FA 2AEMA 1RQVA 2R32A 4RESB 4I7ZB 2FYUJ 2IX7C 3VP9A 3WMM0 1E0HA 1JY3O 4MRTC 2N50A 2KODA 1N73C 4HB1A 2CGQA 1L0NK 3G71P 1M6NA 2FBWC 3KHUA 4IPYA 1M56D 4I6MC 2P10A 1T8KA 1PPJD 3TGUJ 2Y0DA 3BCCG 3M1MA 1LP1B 1AFOA 4N6JA 1J1EB 5E79H 3AE5C 3H1KG 1GL2D 1AQTA 4U3FJ 3WU2E 1Y47A 3P8CE 4AYCA 5GTIH 3KZIE 4OVNF 3H1IE 2M5AB 3CXHI 3H1HG 2L9FA 3HTKA 4AQRD 3CXHD 1EDKA 4U0AA 1LGHB 3V6IA 2R3SA 2J59M 3CC7P 3EJDA 1A8OA 5APUA 1LNQA 1KQLA 2K3RA 2LIUA 1J1DC 2VLPA 3T97A 1PIXA 4XE5B 1L4AC 2YMYA 1VQLP 3HD7A 2CG5B 1GXGA 1GW3A 1NKNA 4IFMA 2K1AA 1NU1D 1L0NG 3GKLC 1RHZB 1MFTA 5KP6B 1H88A 2IDBA 1JMMA 1JY3N 1NH4A 2JYGA 3NTEA 2N1TA 3L71J 3H1JJ 3DS0A 1BGYG 4OGQD 2XZ1C 3I55P 2YXRB 4M3LA 2C9LY 3MUDA 4Y99C 1HY8A 1FS0E 3KPEA 3FXDA 2UWJE 3CX5D 3V2PA 3NY7B 2D2CB 3CX5E 4N3YB 3MD0A 3HYBA 1Z56A 2XKMA 4WVZA 2L4BA 2LMLA 3HD7B 5KLVG 1OZHA 3HUSC 3P7KA 4I7ZC 1PL5A 1PFIA 2D2CC 3RGUA 1EDIA 1OVUA 5AW6B 3U1CA 1YIJP 1NTZJ 2GM4A 3BCCE 3L75G 2NPSA 5AW4B 2GUVA 3IF4A 2RMZA 1VF5D 4IL6X 1OVRA 2KORA 5CJ4A 1VQ6P 2ZVNB 2JAZA 3LMOA 1IFJA 2XDJA 1FOSF 2ZT9D 4L74A 1OMIA 1QRJA 1HH0A 1L0ND 3D70A 4D6TG 3A0BH 1URQD 5CBNA 3TF5A 4GKGA 1R5LA 1VQ9P 2KNCB 2YNYA 2K5XA 2O1KA 1VQPP 3PJSK 5I4TG 1YTZT 1FJPA 1S9KE 1M1JC 2FQ2A 1YITP 4N78E 4NEOA 2LF4A 2QNWA 2VLOA 3AE6C 2N9YB 4KJMA 1BAJA 4U7JA 3S1KA 4W7YA 4BPFA 3H1HE 3M9HA 1MKMA 3L70D 2H8PD 3USSA 1N7SB 1Y8AA 2Y0CA 1BCCJ 3TNUB 1WMKA 3B71A 1SQXG 5AW5B 4HJGH 2MVVA 1ZLLA 4U0BA 3RK3B 1X22A 1NTKD 3A2AA 3G29A 2QG4A 1IFMA 1SVFA 1OWAA 2I8DA 2WZ7A 2XNDH 2G8YA 3KXDA 3IAOA 2HR3A 5KAFE 1J1DB 3P8CD 3U43A 5KLIB 1L4AB 1FJKA 2L6EA 2WPTA 2KGAA 1SQPG 3FX0A 2QJPB 2FAEA 2M5RA 1E5WA 3M91A 2C9NY 1KILB 2KZIA 1SQVG 2H7HA 1BXIA 4IOIH 3GHGB 1QEXA 3AE9C 1LJ2A 3O8ZA 4TT3H 3NMDA 4MN4C 2GYKA 5AW3B 2YIUC 2PEMA 2AXTH 1RE3A 5DJUB 4Y99B 3RG2A 1MFZA 2WTYA 3L71E 1JM0A 2FQ0A 3NXSA 2FYUE 4GDOA 5AVUB 1PEUA 3GHGC 1N8RQ 5KAFH 3B8EB 5HGLA 2OYHA 2BCCE 1BDCA 3AE7C 3H25A 2GZGA 3OJAB 2N1TC 1M6EX 5B66E 2ZVOB 3VMAA 1AQ5A 2OQQA 4DZOA 1J1EC 2OGUA 2ONTA 1AF8A 2KSEA 1PV3A 2KYVA 2A06D 2W83C 1ACPA 2KP8A 1PZQA 2JWDA 1PEQA 2OTLP 2WSFJ 4WB4A 2QM7A 1GU4A 1NTZG 4H13D 1SS1A 2M3EA 2CPBA 4H13C 3O6QB 3BATA 3SFEC 1YJWP 1S2EA 3G4SP 4PH1A 3H1LJ 2B87A 1ZNVA 2V7QH 4WY4B 4IFFA 5B66H 1OW7A 4OWFA 2KG9A 1N86A 2L0QA 2KIKA 2M0BA 5KP7B 1HQBA 3CCMP 1K04A 1BE3J 3A5TA 1BCCG 1KORA 2YO3A 2L22A 1SFCC 3C1LA 5EFWB 1SQQE 1OVVA 4U0CA 1L0LJ 1G1IA 2XV5A 3H4EA 2G3AA 2Z5IA 2ZYDA 1KB9H 3AEGC 2IBZG 3G0VA 2IBZE 3GJNA 2O01J 2OYIB 1M1KQ 2BCCD 1QGKB 3G3ZA 3L72E 2FFDA 3L74D 4QNBA 2QSIA 2HPCB 2Q3IA 2M5AA 2IYOA 1L0LK 1LP1A 3H1LD 4IL6H 3TGUD 3AE2C 1KB9I 2YKPA 2FYUK 1YJNP 1KQGB 1SFCA 3CCRP 2BCCJ 2J58A 3BASA 1SQBG 1FBMA 1KILD 4LC1A 2FYUD 2LXBA 1GDTA 2IFNA 2PEIA 3ABVC 2JGPA 2YXQB 1P84H 2MY5A 1P84D 1SQVJ 1PGOA 2YIUB 2JQ4A 4PV1B 1NTMK 3CI9A 4YTPC 3EFFK 2ZT9B 1AYIA 4O9BA 1HF9A 4K3AA 1UNKA 3AEDC 4CPGA 1K30A 1XTGB 2YO2A 1VQ4P 1S5LX 2QEXP 1BGYJ 1HTLC 1KYOH 4IZ6A 2AF8A 3FXEA 3ITKA 3H32A 2JWAA 3V4WA 1FZFA 1IFIA 5KP8B 2FYNB 5CCHA 3G1IA 4HYTB 1Z6MA 4R0MA 1FDMA 1FZBA 3CCEP 5CMZA 4HKZH 3EWKA 3OAKA 2JEEA 4UHPB 2OYHC 1NO4A 1Q2NA 5AVWB 1BE3D 2PY8A 2O3JA 1HGZA 1F80D 2WQYC 1HGVA 2LIWA 3PHLA 2R5BA 4L75A 3H32B 1PP9G 1NTKK 1AA0A 1KYOD 3JCUE 1X79B 5GTHE 1EQ7A 4GOEA 4YXDC 1JY2P 2PFXA 1HVVA 3VN0A 2EFJA 2BQ1E 2WMMA 1MV8A 3L36A 1SQQK 3H1LE 5CBOA 5KJ7A 4TLFA 2KUBA 4UB8H 2V7QJ 1DV5A 3VOPA 2K9JA 2MD9A 1K05A 1SQPE 1SQVE
chains in the Genus database with same CATH topology
3CC7P 1QRJA 3RG6C 4GR2A 1A8OA 5F2NA 1VQNP 1VQ4P 2XXMA 3DS3A 4U0CA 2QEXP 5DCKA 3P05A 3G28A 4M0IA 1VQ9P 1VQ8P 3E2DA 2PEMA 1JJ2O 2PENA 1KD1Q 4PH0A 4XFYA 4COCA 4U0EA 1VQLP 3B5IA 3H4EA 3CCVP 2M8LA 1YJ9P 1VQPP 3I56P 1E6JP 5I4TG 2E1MA 3OW2O 1PEUA 2XT1A 3G0VA 5JPAA 2PEKA 1Q81Q 3G1IA 4XFXA 2Z46A 5F2OA 3VRLC 1N8RQ 3MGEA 1YITP 1D1DA 2JO0A 5HGLA 5HGNA 4U0DA 2LF4A 1M1KQ 1PEMA 1A43A 3CCEP 2JYGA 2M8PA 1K8AQ 3CCLP 1BAJA 1KQSO 3CCUP 4QNBA 3DPHA 3G1GA 3NTEA 4WYMA 3CMAP 2QA4P 2EIAA 4U0FA 3CCQP 1QVGO 1VQ7P 4XRQA 2BUOA 1M6EX 3DS0A 2OTJP 3I55P 4XROA 1VQ5P 2ONTA 5F2KA 3DS5A 2CWOA 1YJNP 1YI2P 2PEJA 2PEOA 3G6EP 1K9MQ 2KODA 4GR6A 2P9XA 2PY8A 3WBHA 3H0DA 3CC4P 1PEQA 3G71P 1M6NA 2PEQA 3CCSP 3CCRP 1S72P 4IPYA 3HYBA 2OTLP 3CD6P 1PEOA 3G26A 2XV6A 3HZQA 3CXCO 3M1MA 1M90Q 1RO0A 2JYLA 3DS2A 4U0BA 1VQMP 1NJIQ 1EOQA 5HGMA 3G29A 5HGOA 3CMEP 1RO2A 1QVFO 2DGYA 1IUQA 3CCJP 1VQKP 2PEIA 1YJWP 5BS1A 3G4SP 2EG5A 1YIJP 1Q7YQ 1YHQP 2OARA 3DS4A 1RNIA 3Q20A 4PH1A 2EFJA 2BQ1E 1AUMA 3DS1A 1W2BO 2Z44A 1K73Q 1ZMBA 4XFZA 4COPA 1M74A 1VQOP 2BHVA 1EIAA 2L6EA 1VQ6P 3CPWO 3LRYA 3H47A 1KC8Q 3G21A 4U0AA 2M8NA 1Q86Q 2Z45A 5BS2A 3CCMP 3CC2P 3DTJA 1K30A 1Q82Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CC7 P;  3G6E P;  1K9M Q;  1YIJ P;  1YIT P;  1Q7Y Q;  1YHQ P;  3G71 P;  3CC4 P;  1VQN P;  1VQ4 P;  3CCS P;  1M1K Q;  3CCR P;  1S72 P;  2OTL P;  2QEX P;  3CCE P;  1W2B O;  3CD6 P;  1K8A Q;  3CCL P;  1K73 Q;  3CXC O;  1KQS O;  3CCU P;  1VQ9 P;  1VQ8 P;  1VQ7 P;  2QA4 P;  1QVG O;  3CMA P;  1VQO P;  3CCQ P;  1M90 Q;  1KD1 Q;  1JJ2 O;  1VQM P;  1NJI Q;  1VQL P;  1VQ6 P;  1N8R Q;  3CPW O;  3CME P;  2OTJ P;  3I55 P;  3CCV P;  1KC8 Q;  1YJ9 P;  1VQP P;  1QVF O;  3I56 P;  1Q86 Q;  3CCJ P;  1VQ5 P;  3CCM P;  1VQK P;  3CC2 P;  3OW2 O;  1Q81 Q;  1YJW P;  3G4S P;  1YJN P;  1YI2 P;  1Q82 Q; 
#chains in the Genus database with same CATH topology
 1KN7 A;  1ZW0 A;  1G2C A;  5KTB A;  1JY3 P;  3GW6 A;  2GZF A;  2XXM A;  4GIF A;  4I1L A;  4XFY A;  4COC A;  4U0E A;  5KKZ B;  5BU8 B;  2KI7 B;  1KYO E;  1EMV A;  1M57 D;  2HYN A;  1Q81 Q;  2OYI A;  2K9Y A;  2JO0 A;  1WRG A;  2N6Y A;  4KT0 J;  3HE4 B;  3O6Q A;  1MZ8 A;  3CCU P;  3H1I J;  2BUO A;  5CCG A;  2IPP A;  1FZG A;  2OTJ P;  2JU2 A;  2WSC J;  5TIS H;  3E1R A;  4H13 B;  1SQX K;  2OYO A;  2PEJ A;  4EIJ A;  1E79 H;  4HH2 A;  1K9M Q;  2P9X A;  2B9B A;  1YTZ I;  2JU1 A;  1JNM A;  1PP9 D;  1EDL A;  3D71 A;  5CHX A;  4PV1 C;  3NFQ A;  3LIE A;  1GMJ A;  2JYL A;  2NRG A;  2ZT9 C;  3AEB C;  1EOQ A;  5HGO A;  3H1I D;  3GF7 A;  1RO2 A;  1JB0 J;  3N7N A;  3PTZ A;  4H2Y C;  3CCJ P;  1OW6 A;  3AEC C;  1OXZ A;  1VDF A;  1KLP A;  2NPS C;  2FXP A;  1EC5 A;  1Q7Y Q;  2OAR A;  3Q20 A;  3NTN A;  4H0L C;  2Q9I A;  1JY2 O;  1K73 Q;  2KLV A;  4IL6 E;  2AXC A;  3RL0 C;  1N7S D;  4WWI A;  2Y9Z A;  1RF0 C;  5H2F H;  4EI2 A;  1IFD A;  1H0T B;  5BU5 A;  1VF5 B;  2JO1 A;  4DT0 A;  4H0L B;  2P1J A;  1HWT C;  1A02 F;  2N5H A;  1FDO A;  1KB9 E;  1SP4 A;  1PGP A;  2WPR A;  2Q5U A;  2MR8 A;  2YMK A;  3Q2Y A;  5H2F E;  3L35 A;  4L73 A;  1LWU A;  2MKV A;  5JPA A;  3VMX A;  1IJD B;  3CE7 A;  4DJG A;  3IR9 A;  4RJT A;  3MP7 B;  1DEE G;  4U0D A;  1LTJ B;  3M06 A;  2M8P A;  3SSU A;  1LT9 A;  3CL3 D;  1PGQ A;  5AW7 B;  1KMI Z;  1M7L A;  2AFD A;  1QLE D;  1QX8 A;  5F2K A;  3DS5 A;  4H0L D;  2GZJ A;  3BRV B;  3GHG A;  1N73 B;  1GK6 A;  1IFN A;  3HD7 C;  2PNG A;  1NJI Q;  2IBZ I;  1LTS C;  4W7Z A;  2P2U A;  3CX5 I;  1IUQ A;  3CLQ A;  3AE1 C;  1EDJ A;  4PWV B;  2QJY C;  2OTK E;  1XTC C;  2FHS C;  1YHQ P;  5AVR B;  3H1L G;  2C0X A;  3DS1 A;  1W2B O;  1ZMB A;  1EZV D;  1DEB A;  1SQB E;  4RKU J;  2M8N A;  5APY A;  2K37 A;  4U3F D;  4ZKU A;  4QKO A;  1Q82 Q;  2QVA A;  5CCH D;  2L91 A;  2FYN C;  2QM8 A;  3Q5R A;  1NTM D;  2KG6 A;  3B5N A;  1X3O A;  1AVY A;  1NQ4 A;  4ASW A;  1HUC A;  1JJ2 O;  5E79 E;  2FKW B;  4ZMD A;  3R4Y A;  3HTK B;  2IZ0 A;  5APX A;  1YJ9 P;  2AXT E;  1NTM G;  2E1M A;  1BCC D;  1U7M A;  3WUV A;  5F2O A;  2DW3 A;  3EQ2 A;  2ZJS E;  3EFG A;  1G2C B;  4CA3 A;  1JCD A;  2BCC G;  3R2P A;  1K8A Q;  3SFD C;  5TJH A;  2R3C A;  5CCG C;  3G1G A;  1L0L D;  4R4M A;  3CCQ P;  1LTI C;  4UB6 E;  3VP8 A;  1RH5 B;  4D6T E;  2FFD C;  2RKL A;  1N2D C;  3M9B A;  1IZN B;  4JYC A;  4BRY A;  3Q3D A;  1ZR2 A;  1VHN A;  2PEQ A;  5AW0 B;  3W67 A;  4XA4 A;  1FR2 A;  2H88 C;  1NYH A;  1DX7 A;  3C8V A;  1VPC A;  2ZYG A;  1LTT C;  1YYC A;  1QVF O;  1ZXG A;  4F37 A;  3C9I A;  1BSH A;  4U3F G;  2XU6 A;  2AEF A;  2AVA A;  2NO8 A;  1GW4 A;  1RNI A;  4W80 A;  1KIL E;  1USE A;  1G1J A;  2V4H A;  1SQB J;  4COP A;  1M74 A;  2ROQ A;  2H43 A;  1NTK E;  2Q3E A;  3CPW O;  2HPC A;  2N5I A;  3M0A A;  3U59 A;  3PRJ A;  2QJY B;  3KQG A;  1LTJ C;  2KR5 A;  1EXJ A;  1U57 A;  3DS3 A;  1SQX E;  3H1J G;  1Q90 D;  3II6 A;  4D6T J;  3JSV C;  1VQ8 P;  2EHT A;  1LT9 C;  3L70 G;  1L4A D;  1BSN A;  1RF1 B;  3OW2 O;  2PEK A;  2FAD A;  2GDY A;  2JB0 A;  5K5G B;  1M8O B;  3L72 G;  3OA7 A;  3SWF A;  3F5H A;  2B89 A;  1L0L E;  1VQ7 P;  2Y9Y A;  3CMA P;  2CPS A;  1JTH B;  4XRQ A;  1L4A A;  1IK7 A;  1AV1 A;  2WWW A;  2Q6Q A;  2PEO A;  1NKZ B;  1LWU C;  3IN6 A;  3L72 J;  2BEQ D;  3AE3 C;  2XV6 A;  3RK2 D;  1GPJ A;  1T6A A;  1VQM P;  1KQF B;  5APS A;  2LPK A;  2D2C D;  2LOL A;  3I5C A;  2DNW A;  2FFD B;  2KW2 A;  1TU3 F;  2E5Y A;  1OW8 A;  3L74 G;  2EG5 A;  1VF5 C;  3DS4 A;  3L75 J;  4WY4 D;  1IO4 A;  2K0Y A;  3EJB A;  1ZOY C;  1NTK J;  1EZV E;  1VQO P;  2E75 B;  3AEF C;  1KC8 Q;  2QIW A;  5KLV D;  2P7J A;  2KOG A;  3CC2 P;  1GL2 A;  2RH0 A;  5KLV E;  3RK3 E;  4QMA A;  2B88 A;  3TNU A;  2W6A A;  1FAV A;  3RL0 g;  2ZAE B;  2LKI A;  2ZXE B;  3H1I G;  3L74 J;  4H44 B;  1KFM A;  3ZDM A;  3MHV A;  1KD1 Q;  2WSC H;  2HFE D;  3B4Q A;  3CCV P;  3TGU E;  3I56 P;  4D6T D;  1L0I A;  4R4L A;  2X2B A;  3H1K E;  2XT1 A;  2LXC B;  2E43 A;  3FWN A;  4C7N A;  2GZE A;  1T3U A;  1X9V A;  1ZN5 A;  1PEM A;  4DG9 A;  1OR5 A;  2WT7 A;  3A7O A;  1VKU A;  2EIA A;  1RY3 A;  3KZI H;  2N1T B;  5APT A;  3B4S A;  3KDP B;  4XRO A;  1ZR4 A;  1WT6 A;  4PD4 D;  3M0D C;  1URQ B;  5L8R J;  3H0D A;  4PV1 D;  1M1J A;  4BPG A;  3WU2 H;  3CCS P;  1S72 P;  1Y9B A;  2KGE A;  1JMB A;  3CD6 P;  3G26 A;  4K35 A;  2KSJ A;  1BGY E;  4YXW H;  1KFN A;  4NPF X;  3HUS B;  5HGM A;  1NTM J;  2KXP B;  1JY2 N;  2KOO A;  2WVR A;  2ITA A;  4WY4 A;  2SPZ A;  2CK3 H;  3CWB J;  3N4X A;  1URQ C;  4DCK A;  5AW9 B;  3AE4 C;  3A0B E;  1W5C E;  1IMP A;  1L0N E;  4JQ0 D;  1AUM A;  3RL0 D;  3LW5 H;  7CEI A;  1RQU A;  4AUW A;  3QWO C;  3GG2 A;  3L73 D;  3LRY A;  1LT9 B;  2W8Z A;  1R8E A;  4ASV A;  3H47 A;  3L73 J;  3G21 A;  3GMA A;  5AVT B;  3PH0 A;  1N7S C;  1SQP K;  3TYY A;  4NPD A;  2KS1 A;  4GR2 A;  1GU5 A;  1H8A A;  1DD3 A;  5HV8 A;  1UIX A;  2CQ8 A;  1FDI A;  3MTU E;  2K9J B;  5DCK A;  2WSF H;  1UII A;  2RN0 A;  4H44 D;  2PRR A;  3Q5S A;  5KLV J;  1RE4 C;  4DOJ A;  3E1I A;  4WBA A;  3L71 G;  1SQP D;  1BDD A;  2NPS B;  2WSE J;  2Z46 A;  3FGA D;  3MZW B;  5APV A;  3S4R A;  5HGN A;  3H6P A;  1A02 J;  3MUD C;  2E74 D;  1L2P A;  3VTP C;  3CCL P;  1EXI A;  3RL0 B;  1SFC D;  3CWB E;  4LGD E;  1QVG O;  1EZV G;  2VSQ A;  5AVQ B;  1NAY A;  1FC2 C;  3VMZ A;  1YI2 P;  1SFC B;  4GR6 A;  3CC4 P;  3L74 E;  1NVO A;  1PPJ E;  1RF1 A;  1CSB A;  2KB7 P;  3MIW A;  1RE3 C;  4PJ0 H;  1SQB D;  3H1J D;  2AEJ A;  1NTZ E;  5EJD A;  2KK7 A;  2ZFC A;  2YKQ A;  4JPZ B;  3RBZ A;  3WUU A;  3RK3 D;  4H44 C;  1QL2 A;  1L0H A;  2Z44 A;  1SQP J;  1GD2 E;  3QH9 A;  1OFC X;  4JBZ A;  1RF0 A;  4XFZ A;  1FU1 A;  2EHS A;  1T3J A;  1KIL C;  1IFP A;  2I1K A;  5KAI H;  3GZL A;  3RG6 C;  3BCC D;  4PXH B;  2MR7 A;  1KZU B;  2A06 E;  2P58 A;  4BRY B;  3JCU H;  1PP9 E;  2N1T D;  1LTG C;  3AE8 C;  5AVY B;  3G28 A;  2PP6 A;  2VRS A;  3S9O A;  2P67 A;  5APW A;  2ERH A;  1EZV I;  5AW1 B;  2VLQ A;  2KOP A;  1NU1 K;  1BE3 E;  1BE3 G;  1GXH A;  4XFX A;  1S5L H;  1NHL A;  3M9Q A;  3BCC J;  2QRX A;  3M0D A;  4I2L C;  3HD7 D;  1LWU B;  4N78 D;  2XZR A;  3G9R A;  1L0L G;  3UIA A;  2JR8 A;  1IK9 A;  2FYU G;  1YQ4 C;  2KNC A;  2H89 C;  2E75 D;  3HRN A;  2PGD A;  2AFE A;  1LTA C;  2JP3 A;  2JDI H;  3H1H J;  2POH A;  2W6B A;  2O1J A;  1D7M A;  1QL1 A;  3DS2 A;  2J5U A;  2L5G B;  2KOS A;  1SQB K;  5KJ7 C;  1S4X A;  2I1J A;  3Q1M A;  2JJL A;  1PP9 J;  2N98 A;  1VQK P;  2Q7C A;  5KJ7 D;  5APQ A;  2M3B A;  2XZ0 D;  3U1A A;  2BAS A;  1CEI A;  3MGN A;  1GL2 C;  3P8M C;  5HVC A;  1CI6 B;  4BWN A;  1SLQ A;  2XNX A;  2K92 A;  5KLI C;  5AVX B;  1YQ3 C;  2A45 I;  2BHV A;  2IFM A;  3HUS A;  1L0N J;  1NU1 G;  4PJ0 E;  2QJP C;  5BS2 A;  3T97 B;  1DNY A;  2KWL A;  1JOC A;  2ZXX A;  3H1K D;  4XFJ A;  2KLU A;  3H1K J;  5F2N A;  1T8Z A;  3TK1 A;  2FYZ A;  1OIP A;  1H89 A;  1FZA A;  2FVE A;  2E42 A;  2Z4E A;  5DJT B;  1NTZ D;  2M8L A;  2LTE A;  5C39 A;  1BCC E;  1LT1 A;  2A06 G;  1AJY A;  2B87 B;  5GTI E;  2IZ1 A;  4Y28 J;  2MVU A;  1SQV D;  1CW5 A;  3FWL A;  1D1D A;  2ZYA A;  3SWY A;  1P84 E;  1SQX J;  4BXL A;  1KQS O;  4YPC A;  2YKO A;  1LTB C;  4ZKP A;  2R44 A;  3F89 A;  2CWO A;  4PD4 I;  1FZC A;  4OGQ C;  2KGD A;  1J2J B;  3KYQ A;  1GZL A;  2HOD B;  1HBW A;  3RK2 C;  1R5S A;  5BVZ A;  1DIP A;  2LR2 A;  1FZC B;  4B86 A;  1MZ9 A;  1NTK G;  5AVV B;  1N7S A;  3V2R A;  1RO0 A;  2LL8 A;  1SQQ J;  5M1B A;  3P32 A;  3CME P;  4JYB A;  2DGY A;  2LKM A;  2NZ2 A;  5BS1 A;  5KLV K;  4ZNC A;  1M1J B;  2O01 H;  2KZJ A;  1NAF A;  2MF4 A;  1ZRT D;  1GK4 A;  1KTM A;  1KV4 A;  2K88 A;  4WY4 C;  3JC2 2;  4RO0 A;  5AW8 B;  3LID A;  1S9K D;  1SQQ G;  2N9B A;  1S3J A;  2FY8 A;  3BRT B;  2PAJ A;  1URQ A;  1VQN P;  2R5D A;  2A45 G;  3CX5 H;  5KAI E;  4GT1 A;  1GL2 B;  5TIS E;  3P05 A;  2NPS D;  4M0I A;  1X0T A;  3L70 E;  2A45 H;  2PEN A;  2Q1K A;  2E76 D;  3V2N A;  1NWQ A;  3HE4 A;  2WPS A;  4H2X C;  1MUU A;  3AEE C;  1N73 A;  2E76 C;  4Z1M H;  1SQQ D;  2HG5 D;  1NTM E;  1IC2 A;  2W27 A;  1AVO A;  5AVZ B;  1FOS E;  2OYI C;  1A43 A;  1ZRT E;  2QJK C;  3DPH A;  3A0H H;  2N6Z A;  1YBK A;  2K2Q A;  5CZD B;  2WSE H;  3L75 D;  1ZME C;  2WT7 B;  1UJZ A;  2MJZ A;  4EDF A;  3V4Q A;  3B5N C;  2Y0E A;  3SWK A;  2KS1 B;  1OX3 A;  1SQX D;  4H2W C;  3CXC O;  3AEA C;  2JBG A;  1JO5 A;  3GF3 A;  1NGM B;  1NU1 E;  4EOT A;  1HJB A;  3B5N B;  4PD4 E;  3W68 A;  4OH8 B;  4OGQ B;  3TGU G;  5EW5 E;  1BGY D;  3D6Y A;  1KIL A;  4UB8 E;  3K5B A;  3D6Z A;  2K94 A;  1EIA A;  3L73 E;  3L71 D;  3LW5 J;  4A7P A;  3WUT A;  4KHX A;  2JKV A;  2Z45 A;  2GA1 A;  1ZP0 C;  3DTJ A;  3V5B A;  2FXO A;  5B5E H;  2IBZ D;  4C7R A;  1IMQ A;  2FQ1 A;  3L70 J;  1T2K D;  1FZE A;  2M8R A;  3E7K A;  5AVS B;  1T2K C;  3HE5 A;  4PH0 A;  2K93 A;  3L37 A;  2KG8 A;  3B5I A;  1U7J A;  2E74 B;  2CNR A;  1RF1 C;  3HE5 B;  3Q5P A;  4JF7 A;  3L73 G;  3B5N D;  2QE7 H;  2WPV B;  3RK2 B;  3VRL C;  1PGJ A;  4U3F E;  3MGE A;  1GTW A;  1X8Y A;  1FZC C;  3EJE A;  3L72 D;  2K0X A;  5CCH C;  2GZI A;  4PD4 H;  3H1H D;  1FE6 A;  3CWB D;  2QA4 P;  4WYM A;  3A0H E;  1NOH A;  2E74 C;  1JUN A;  1VL2 A;  2FXM A;  2GDX A;  4IFD K;  1VQ5 P;  1CI6 A;  2VLN A;  5CJ0 A;  2OYH B;  4BPH A;  3PP5 A;  3G6E P;  1JEK A;  3GLM A;  4NPE A;  3WBH A;  3IFM A;  2E76 B;  2KOQ A;  1KB9 D;  1PEO A;  1RE4 A;  3HZQ A;  3GZM A;  2QJK B;  1M90 Q;  1N7L A;  2BEZ F;  3CXH E;  3CXH H;  4L76 A;  1SQV K;  1NTZ K;  1JTH A;  1JCC A;  1NU1 J;  5CCG D;  2WSS H;  3TSI A;  1S1C X;  1ZV8 A;  1LTJ A;  2HOD A;  2O01 N;  1W2E A;  4LLH A;  2FVF A;  4GOF A;  2KGC A;  2W6J H;  2E75 C;  2W90 A;  3RK3 C;  3H1J E;  1P84 I;  3L75 E;  4HKG A;  1Q86 Q;  2GDW A;  1HJ0 A;  3RBX A;  1CZQ A;  2Z5H A;  2GUS A;  5GTH H;  2WPQ A;  3VMY A;  3PLN A;  2IYP A;  3L4F A;  3E2D A;  4C46 A;  4UB6 H;  3VYI A;  1PPJ G;  4GOD A;  2FVA A;  5KKZ C;  2E5T A;  4EYY Q;  1E6J P;  1DH3 A;  3BVH A;  2HLO A;  3V2Q A;  2C0W A;  1KYO I;  2WIT A;  3TDK A;  2K0D X;  3CWB G;  5B5E E;  4C7N B;  1S5L E;  5AW2 B;  3A3Y B;  2FAC A;  1USD A;  1DD4 A;  1H0T A;  4U0F A;  2AEM A;  1RQV A;  2R32 A;  4RES B;  4I7Z B;  2FYU J;  2IX7 C;  3VP9 A;  3WMM 0;  1E0H A;  1JY3 O;  4MRT C;  2N50 A;  2KOD A;  1N73 C;  4HB1 A;  2CGQ A;  1L0N K;  3G71 P;  1M6N A;  2FBW C;  3KHU A;  4IPY A;  1M56 D;  4I6M C;  2P10 A;  1T8K A;  1PPJ D;  3TGU J;  2Y0D A;  3BCC G;  3M1M A;  1LP1 B;  1AFO A;  4N6J A;  1J1E B;  5E79 H;  3AE5 C;  3H1K G;  1GL2 D;  1AQT A;  4U3F J;  3WU2 E;  1Y47 A;  3P8C E;  4AYC A;  5GTI H;  3KZI E;  4OVN F;  3H1I E;  2M5A B;  3CXH I;  3H1H G;  2L9F A;  3HTK A;  4AQR D;  3CXH D;  1EDK A;  4U0A A;  1LGH B;  3V6I A;  2R3S A;  2J59 M;  3CC7 P;  3EJD A;  1A8O A;  5APU A;  1LNQ A;  1KQL A;  2K3R A;  2LIU A;  1J1D C;  2VLP A;  3T97 A;  1PIX A;  4XE5 B;  1L4A C;  2YMY A;  1VQL P;  3HD7 A;  2CG5 B;  1GXG A;  1GW3 A;  1NKN A;  4IFM A;  2K1A A;  1NU1 D;  1L0N G;  3GKL C;  1RHZ B;  1MFT A;  5KP6 B;  1H88 A;  2IDB A;  1JMM A;  1JY3 N;  1NH4 A;  2JYG A;  3NTE A;  2N1T A;  3L71 J;  3H1J J;  3DS0 A;  1BGY G;  4OGQ D;  2XZ1 C;  3I55 P;  2YXR B;  4M3L A;  2C9L Y;  3MUD A;  4Y99 C;  1HY8 A;  1FS0 E;  3KPE A;  3FXD A;  2UWJ E;  3CX5 D;  3V2P A;  3NY7 B;  2D2C B;  3CX5 E;  4N3Y B;  3MD0 A;  3HYB A;  1Z56 A;  2XKM A;  4WVZ A;  2L4B A;  2LML A;  3HD7 B;  5KLV G;  1OZH A;  3HUS C;  3P7K A;  4I7Z C;  1PL5 A;  1PFI A;  2D2C C;  3RGU A;  1EDI A;  1OVU A;  5AW6 B;  3U1C A;  1YIJ P;  1NTZ J;  2GM4 A;  3BCC E;  3L75 G;  2NPS A;  5AW4 B;  2GUV A;  3IF4 A;  2RMZ A;  1VF5 D;  4IL6 X;  1OVR A;  2KOR A;  5CJ4 A;  1VQ6 P;  2ZVN B;  2JAZ A;  3LMO A;  1IFJ A;  2XDJ A;  1FOS F;  2ZT9 D;  4L74 A;  1OMI A;  1QRJ A;  1HH0 A;  1L0N D;  3D70 A;  4D6T G;  3A0B H;  1URQ D;  5CBN A;  3TF5 A;  4GKG A;  1R5L A;  1VQ9 P;  2KNC B;  2YNY A;  2K5X A;  2O1K A;  1VQP P;  3PJS K;  5I4T G;  1YTZ T;  1FJP A;  1S9K E;  1M1J C;  2FQ2 A;  1YIT P;  4N78 E;  4NEO A;  2LF4 A;  2QNW A;  2VLO A;  3AE6 C;  2N9Y B;  4KJM A;  1BAJ A;  4U7J A;  3S1K A;  4W7Y A;  4BPF A;  3H1H E;  3M9H A;  1MKM A;  3L70 D;  2H8P D;  3USS A;  1N7S B;  1Y8A A;  2Y0C A;  1BCC J;  3TNU B;  1WMK A;  3B71 A;  1SQX G;  5AW5 B;  4HJG H;  2MVV A;  1ZLL A;  4U0B A;  3RK3 B;  1X22 A;  1NTK D;  3A2A A;  3G29 A;  2QG4 A;  1IFM A;  1SVF A;  1OWA A;  2I8D A;  2WZ7 A;  2XND H;  2G8Y A;  3KXD A;  3IAO A;  2HR3 A;  5KAF E;  1J1D B;  3P8C D;  3U43 A;  5KLI B;  1L4A B;  1FJK A;  2L6E A;  2WPT A;  2KGA A;  1SQP G;  3FX0 A;  2QJP B;  2FAE A;  2M5R A;  1E5W A;  3M91 A;  2C9N Y;  1KIL B;  2KZI A;  1SQV G;  2H7H A;  1BXI A;  4IOI H;  3GHG B;  1QEX A;  3AE9 C;  1LJ2 A;  3O8Z A;  4TT3 H;  3NMD A;  4MN4 C;  2GYK A;  5AW3 B;  2YIU C;  2PEM A;  2AXT H;  1RE3 A;  5DJU B;  4Y99 B;  3RG2 A;  1MFZ A;  2WTY A;  3L71 E;  1JM0 A;  2FQ0 A;  3NXS A;  2FYU E;  4GDO A;  5AVU B;  1PEU A;  3GHG C;  1N8R Q;  5KAF H;  3B8E B;  5HGL A;  2OYH A;  2BCC E;  1BDC A;  3AE7 C;  3H25 A;  2GZG A;  3OJA B;  2N1T C;  1M6E X;  5B66 E;  2ZVO B;  3VMA A;  1AQ5 A;  2OQQ A;  4DZO A;  1J1E C;  2OGU A;  2ONT A;  1AF8 A;  2KSE A;  1PV3 A;  2KYV A;  2A06 D;  2W83 C;  1ACP A;  2KP8 A;  1PZQ A;  2JWD A;  1PEQ A;  2OTL P;  2WSF J;  4WB4 A;  2QM7 A;  1GU4 A;  1NTZ G;  4H13 D;  1SS1 A;  2M3E A;  2CPB A;  4H13 C;  3O6Q B;  3BAT A;  3SFE C;  1YJW P;  1S2E A;  3G4S P;  4PH1 A;  3H1L J;  2B87 A;  1ZNV A;  2V7Q H;  4WY4 B;  4IFF A;  5B66 H;  1OW7 A;  4OWF A;  2KG9 A;  1N86 A;  2L0Q A;  2KIK A;  2M0B A;  5KP7 B;  1HQB A;  3CCM P;  1K04 A;  1BE3 J;  3A5T A;  1BCC G;  1KOR A;  2YO3 A;  2L22 A;  1SFC C;  3C1L A;  5EFW B;  1SQQ E;  1OVV A;  4U0C A;  1L0L J;  1G1I A;  2XV5 A;  3H4E A;  2G3A A;  2Z5I A;  2ZYD A;  1KB9 H;  3AEG C;  2IBZ G;  3G0V A;  2IBZ E;  3GJN A;  2O01 J;  2OYI B;  1M1K Q;  2BCC D;  1QGK B;  3G3Z A;  3L72 E;  2FFD A;  3L74 D;  4QNB A;  2QSI A;  2HPC B;  2Q3I A;  2M5A A;  2IYO A;  1L0L K;  1LP1 A;  3H1L D;  4IL6 H;  3TGU D;  3AE2 C;  1KB9 I;  2YKP A;  2FYU K;  1YJN P;  1KQG B;  1SFC A;  3CCR P;  2BCC J;  2J58 A;  3BAS A;  1SQB G;  1FBM A;  1KIL D;  4LC1 A;  2FYU D;  2LXB A;  1GDT A;  2IFN A;  2PEI A;  3ABV C;  2JGP A;  2YXQ B;  1P84 H;  2MY5 A;  1P84 D;  1SQV J;  1PGO A;  2YIU B;  2JQ4 A;  4PV1 B;  1NTM K;  3CI9 A;  4YTP C;  3EFF K;  2ZT9 B;  1AYI A;  4O9B A;  1HF9 A;  4K3A A;  1UNK A;  3AED C;  4CPG A;  1K30 A;  1XTG B;  2YO2 A;  1VQ4 P;  1S5L X;  2QEX P;  1BGY J;  1HTL C;  1KYO H;  4IZ6 A;  2AF8 A;  3FXE A;  3ITK A;  3H32 A;  2JWA A;  3V4W A;  1FZF A;  1IFI A;  5KP8 B;  2FYN B;  5CCH A;  3G1I A;  4HYT B;  1Z6M A;  4R0M A;  1FDM A;  1FZB A;  3CCE P;  5CMZ A;  4HKZ H;  3EWK A;  3OAK A;  2JEE A;  4UHP B;  2OYH C;  1NO4 A;  1Q2N A;  5AVW B;  1BE3 D;  2PY8 A;  2O3J A;  1HGZ A;  1F80 D;  2WQY C;  1HGV A;  2LIW A;  3PHL A;  2R5B A;  4L75 A;  3H32 B;  1PP9 G;  1NTK K;  1AA0 A;  1KYO D;  3JCU E;  1X79 B;  5GTH E;  1EQ7 A;  4GOE A;  4YXD C;  1JY2 P;  2PFX A;  1HVV A;  3VN0 A;  2EFJ A;  2BQ1 E;  2WMM A;  1MV8 A;  3L36 A;  1SQQ K;  3H1L E;  5CBO A;  5KJ7 A;  4TLF A;  2KUB A;  4UB8 H;  2V7Q J;  1DV5 A;  3VOP A;  2K9J A;  2MD9 A;  1K05 A;  1SQP E;  1SQV E; 
#chains in the Genus database with same CATH homology
 3CC7 P;  1QRJ A;  3RG6 C;  4GR2 A;  1A8O A;  5F2N A;  1VQN P;  1VQ4 P;  2XXM A;  3DS3 A;  4U0C A;  2QEX P;  5DCK A;  3P05 A;  3G28 A;  4M0I A;  1VQ9 P;  1VQ8 P;  3E2D A;  2PEM A;  1JJ2 O;  2PEN A;  1KD1 Q;  4PH0 A;  4XFY A;  4COC A;  4U0E A;  1VQL P;  3B5I A;  3H4E A;  3CCV P;  2M8L A;  1YJ9 P;  1VQP P;  3I56 P;  1E6J P;  5I4T G;  2E1M A;  3OW2 O;  1PEU A;  2XT1 A;  3G0V A;  5JPA A;  2PEK A;  1Q81 Q;  3G1I A;  4XFX A;  2Z46 A;  5F2O A;  3VRL C;  1N8R Q;  3MGE A;  1YIT P;  1D1D A;  2JO0 A;  5HGL A;  5HGN A;  4U0D A;  2LF4 A;  1M1K Q;  1PEM A;  1A43 A;  3CCE P;  2JYG A;  2M8P A;  1K8A Q;  3CCL P;  1BAJ A;  1KQS O;  3CCU P;  4QNB A;  3DPH A;  3G1G A;  3NTE A;  4WYM A;  3CMA P;  2QA4 P;  2EIA A;  4U0F A;  3CCQ P;  1QVG O;  1VQ7 P;  4XRQ A;  2BUO A;  1M6E X;  3DS0 A;  2OTJ P;  3I55 P;  4XRO A;  1VQ5 P;  2ONT A;  5F2K A;  3DS5 A;  2CWO A;  1YJN P;  1YI2 P;  2PEJ A;  2PEO A;  3G6E P;  1K9M Q;  2KOD A;  4GR6 A;  2P9X A;  2PY8 A;  3WBH A;  3H0D A;  3CC4 P;  1PEQ A;  3G71 P;  1M6N A;  2PEQ A;  3CCS P;  3CCR P;  1S72 P;  4IPY A;  3HYB A;  2OTL P;  3CD6 P;  1PEO A;  3G26 A;  2XV6 A;  3HZQ A;  3CXC O;  3M1M A;  1M90 Q;  1RO0 A;  2JYL A;  3DS2 A;  4U0B A;  1VQM P;  1NJI Q;  1EOQ A;  5HGM A;  3G29 A;  5HGO A;  3CME P;  1RO2 A;  1QVF O;  2DGY A;  1IUQ A;  3CCJ P;  1VQK P;  2PEI A;  1YJW P;  5BS1 A;  3G4S P;  2EG5 A;  1YIJ P;  1Q7Y Q;  1YHQ P;  2OAR A;  3DS4 A;  1RNI A;  3Q20 A;  4PH1 A;  2EFJ A;  2BQ1 E;  1AUM A;  3DS1 A;  1W2B O;  2Z44 A;  1K73 Q;  1ZMB A;  4XFZ A;  4COP A;  1M74 A;  1VQO P;  2BHV A;  1EIA A;  2L6E A;  1VQ6 P;  3CPW O;  3LRY A;  3H47 A;  1KC8 Q;  3G21 A;  4U0A A;  2M8N A;  1Q86 Q;  2Z45 A;  5BS2 A;  3CCM P;  3CC2 P;  3DTJ A;  1K30 A;  1Q82 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...