3G71P

Co-crystal structure of bruceantin bound to the large ribosomal subunit
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal RNA
publication title U2504 determines the species specificity of the A-site cleft antibiotics: the structures of tiamulin, homoharringtonine, and bruceantin bound to the ribosome.
pubmed doi rcsb
total genus 44
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2009-02-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3g71P03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 3g71P01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 3g71P02
1YITP 1YJWP 3CMEP 1QVFO 1VQ9P 1YJ9P 1VQKP 2OTLP 3CMAP 1KQSO 3CD6P 3CCRP 1VQMP 3CXCO 1VQ4P 1VQOP 1VQNP 1YHQP 3I56P 3CCSP 1K73Q 3CC7P 1VQ5P 3CCUP 1W2BO 1K9MQ 3OW2O 1VQLP 1VQPP 1VQ7P 2OTJP 3CCMP 1M90Q 3CC2P 1Q81Q 1VQ6P 3CPWO 2QEXP 3CCQP 1Q86Q 3CC4P 2QA4P 1S72P 1NJIQ 3G6EP 1Q82Q 1KC8Q 1QVGO 1M1KQ 1JJ2O 3CCEP 1Q7YQ 1YI2P 3CCLP 1K8AQ 3I55P 3G71P 1YJNP 3CCJP 1N8RQ 3CCVP 1YIJP 1KD1Q 3G4SP 1VQ8P
chains in the Genus database with same CATH superfamily
2R44A 5H2FH 1CW5A 3G1GA 1NGMB 3HTKB 3TF5A 3L71J 3B4QA 2VLNA 4PWVB 1CSBA 2KI7B 2AFEA 1GL2C 2X2BA 2GYKA 3OJAB 3SWYA 2P2UA 3U59A 1Z6MA 2KP8A 1N7SB 3BCCD 2YKQA 1S9KD 2RH0A 1OW6A 2N1TB 4AYCA 4KHXA 1D7MA 1EDKA 1T2KC 2E76D 3KXDA 2NPSC 3RBXA 2BASA 1Y47A 2A45G 1IFNA 3B5NC 2PENA 2KOQA 3PTZA 3FGAD 3AE8C 1LTTC 4UB6H 1LT9A 1FJKA 1X0TA 1IFMA 2FFDB 1Y9BA 3SFDC 3G3ZA 2KW2A 5B66H 4LLHA 2JJLA 4U3FJ 3E1RA 3N4XA 3ABVC 2FKWB 1GPJA 2FACA 2J5UA 4RKUJ 1JEKA 1SQPJ 3EFGA 3M1MA 3EQ2A 4R4LA 2PNGA 3T97A 1PP9D 2Z46A 3GW6A 1VQ4P 1QX8A 5AVTB 3P8CD 3L4FA 5CJ4A 1GK4A 5KLVJ 4HKZH 2XXMA 2AXTE 1PEUA 1ZOYC 1L0LJ 3HUSA 1SQXJ 1IO4A 3D6YA 3GZLA 4WBAA 5AVRB 4N3YB 3ITKA 1HVVA 1L4AB 2QVAA 2KGCA 4JYBA 4BPGA 2IYPA 3CPWO 3PH0A 3H25A 4I2LC 1NVOA 3MUDC 3H1LJ 4L75A 2KXPB 2AEFA 2QM8A 1MFTA 3RK2D 1KB9I 2SPZA 1MZ8A 4ASWA 2KGDA 1J2JB 4UB8E 4XFXA 3CMEP 4D6TD 5GTIE 2OGUA 2WSEH 2DNWA 2H88C 5AW1B 1OVRA 1HH0A 2N50A 1NU1K 3S9OA 1MFZA 3H1JE 2FYZA 3VMXA 1NOHA 2QIWA 4U0CA 4QKOA 2QSIA 2ZYAA 2E74D 2O01N 1YJNP 1M6NA 1IMPA 1N86A 2XKMA 1NU1E 3G21A 1A02F 1N7SC 5AVXB 4ZMDA 3CCRP 2A06G 2N1TC 2CWOA 1OMIA 2I1KA 2BEZF 4M3LA 5AW6B 1BDCA 1P84E 1DD3A 1RF0A 2QJKB 1FDOA 3GZMA 4CA3A 3GHGB 1YI2P 1SQBJ 4IZ6A 4NPEA 4WVZA 3V4QA 5H2FE 1S2EA 2M5AA 5CCHA 5AVSB 3HE5A 1G1IA 2PEKA 3GMAA 1KB9H 1JTHA 1Q81Q 2NZ2A 2OARA 2W6BA 4HH2A 1U7MA 1UJZA 1HQBA 1NTMJ 1PFIA 5BU8B 2E76B 3L71D 1VKUA 2Q6QA 1USDA 3CI9A 2K92A 2LTEA 3U43A 3CXHD 2N6YA 2KG8A 5DJTB 2K9JA 1BCCE 3G6EP 5HGLA 1T8KA 3L74G 2K9YA 4PD4D 3O6QA 2IPPA 1AVYA 2LIWA 2IYOA 4I1LA 1WMKA 2GDXA 1L4AC 3HE4A 2ZXXA 5B66E 3VP8A 4C46A 3II6A 2FADA 2QJYB 5KJ7D 3A2AA 2B9BA 2Y0CA 4H2XC 3W67A 2YMYA 2BCCJ 1URQD 2K37A 4IPYA 1VQNP 5AVQB 3L71G 4EI2A 4XROA 4W7ZA 2JYLA 3CCQP 3L70E 1EDLA 1NTKE 1VL2A 1EZVI 1SFCA 5AW9B 1OR5A 2Q9IA 1JY2P 1QRJA 1YIJP 3H47A 1SP4A 2FAEA 1LTGC 1AA0A 1BE3J 5KTBA 1FOSF 2CNRA 3CC7P 2P9XA 4PV1D 2IDBA 1SQXD 1ZR4A 3CCLP 3H1KJ 3GHGC 3A0HH 2PEQA 2JB0A 2ITAA 1VF5D 3L72D 3DS2A 5HGNA 3C9IA 1T6AA 2WSCH 1P84D 1GXGA 1NKZB 2FVFA 3O8ZA 1VQPP 2P7JA 5CCGD 1Q2NA 3H1LD 4U3FG 1M1JA 1VQ6P 1SQVK 1H0TA 2K88A 3IF4A 2IBZI 3VOPA 1FS0E 1X8YA 2YIUC 3L73G 2L6EA 1BGYD 3L36A 1SQPG 2E76C 5AVVB 1JMMA 5KLIB 1BDDA 3WUUA 2PEOA 1N73C 3G26A 1DNYA 3V2NA 2WQYC 2HG5D 3NTNA 1FZFA 4IFDK 1D1DA 5KLVG 3WU2H 1L0LG 3M0DA 2P1JA 4HJGH 1EOQA 1DV5A 1ZNVA 1SQXG 1E6JP 1NKNA 1NTZD 4JYCA 1RQVA 4YXDC 4XFYA 1G1JA 2R5DA 3L75E 3G0VA 2Z5HA 2GZIA 1FZAA 1JY3N 2LKMA 3BCCJ 2MD9A 1KB9E 2M8NA 1IZNB 1FR2A 2ERHA 2MJZA 4DG9A 1SQBD 2QJYC 1GK6A 2DGYA 3Q20A 2FHSC 1ZV8A 3VP9A 3LMOA 3MP7B 1KILD 5TISE 2KGAA 3M91A 3PHLA 5APUA 5KP8B 1VDFA 2B87B 3EJDA 4K35A 4DOJA 1E79H 2GDWA 2WT7A 2FXMA 2JO1A 5EFWB 4JF7A 5DCKA 3G4SP 4EOTA 3H1HE 2KWLA 5AVWB 3HYBA 4H0LD 3CLQA 2WVRA 2KS1B 1PP9J 1NTKD 2O1KA 1S5LE 2FY8A 2D2CD 3M9QA 1QEXA 3OA7A 3D6ZA 2OYIB 1SQBG 2NRGA 1URQB 1AFOA 4IL6H 2XZ0D 1TU3F 2BUOA 1G2CA 1X3OA 2OTLP 5CHXA 5KAIH 2UWJE 4JBZA 3VRLC 2KSEA 1LNQA 2HPCA 3OW2O 3FXEA 2JGPA 2OQQA 2AXTH 1CI6A 2GA1A 1LGHB 1RQUA 2XZ1C 1FZCB 1NTMG 5KLIC 2K5XA 1VHNA 4D6TJ 4PV1B 3DS0A 3P32A 2K0XA 3CC2P 1MKMA 3NFQA 1FU1A 1S4XA 3FWLA 1M1KQ 5BS2A 2HODB 2PY8A 3Q1MA 3HZQA 4XE5B 1IFJA 3TNUA 5GTIH 1KYOH 2FYUE 3BASA 3H1KD 3HD7D 1JOCA 3FX0A 1NO4A 3RG6C 1WT6A 2KOGA 1LTIC 3L75D 2WPRA 3RGUA 1EXJA 1RF1B 5M1BA 3A5TA 3RK3D 1KQFB 1EZVE 2KORA 2BCCG 5EJDA 4WY4D 2Z4EA 3V2PA 2K0DX 2YXQB 2ZXEB 1AQTA 2OYHB 1SQQE 3AEAC 3NMDA 1K8AQ 3AEEC 2KZJA 3MIWA 2JEEA 4COCA 3MGNA 2Y0DA 3N7NA 4BRYA 1BE3G 3C1LA 5EW5E 3A0BE 5KJ7C 3KQGA 2XZRA 2VSQA 4CPGA 3E7KA 2M8LA 3BRVB 5APTA 3NY7B 1RHZB 1KQGB 1LTBC 1KILB 2OYIC 3H1HD 3H1KG 2PEIA 1URQC 1KV4A 2E75D 4ZKUA 1RE3C 1DEEG 3ZDMA 2ZT9D 2IBZE 2Q1KA 4JPZB 4U0BA 3FXDA 1PGQA 2KOOA 3Q3DA 1OFCX 2EHSA 4GDOA 3L74E 1LTJA 1JY3O 4H0LB 1J1DB 2K1AA 1FZCC 1GTWA 2CPSA 2D2CB 4PV1C 3TYYA 2AFDA 4WYMA 1R5LA 1H8AA 2EG5A 4IL6E 1LT1A 1PIXA 3JCUH 1VQKP 5KAIE 5CCGC 4L73A 2G8YA 3CX5D 2I1JA 3D70A 3BCCG 1M56D 3CWBE 1QVGO 2KNCB 3I5CA 4PH1A 1NWQA 3OAKA 2WWWA 1L0ND 1RF1C 2LL8A 4GOEA 3L72J 2FYUD 5AVZB 4ASVA 1K04A 4UHPB 1Y8AA 3PLNA 1PGJA 5L8RJ 2OYHC 3CE7A 3KPEA 5HVCA 2E5TA 3H32A 1SQPK 2H7HA 2HLOA 1M8OB 1BGYJ 1KYOE 4EYYQ 1BXIA 1IFDA 4U3FE 3HD7B 2WPSA 3MTUE 2YMKA 1SQQD 5KLVK 1PP9G 3L73E 2VLPA 1KFNA 1L0LK 2XV5A 3RBZA 1KILC 4XFZA 1SQPE 1EDJA 2HFED 1HUCA 1SQXK 3RK3B 2JU2A 2A45I 2WSFH 1EMVA 2M3BA 4WY4B 2QRXA 1NTZJ 3TGUE 2LXCB 1MV8A 3I56P 3LW5H 5APYA 2OTJP 2W6AA 1LWUB 2ZYGA 1FZGA 2ZFCA 1GL2A 3CCJP 4H0LC 1J1DC 3BVHA 4ZKPA 1AUMA 2HPCB 1JNMA 1PEOA 3GLMA 2FFDC 2D2CC 1OWAA 4D6TG 2GM4A 4WWIA 2YO3A 2NPSA 1KC8Q 1A02J 1DD4A 1T8ZA 1IK7A 2E75B 2MVUA 3B5NA 2Z5IA 4LGDE 2JR8A 3GF3A 5TISH 4MN4C 5AW7B 2JWAA 3G29A 4IL6X 2FVAA 4U0DA 2A45H 3AECC 2AXCA 4EDFA 2BHVA 1NTKJ 3BRTB 2Q3EA 2FXOA 1KQLA 1HTLC 3GJNA 1LP1B 3H1IE 3Q5PA 1H89A 1SQBK 2JWDA 1PZQA 1HJ0A 2V7QH 2P58A 1GDTA 1CZQA 1BSHA 2MR8A 1PGPA 2IFNA 1EQ7A 2XNDH 3CWBD 1S5LH 2CQ8A 1SS1A 3G71P 1PPJE 2C0XA 1E0HA 3KHUA 1NTMK 3JCUE 4C7NA 2WSEJ 1EDIA 1QL1A 1U57A 3L37A 1VQ5P 3IAOA 1VQ7P 2O01H 3HD7C 3R4YA 1HWTC 1M90Q 2YNYA 1NTME 3PRJA 3MUDA 1LTSC 3RK3C 3G9RA 3AEDC 2KSJA 1KYOD 4XRQA 1U7JA 2XT1A 4WY4C 1KLPA 3H1JD 4MRTC 1VPCA 5CCHD 5CBNA 3HTKA 1AYIA 2KYVA 2AEJA 2M8PA 2YKOA 1LWUC 2WPTA 2QJKC 3M0AA 5CZDB 3RK2B 1JUNA 3SSUA 3TSIA 1NU1D 1FBMA 3TGUD 1OZHA 3LIDA 1A43A 3S4RA 4F37A 3L75J 1N7SA 3A7OA 1OXZA 2KZIA 2N1TA 2E74B 1AF8A 1IFIA 1JM0A 1A8OA 1EIAA 1USEA 3JSVC 2E75C 2IFMA 5F2OA 1LT9B 4R4MA 2BCCE 1M7LA 5AVUB 2QE7H 2M8RA 1PEQA 2KG9A 1T3JA 4N78E 1SQVE 1JCDA 1JJ2O 3M06A 2JBGA 3MGEA 2L22A 2POHA 4AUWA 3T97B 3H1HJ 1Z56A 3CMAP 2IZ1A 4LC1A 3L35A 2L0QA 3L72G 1NAYA 3A0BH 1RE4C 2KG6A 1OVUA 1BCCD 3PJSK 3HUSB 3H1ID 4HKGA 1LTAC 1SFCD 1JY3P 1KD1Q 1OIPA 3H1LG 3AEBC 2N5IA 2PEJA 1QVFO 3CXHI 3EJBA 2XDJA 5DJUB 2YXRB 1K73Q 1BGYG 4H44D 1L4AA 2RN0A 2Q7CA 2WMMA 2E43A 1PPJD 2FBWC 4PD4I 4WB4A 1JCCA 3TK1A 4AQRD 1ZMEC 3A3YB 2WPVB 1K05A 1BAJA 1N7SD 1NTZG 1JMBA 3L70D 2QEXP 2Z45A 3RK2C 2H89C 1DX7A 3KDPB 3LRYA 2HYNA 2LIUA 1YITP 1E5WA 2EFJA 3SWKA 2WSCJ 1RO0A 1VQMP 1S9KE 1L0NJ 2E74C 2PFXA 1WRGA 2FYUJ 4GR2A 5C39A 4I7ZB 2ZVNB 1M6EX 2MR7A 5AW4B 1S72P 3Q5SA 2E42A 1L2PA 4JQ0D 3GHGA 1RO2A 2M5AB 1LT9C 4COPA 4U7JA 3HE5B 1VQ9P 2LPKA 3MZWB 2C9NY 3IN6A 3VYIA 1JTHB 3AE6C 5AW0B 4H2WC 1SQQJ 3AEFC 1VF5B 3P7KA 1YQ4C 1YTZI 1NTKG 2GUVA 5CJ0A 3WBHA 4YXWH 2W27A 1FZEA 3M9BA 2J58A 2DW3A 2N5HA 1QGKB 1XTCC 4N78D 2N9YB 4C7RA 5TJHA 1IMQA 1N73A 3P8CE 2K9JB 2XV6A 3AE9C 1QLED 3VTPC 3HUSC 1R8EA 3CC4P 3PP5A 1S3JA 5BS1A 1ZMBA 4DZOA 3O6QB 2A06E 1ZP0C 1CEIA 4GT1A 4Y28J 3HE4B 5CBOA 1KB9D 1Q90D 1GW4A 3NTEA 3H0DA 3JC22 3B8EB 1IUQA 1AV1A 1ZN5A 4OGQD 4I6MC 1F80D 4DJGA 2JKVA 2RMZA 2H8PD 1JO5A 2JP3A 4H13D 3E1IA 2WPQA 2VLOA 2R32A 5AW8B 4N6JA 1L0IA 1K9MQ 5HGMA 1EXIA 2GZFA 1AVOA 1X9VA 1YTZT 1Q86Q 1SFCB 4ZNCA 1S5LX 2LOLA 4NEOA 4H44B 1J1EB 1OW8A 4IFFA 3L75G 1RY3A 1RF0C 3KZIE 3U1AA 5AW3B 1L0HA 4I7ZC 1AJYA 2K2QA 1RNIA 3CWBJ 1HY8A 3F5HA 4EIJA 2K0YA 1GXHA 2LF4A 2ROQA 1VQ8P 4PJ0E 5CCHC 3W68A 3IFMA 1VQLP 1NYHA 1M1JB 2E5YA 1H0TB 2GZJA 2QG4A 4BPFA 3I55P 1VF5C 1OX3A 4U0EA 5I4TG 2BEQD 3H1HG 3L71E 3DPHA 4Y99B 2P67A 1YYCA 3H1JJ 3RL0D 3CXHE 5E79H 4PH0A 3BATA 3L73J 5KAFE 1PV3A 1DH3A 3EWKA 4O9BA 1K30A 2C0WA 1W2EA 1NU1J 4PD4E 3TGUJ 3AE1C 2WSSH 1HBWA 3UIAA 4GODA 3CCMP 2N6ZA 4YPCA 4TLFA 2PRRA 2EHTA 4IOIH 2EIAA 2A06D 2Q5UA 5HV8A 1N7LA 2VRSA 7CEIA 5KKZB 1EZVD 1YJ9P 2L9FA 2L4BA 5KP6B 1YBKA 2QJPB 5APWA 4TT3H 2CK3H 1JB0J 2WT7B 2B87A 1SFCC 2Y0EA 2N98A 1KZUB 1IC2A 2Q3IA 4NPFX 4GR6A 4H44C 1RH5B 1J1EC 2YO2A 4OGQB 1BSNA 2M3EA 2FQ2A 2O3JA 5KLVE 1L0NG 1HGVA 2KS1A 5KJ7A 1L0LE 3AE4C 5KP7B 1W5CE 2QA4P 2FYUG 4RJTA 3EFFK 1BCCJ 1SQXE 3H1IJ 4H13B 1FC2C 1G2CB 2OYIA 2KODA 2IX7C 1URQA 2IBZD 3L72E 1RE3A 3WMM0 1EZVG 4M0IA 1CI6B 1M1JC 1HJBA 2LMLA 2N9BA 3L74D 2JO0A 1PGOA 4L76A 3H1LE 2PP6A 1SQQG 4XFJA 4BPHA 2I8DA 1FZBA 2ZT9B 5CMZA 1BGYE 3DTJA 1FZCA 4HB1A 1FAVA 1DIPA 2AF8A 2KK7A 1NTZK 2K94A 4Y99C 4OVNF 3G28A 3DS5A 1X79B 4OH8B 3M0DC 1Q82Q 3L70J 2L91A 4BXLA 3SWFA 2YIUB 3CCVP 2FXPA 4GIFA 4K3AA 2C9LY 3TNUB 2HODA 1YJWP 1NTZE 2PGDA 2KGEA 1N73B 3V2RA 3RG2A 1GU4A 1ZW0A 2GZGA 5CCGA 4IFMA 2IBZG 2P10A 3EJEA 2CGQA 4GOFA 1GZLA 2JYGA 2KOPA 1SQBE 1OVVA 3GF7A 2XU6A 4UB6E 2M0BA 2RKLA 2KB7P 3CX5I 5APXA 5KKZC 1KILE 1EC5A 3VMAA 1XTGB 3M9HA 3RL0B 5F2KA 1RF1A 3CXCO 4DCKA 3HRNA 2QJPC 2FQ0A 1YQ3C 3G1IA 2XNXA 2L5GB 5E79E 1ZRTE 3USSA 1ZXGA 2OYHA 1UNKA 1NTKK 5HGOA 2KLUA 4GKGA 4U0AA 2FYNB 3AE3C 5B5EH 1GL2D 5AVYB 2WSFJ 4BRYB 3GG2A 1SVFA 2LXBA 4R0MA 4U3FD 1H88A 1JY2N 3LW5J 4OGQC 5BVZA 2WTYA 2ZAEB 3L73D 1T2KD 1SQVJ 2V4HA 2NPSD 1SQPD 3V2QA 1DEBA 4H13C 3CWBG 2MF4A 1QL2A 2OTKE 1KILA 3B5ND 1LJ2A 3P8MC 2GUSA 2B88A 1IJDB 3S1KA 1KQSO 3P05A 2WZ7A 2IZ0A 5KLVD 2O1JA 1YHQP 3U1CA 3CCUP 1L0LD 1AQ5A 2K3RA 1HF9A 1S1CX 3CX5H 1LTJB 1NJIQ 1KORA 2KR5A 1ZR2A 2YKPA 4YTPC 4RO0A 2ZT9C 4XA4A 3Q5RA 2B89A 2VLQA 1NQ4A 4DT0A 2FFDA 3H1JG 2KIKA 2W8ZA 1NH4A 2MKVA 1FDIA 2KOSA 2G3AA 3GKLC 3F89A 1BE3E 5GTHH 3VN0A 2V7QJ 1X22A 1NU1G 3AE7C 1FJPA 3TGUG 2QNWA 4KT0J 2NO8A 1GMJA 3H1KE 5K5GB 1ZLLA 2AVAA 3V5BA 1N8RQ 5F2NA 2KNCA 3WUVA 3AEGC 2R5BA 2M5RA 1R5SA 3K5BA 5APVA 2GDYA 1M57D 1SLQA 1GU5A 3RL0C 1MUUA 3RK3E 3DS4A 4W7YA 2O01J 3IR9A 2W6JH 2WITA 3KZIH 1KMIZ 3R2PA 3CCEP 1FOSE 1Q7YQ 2OYOA 2Y9YA 2FYNC 3H32B 3TDKA 2KUBA 1GW3A 4B86A 4PJ0H 1PEMA 4Z1MH 3CD6P 3B71A 1FDMA 4HYTB 3CL3D 1VQOP 2AEMA 2J59M 2CG5B 1ZRTD 2N1TD 3HD7A 4L74A 3H4EA 2GZEA 3V6IA 1NTMD 2FQ1A 3B5IA 2Y9ZA 1BCCG 3H1IG 3VMYA 1NHLA 2HR3A 3FWNA 4OWFA 4WY4A 4W80A 2H43A 3BCCE 3LIEA 1UIXA 3WUTA 1NAFA 2R3CA 2JDIH 3CXHH 1LTJC 4U0FA 1KYOI 1GL2B 1LWUA 3SFEC 1PL5A 1UIIA 2ZJSE 5B5EE 5KAFH 4PXHB 1FE6A 4KJMA 1PPJG 3H6PA 1KFMA 3VMZA 2FVEA 2PAJA 4A7PA 4QNBA 4PD4H 1KN7A 1T3UA 1N2DC 2NPSB 3C8VA 2ZYDA 3RL0g 4NPDA 3B5NB 3QWOC 3Q2YA 1KTMA 2BCCD 3L70G 1P84I 3E2DA 2MVVA 1ACPA 3KYQA 2KLVA 2MY5A 2W90A 2ONTA 3D71A 1PP9E 1L0NK 3MD0A 1SQVD 2W83C 3AE5C 1OW7A 2K93A 3CX5E 2CPBA 1L4AD 2FYUK 1HGZA 3A0HE 3V4WA 2LKIA 1JY2O 5APSA 1BE3D 1LP1A 4BWNA 2LR2A 2JU1A 2E1MA 4H2YC 3B4SA 2PEMA 4UB8H 1L0NE 3NXSA 4RESB 2QM7A 1W2BO 3AE2C 4QMAA 2JAZA 3DS3A 1RE4A 1IFPA 1SQQK 3L74J 4C7NB 3MHVA 5BU5A 5GTHE 1MZ9A 5JPAA 4D6TE 3CCSP 1P84H 5AW5B 3DS1A 3WU2E 2ZVOB 1M74A 5AW2B 5APQA 1GD2E 1SQVG 2JQ4A 1IK9A 2BQ1E 2R3SA 3QH9A 2Z44A
chains in the Genus database with same CATH topology
4XRQA 1QVFO 2PEJA 3DS2A 2XT1A 3G1GA 1AUMA 5HGNA 1VQKP 3HYBA 4GR6A 1PEOA 5F2KA 3CXCO 4QNBA 1K73Q 2M8PA 1VQLP 1VQPP 2XV6A 3G1IA 3CPWO 3CC4P 2QA4P 1KC8Q 1VQ6P 3G6EP 1QVGO 5BS1A 1ZMBA 1K8AQ 4PH1A 3I55P 5HGOA 1N8RQ 4U0AA 5F2NA 5HGLA 3E2DA 2L6EA 4U0EA 2KODA 4COCA 5I4TG 4XFXA 3CMEP 2BUOA 2OTLP 1A43A 2PEOA 3VRLC 3G29A 1BAJA 2ONTA 3NTEA 3DPHA 3G26A 3H0DA 3DS4A 3OW2O 1IUQA 4M0IA 4U0DA 4U0CA 1A8OA 1EIAA 2M8LA 1D1DA 2QEXP 2JO0A 2BHVA 2Z45A 3CCEP 4PH0A 1Q7YQ 2PENA 1YJNP 1EOQA 1M6NA 5F2OA 2PEIA 3LRYA 1K30A 1E6JP 2E1MA 1YITP 2EFJA 2PEMA 3G21A 3DTJA 4XFYA 1PEMA 1KQSO 3CD6P 3P05A 1RO0A 3G0VA 3CCRP 4IPYA 1VQMP 2CWOA 1VQNP 1VQOP 1PEQA 1YHQP 4U0BA 1W2BO 3CCUP 1K9MQ 2M8NA 5HGMA 3DS0A 3G28A 3CCMP 3CC2P 4GR2A 3DS5A 4XROA 3DS3A 1Q86Q 2JYLA 1M6EX 3CCQP 3H4EA 2DGYA 3Q20A 1S72P 1NJIQ 1Q82Q 1M1KQ 1JJ2O 5BS2A 1YI2P 3G71P 3B5IA 4XFZA 2EIAA 3MGEA 3CCVP 1QRJA 1YIJP 2PY8A 3H47A 3HZQA 1RO2A 4COPA 1YJWP 3M1MA 1VQ9P 1YJ9P 3CMAP 5JPAA 2Z46A 1VQ4P 3I56P 2PEKA 3CCSP 3CC7P 1VQ5P 1VQ7P 4WYMA 2OTJP 2XXMA 1M90Q 2P9XA 1Q81Q 1PEUA 3DS1A 2EG5A 1M74A 2JYGA 4U0FA 1RNIA 3CCLP 2OARA 3RG6C 3CCJP 2BQ1E 1KD1Q 2PEQA 2LF4A 3WBHA 5DCKA 3G4SP 1VQ8P 2Z44A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YIT P;  1YJW P;  3CME P;  1QVF O;  1VQ9 P;  1YJ9 P;  1VQK P;  2OTL P;  3CMA P;  1KQS O;  3CD6 P;  3CCR P;  1VQM P;  3CXC O;  1VQ4 P;  1VQO P;  1VQN P;  1YHQ P;  3I56 P;  3CCS P;  1K73 Q;  3CC7 P;  1VQ5 P;  3CCU P;  1W2B O;  1K9M Q;  3OW2 O;  1VQL P;  1VQP P;  1VQ7 P;  2OTJ P;  3CCM P;  1M90 Q;  3CC2 P;  1Q81 Q;  1VQ6 P;  3CPW O;  2QEX P;  3CCQ P;  1Q86 Q;  3CC4 P;  2QA4 P;  1S72 P;  1NJI Q;  3G6E P;  1Q82 Q;  1KC8 Q;  1QVG O;  1M1K Q;  1JJ2 O;  3CCE P;  1Q7Y Q;  1YI2 P;  3CCL P;  1K8A Q;  3I55 P;  3G71 P;  1YJN P;  3CCJ P;  1N8R Q;  3CCV P;  1YIJ P;  1KD1 Q;  3G4S P;  1VQ8 P; 
#chains in the Genus database with same CATH topology
 2R44 A;  5H2F H;  1CW5 A;  3G1G A;  1NGM B;  3HTK B;  3TF5 A;  3L71 J;  3B4Q A;  2VLN A;  4PWV B;  1CSB A;  2KI7 B;  2AFE A;  1GL2 C;  2X2B A;  2GYK A;  3OJA B;  3SWY A;  2P2U A;  3U59 A;  1Z6M A;  2KP8 A;  1N7S B;  3BCC D;  2YKQ A;  1S9K D;  2RH0 A;  1OW6 A;  2N1T B;  4AYC A;  4KHX A;  1D7M A;  1EDK A;  1T2K C;  2E76 D;  3KXD A;  2NPS C;  3RBX A;  2BAS A;  1Y47 A;  2A45 G;  1IFN A;  3B5N C;  2PEN A;  2KOQ A;  3PTZ A;  3FGA D;  3AE8 C;  1LTT C;  4UB6 H;  1LT9 A;  1FJK A;  1X0T A;  1IFM A;  2FFD B;  1Y9B A;  3SFD C;  3G3Z A;  2KW2 A;  5B66 H;  4LLH A;  2JJL A;  4U3F J;  3E1R A;  3N4X A;  3ABV C;  2FKW B;  1GPJ A;  2FAC A;  2J5U A;  4RKU J;  1JEK A;  1SQP J;  3EFG A;  3M1M A;  3EQ2 A;  4R4L A;  2PNG A;  3T97 A;  1PP9 D;  2Z46 A;  3GW6 A;  1VQ4 P;  1QX8 A;  5AVT B;  3P8C D;  3L4F A;  5CJ4 A;  1GK4 A;  5KLV J;  4HKZ H;  2XXM A;  2AXT E;  1PEU A;  1ZOY C;  1L0L J;  3HUS A;  1SQX J;  1IO4 A;  3D6Y A;  3GZL A;  4WBA A;  5AVR B;  4N3Y B;  3ITK A;  1HVV A;  1L4A B;  2QVA A;  2KGC A;  4JYB A;  4BPG A;  2IYP A;  3CPW O;  3PH0 A;  3H25 A;  4I2L C;  1NVO A;  3MUD C;  3H1L J;  4L75 A;  2KXP B;  2AEF A;  2QM8 A;  1MFT A;  3RK2 D;  1KB9 I;  2SPZ A;  1MZ8 A;  4ASW A;  2KGD A;  1J2J B;  4UB8 E;  4XFX A;  3CME P;  4D6T D;  5GTI E;  2OGU A;  2WSE H;  2DNW A;  2H88 C;  5AW1 B;  1OVR A;  1HH0 A;  2N50 A;  1NU1 K;  3S9O A;  1MFZ A;  3H1J E;  2FYZ A;  3VMX A;  1NOH A;  2QIW A;  4U0C A;  4QKO A;  2QSI A;  2ZYA A;  2E74 D;  2O01 N;  1YJN P;  1M6N A;  1IMP A;  1N86 A;  2XKM A;  1NU1 E;  3G21 A;  1A02 F;  1N7S C;  5AVX B;  4ZMD A;  3CCR P;  2A06 G;  2N1T C;  2CWO A;  1OMI A;  2I1K A;  2BEZ F;  4M3L A;  5AW6 B;  1BDC A;  1P84 E;  1DD3 A;  1RF0 A;  2QJK B;  1FDO A;  3GZM A;  4CA3 A;  3GHG B;  1YI2 P;  1SQB J;  4IZ6 A;  4NPE A;  4WVZ A;  3V4Q A;  5H2F E;  1S2E A;  2M5A A;  5CCH A;  5AVS B;  3HE5 A;  1G1I A;  2PEK A;  3GMA A;  1KB9 H;  1JTH A;  1Q81 Q;  2NZ2 A;  2OAR A;  2W6B A;  4HH2 A;  1U7M A;  1UJZ A;  1HQB A;  1NTM J;  1PFI A;  5BU8 B;  2E76 B;  3L71 D;  1VKU A;  2Q6Q A;  1USD A;  3CI9 A;  2K92 A;  2LTE A;  3U43 A;  3CXH D;  2N6Y A;  2KG8 A;  5DJT B;  2K9J A;  1BCC E;  3G6E P;  5HGL A;  1T8K A;  3L74 G;  2K9Y A;  4PD4 D;  3O6Q A;  2IPP A;  1AVY A;  2LIW A;  2IYO A;  4I1L A;  1WMK A;  2GDX A;  1L4A C;  3HE4 A;  2ZXX A;  5B66 E;  3VP8 A;  4C46 A;  3II6 A;  2FAD A;  2QJY B;  5KJ7 D;  3A2A A;  2B9B A;  2Y0C A;  4H2X C;  3W67 A;  2YMY A;  2BCC J;  1URQ D;  2K37 A;  4IPY A;  1VQN P;  5AVQ B;  3L71 G;  4EI2 A;  4XRO A;  4W7Z A;  2JYL A;  3CCQ P;  3L70 E;  1EDL A;  1NTK E;  1VL2 A;  1EZV I;  1SFC A;  5AW9 B;  1OR5 A;  2Q9I A;  1JY2 P;  1QRJ A;  1YIJ P;  3H47 A;  1SP4 A;  2FAE A;  1LTG C;  1AA0 A;  1BE3 J;  5KTB A;  1FOS F;  2CNR A;  3CC7 P;  2P9X A;  4PV1 D;  2IDB A;  1SQX D;  1ZR4 A;  3CCL P;  3H1K J;  3GHG C;  3A0H H;  2PEQ A;  2JB0 A;  2ITA A;  1VF5 D;  3L72 D;  3DS2 A;  5HGN A;  3C9I A;  1T6A A;  2WSC H;  1P84 D;  1GXG A;  1NKZ B;  2FVF A;  3O8Z A;  1VQP P;  2P7J A;  5CCG D;  1Q2N A;  3H1L D;  4U3F G;  1M1J A;  1VQ6 P;  1SQV K;  1H0T A;  2K88 A;  3IF4 A;  2IBZ I;  3VOP A;  1FS0 E;  1X8Y A;  2YIU C;  3L73 G;  2L6E A;  1BGY D;  3L36 A;  1SQP G;  2E76 C;  5AVV B;  1JMM A;  5KLI B;  1BDD A;  3WUU A;  2PEO A;  1N73 C;  3G26 A;  1DNY A;  3V2N A;  2WQY C;  2HG5 D;  3NTN A;  1FZF A;  4IFD K;  1D1D A;  5KLV G;  3WU2 H;  1L0L G;  3M0D A;  2P1J A;  4HJG H;  1EOQ A;  1DV5 A;  1ZNV A;  1SQX G;  1E6J P;  1NKN A;  1NTZ D;  4JYC A;  1RQV A;  4YXD C;  4XFY A;  1G1J A;  2R5D A;  3L75 E;  3G0V A;  2Z5H A;  2GZI A;  1FZA A;  1JY3 N;  2LKM A;  3BCC J;  2MD9 A;  1KB9 E;  2M8N A;  1IZN B;  1FR2 A;  2ERH A;  2MJZ A;  4DG9 A;  1SQB D;  2QJY C;  1GK6 A;  2DGY A;  3Q20 A;  2FHS C;  1ZV8 A;  3VP9 A;  3LMO A;  3MP7 B;  1KIL D;  5TIS E;  2KGA A;  3M91 A;  3PHL A;  5APU A;  5KP8 B;  1VDF A;  2B87 B;  3EJD A;  4K35 A;  4DOJ A;  1E79 H;  2GDW A;  2WT7 A;  2FXM A;  2JO1 A;  5EFW B;  4JF7 A;  5DCK A;  3G4S P;  4EOT A;  3H1H E;  2KWL A;  5AVW B;  3HYB A;  4H0L D;  3CLQ A;  2WVR A;  2KS1 B;  1PP9 J;  1NTK D;  2O1K A;  1S5L E;  2FY8 A;  2D2C D;  3M9Q A;  1QEX A;  3OA7 A;  3D6Z A;  2OYI B;  1SQB G;  2NRG A;  1URQ B;  1AFO A;  4IL6 H;  2XZ0 D;  1TU3 F;  2BUO A;  1G2C A;  1X3O A;  2OTL P;  5CHX A;  5KAI H;  2UWJ E;  4JBZ A;  3VRL C;  2KSE A;  1LNQ A;  2HPC A;  3OW2 O;  3FXE A;  2JGP A;  2OQQ A;  2AXT H;  1CI6 A;  2GA1 A;  1LGH B;  1RQU A;  2XZ1 C;  1FZC B;  1NTM G;  5KLI C;  2K5X A;  1VHN A;  4D6T J;  4PV1 B;  3DS0 A;  3P32 A;  2K0X A;  3CC2 P;  1MKM A;  3NFQ A;  1FU1 A;  1S4X A;  3FWL A;  1M1K Q;  5BS2 A;  2HOD B;  2PY8 A;  3Q1M A;  3HZQ A;  4XE5 B;  1IFJ A;  3TNU A;  5GTI H;  1KYO H;  2FYU E;  3BAS A;  3H1K D;  3HD7 D;  1JOC A;  3FX0 A;  1NO4 A;  3RG6 C;  1WT6 A;  2KOG A;  1LTI C;  3L75 D;  2WPR A;  3RGU A;  1EXJ A;  1RF1 B;  5M1B A;  3A5T A;  3RK3 D;  1KQF B;  1EZV E;  2KOR A;  2BCC G;  5EJD A;  4WY4 D;  2Z4E A;  3V2P A;  2K0D X;  2YXQ B;  2ZXE B;  1AQT A;  2OYH B;  1SQQ E;  3AEA C;  3NMD A;  1K8A Q;  3AEE C;  2KZJ A;  3MIW A;  2JEE A;  4COC A;  3MGN A;  2Y0D A;  3N7N A;  4BRY A;  1BE3 G;  3C1L A;  5EW5 E;  3A0B E;  5KJ7 C;  3KQG A;  2XZR A;  2VSQ A;  4CPG A;  3E7K A;  2M8L A;  3BRV B;  5APT A;  3NY7 B;  1RHZ B;  1KQG B;  1LTB C;  1KIL B;  2OYI C;  3H1H D;  3H1K G;  2PEI A;  1URQ C;  1KV4 A;  2E75 D;  4ZKU A;  1RE3 C;  1DEE G;  3ZDM A;  2ZT9 D;  2IBZ E;  2Q1K A;  4JPZ B;  4U0B A;  3FXD A;  1PGQ A;  2KOO A;  3Q3D A;  1OFC X;  2EHS A;  4GDO A;  3L74 E;  1LTJ A;  1JY3 O;  4H0L B;  1J1D B;  2K1A A;  1FZC C;  1GTW A;  2CPS A;  2D2C B;  4PV1 C;  3TYY A;  2AFD A;  4WYM A;  1R5L A;  1H8A A;  2EG5 A;  4IL6 E;  1LT1 A;  1PIX A;  3JCU H;  1VQK P;  5KAI E;  5CCG C;  4L73 A;  2G8Y A;  3CX5 D;  2I1J A;  3D70 A;  3BCC G;  1M56 D;  3CWB E;  1QVG O;  2KNC B;  3I5C A;  4PH1 A;  1NWQ A;  3OAK A;  2WWW A;  1L0N D;  1RF1 C;  2LL8 A;  4GOE A;  3L72 J;  2FYU D;  5AVZ B;  4ASV A;  1K04 A;  4UHP B;  1Y8A A;  3PLN A;  1PGJ A;  5L8R J;  2OYH C;  3CE7 A;  3KPE A;  5HVC A;  2E5T A;  3H32 A;  1SQP K;  2H7H A;  2HLO A;  1M8O B;  1BGY J;  1KYO E;  4EYY Q;  1BXI A;  1IFD A;  4U3F E;  3HD7 B;  2WPS A;  3MTU E;  2YMK A;  1SQQ D;  5KLV K;  1PP9 G;  3L73 E;  2VLP A;  1KFN A;  1L0L K;  2XV5 A;  3RBZ A;  1KIL C;  4XFZ A;  1SQP E;  1EDJ A;  2HFE D;  1HUC A;  1SQX K;  3RK3 B;  2JU2 A;  2A45 I;  2WSF H;  1EMV A;  2M3B A;  4WY4 B;  2QRX A;  1NTZ J;  3TGU E;  2LXC B;  1MV8 A;  3I56 P;  3LW5 H;  5APY A;  2OTJ P;  2W6A A;  1LWU B;  2ZYG A;  1FZG A;  2ZFC A;  1GL2 A;  3CCJ P;  4H0L C;  1J1D C;  3BVH A;  4ZKP A;  1AUM A;  2HPC B;  1JNM A;  1PEO A;  3GLM A;  2FFD C;  2D2C C;  1OWA A;  4D6T G;  2GM4 A;  4WWI A;  2YO3 A;  2NPS A;  1KC8 Q;  1A02 J;  1DD4 A;  1T8Z A;  1IK7 A;  2E75 B;  2MVU A;  3B5N A;  2Z5I A;  4LGD E;  2JR8 A;  3GF3 A;  5TIS H;  4MN4 C;  5AW7 B;  2JWA A;  3G29 A;  4IL6 X;  2FVA A;  4U0D A;  2A45 H;  3AEC C;  2AXC A;  4EDF A;  2BHV A;  1NTK J;  3BRT B;  2Q3E A;  2FXO A;  1KQL A;  1HTL C;  3GJN A;  1LP1 B;  3H1I E;  3Q5P A;  1H89 A;  1SQB K;  2JWD A;  1PZQ A;  1HJ0 A;  2V7Q H;  2P58 A;  1GDT A;  1CZQ A;  1BSH A;  2MR8 A;  1PGP A;  2IFN A;  1EQ7 A;  2XND H;  3CWB D;  1S5L H;  2CQ8 A;  1SS1 A;  3G71 P;  1PPJ E;  2C0X A;  1E0H A;  3KHU A;  1NTM K;  3JCU E;  4C7N A;  2WSE J;  1EDI A;  1QL1 A;  1U57 A;  3L37 A;  1VQ5 P;  3IAO A;  1VQ7 P;  2O01 H;  3HD7 C;  3R4Y A;  1HWT C;  1M90 Q;  2YNY A;  1NTM E;  3PRJ A;  3MUD A;  1LTS C;  3RK3 C;  3G9R A;  3AED C;  2KSJ A;  1KYO D;  4XRQ A;  1U7J A;  2XT1 A;  4WY4 C;  1KLP A;  3H1J D;  4MRT C;  1VPC A;  5CCH D;  5CBN A;  3HTK A;  1AYI A;  2KYV A;  2AEJ A;  2M8P A;  2YKO A;  1LWU C;  2WPT A;  2QJK C;  3M0A A;  5CZD B;  3RK2 B;  1JUN A;  3SSU A;  3TSI A;  1NU1 D;  1FBM A;  3TGU D;  1OZH A;  3LID A;  1A43 A;  3S4R A;  4F37 A;  3L75 J;  1N7S A;  3A7O A;  1OXZ A;  2KZI A;  2N1T A;  2E74 B;  1AF8 A;  1IFI A;  1JM0 A;  1A8O A;  1EIA A;  1USE A;  3JSV C;  2E75 C;  2IFM A;  5F2O A;  1LT9 B;  4R4M A;  2BCC E;  1M7L A;  5AVU B;  2QE7 H;  2M8R A;  1PEQ A;  2KG9 A;  1T3J A;  4N78 E;  1SQV E;  1JCD A;  1JJ2 O;  3M06 A;  2JBG A;  3MGE A;  2L22 A;  2POH A;  4AUW A;  3T97 B;  3H1H J;  1Z56 A;  3CMA P;  2IZ1 A;  4LC1 A;  3L35 A;  2L0Q A;  3L72 G;  1NAY A;  3A0B H;  1RE4 C;  2KG6 A;  1OVU A;  1BCC D;  3PJS K;  3HUS B;  3H1I D;  4HKG A;  1LTA C;  1SFC D;  1JY3 P;  1KD1 Q;  1OIP A;  3H1L G;  3AEB C;  2N5I A;  2PEJ A;  1QVF O;  3CXH I;  3EJB A;  2XDJ A;  5DJU B;  2YXR B;  1K73 Q;  1BGY G;  4H44 D;  1L4A A;  2RN0 A;  2Q7C A;  2WMM A;  2E43 A;  1PPJ D;  2FBW C;  4PD4 I;  4WB4 A;  1JCC A;  3TK1 A;  4AQR D;  1ZME C;  3A3Y B;  2WPV B;  1K05 A;  1BAJ A;  1N7S D;  1NTZ G;  1JMB A;  3L70 D;  2QEX P;  2Z45 A;  3RK2 C;  2H89 C;  1DX7 A;  3KDP B;  3LRY A;  2HYN A;  2LIU A;  1YIT P;  1E5W A;  2EFJ A;  3SWK A;  2WSC J;  1RO0 A;  1VQM P;  1S9K E;  1L0N J;  2E74 C;  2PFX A;  1WRG A;  2FYU J;  4GR2 A;  5C39 A;  4I7Z B;  2ZVN B;  1M6E X;  2MR7 A;  5AW4 B;  1S72 P;  3Q5S A;  2E42 A;  1L2P A;  4JQ0 D;  3GHG A;  1RO2 A;  2M5A B;  1LT9 C;  4COP A;  4U7J A;  3HE5 B;  1VQ9 P;  2LPK A;  3MZW B;  2C9N Y;  3IN6 A;  3VYI A;  1JTH B;  3AE6 C;  5AW0 B;  4H2W C;  1SQQ J;  3AEF C;  1VF5 B;  3P7K A;  1YQ4 C;  1YTZ I;  1NTK G;  2GUV A;  5CJ0 A;  3WBH A;  4YXW H;  2W27 A;  1FZE A;  3M9B A;  2J58 A;  2DW3 A;  2N5H A;  1QGK B;  1XTC C;  4N78 D;  2N9Y B;  4C7R A;  5TJH A;  1IMQ A;  1N73 A;  3P8C E;  2K9J B;  2XV6 A;  3AE9 C;  1QLE D;  3VTP C;  3HUS C;  1R8E A;  3CC4 P;  3PP5 A;  1S3J A;  5BS1 A;  1ZMB A;  4DZO A;  3O6Q B;  2A06 E;  1ZP0 C;  1CEI A;  4GT1 A;  4Y28 J;  3HE4 B;  5CBO A;  1KB9 D;  1Q90 D;  1GW4 A;  3NTE A;  3H0D A;  3JC2 2;  3B8E B;  1IUQ A;  1AV1 A;  1ZN5 A;  4OGQ D;  4I6M C;  1F80 D;  4DJG A;  2JKV A;  2RMZ A;  2H8P D;  1JO5 A;  2JP3 A;  4H13 D;  3E1I A;  2WPQ A;  2VLO A;  2R32 A;  5AW8 B;  4N6J A;  1L0I A;  1K9M Q;  5HGM A;  1EXI A;  2GZF A;  1AVO A;  1X9V A;  1YTZ T;  1Q86 Q;  1SFC B;  4ZNC A;  1S5L X;  2LOL A;  4NEO A;  4H44 B;  1J1E B;  1OW8 A;  4IFF A;  3L75 G;  1RY3 A;  1RF0 C;  3KZI E;  3U1A A;  5AW3 B;  1L0H A;  4I7Z C;  1AJY A;  2K2Q A;  1RNI A;  3CWB J;  1HY8 A;  3F5H A;  4EIJ A;  2K0Y A;  1GXH A;  2LF4 A;  2ROQ A;  1VQ8 P;  4PJ0 E;  5CCH C;  3W68 A;  3IFM A;  1VQL P;  1NYH A;  1M1J B;  2E5Y A;  1H0T B;  2GZJ A;  2QG4 A;  4BPF A;  3I55 P;  1VF5 C;  1OX3 A;  4U0E A;  5I4T G;  2BEQ D;  3H1H G;  3L71 E;  3DPH A;  4Y99 B;  2P67 A;  1YYC A;  3H1J J;  3RL0 D;  3CXH E;  5E79 H;  4PH0 A;  3BAT A;  3L73 J;  5KAF E;  1PV3 A;  1DH3 A;  3EWK A;  4O9B A;  1K30 A;  2C0W A;  1W2E A;  1NU1 J;  4PD4 E;  3TGU J;  3AE1 C;  2WSS H;  1HBW A;  3UIA A;  4GOD A;  3CCM P;  2N6Z A;  4YPC A;  4TLF A;  2PRR A;  2EHT A;  4IOI H;  2EIA A;  2A06 D;  2Q5U A;  5HV8 A;  1N7L A;  2VRS A;  7CEI A;  5KKZ B;  1EZV D;  1YJ9 P;  2L9F A;  2L4B A;  5KP6 B;  1YBK A;  2QJP B;  5APW A;  4TT3 H;  2CK3 H;  1JB0 J;  2WT7 B;  2B87 A;  1SFC C;  2Y0E A;  2N98 A;  1KZU B;  1IC2 A;  2Q3I A;  4NPF X;  4GR6 A;  4H44 C;  1RH5 B;  1J1E C;  2YO2 A;  4OGQ B;  1BSN A;  2M3E A;  2FQ2 A;  2O3J A;  5KLV E;  1L0N G;  1HGV A;  2KS1 A;  5KJ7 A;  1L0L E;  3AE4 C;  5KP7 B;  1W5C E;  2QA4 P;  2FYU G;  4RJT A;  3EFF K;  1BCC J;  1SQX E;  3H1I J;  4H13 B;  1FC2 C;  1G2C B;  2OYI A;  2KOD A;  2IX7 C;  1URQ A;  2IBZ D;  3L72 E;  1RE3 A;  3WMM 0;  1EZV G;  4M0I A;  1CI6 B;  1M1J C;  1HJB A;  2LML A;  2N9B A;  3L74 D;  2JO0 A;  1PGO A;  4L76 A;  3H1L E;  2PP6 A;  1SQQ G;  4XFJ A;  4BPH A;  2I8D A;  1FZB A;  2ZT9 B;  5CMZ A;  1BGY E;  3DTJ A;  1FZC A;  4HB1 A;  1FAV A;  1DIP A;  2AF8 A;  2KK7 A;  1NTZ K;  2K94 A;  4Y99 C;  4OVN F;  3G28 A;  3DS5 A;  1X79 B;  4OH8 B;  3M0D C;  1Q82 Q;  3L70 J;  2L91 A;  4BXL A;  3SWF A;  2YIU B;  3CCV P;  2FXP A;  4GIF A;  4K3A A;  2C9L Y;  3TNU B;  2HOD A;  1YJW P;  1NTZ E;  2PGD A;  2KGE A;  1N73 B;  3V2R A;  3RG2 A;  1GU4 A;  1ZW0 A;  2GZG A;  5CCG A;  4IFM A;  2IBZ G;  2P10 A;  3EJE A;  2CGQ A;  4GOF A;  1GZL A;  2JYG A;  2KOP A;  1SQB E;  1OVV A;  3GF7 A;  2XU6 A;  4UB6 E;  2M0B A;  2RKL A;  2KB7 P;  3CX5 I;  5APX A;  5KKZ C;  1KIL E;  1EC5 A;  3VMA A;  1XTG B;  3M9H A;  3RL0 B;  5F2K A;  1RF1 A;  3CXC O;  4DCK A;  3HRN A;  2QJP C;  2FQ0 A;  1YQ3 C;  3G1I A;  2XNX A;  2L5G B;  5E79 E;  1ZRT E;  3USS A;  1ZXG A;  2OYH A;  1UNK A;  1NTK K;  5HGO A;  2KLU A;  4GKG A;  4U0A A;  2FYN B;  3AE3 C;  5B5E H;  1GL2 D;  5AVY B;  2WSF J;  4BRY B;  3GG2 A;  1SVF A;  2LXB A;  4R0M A;  4U3F D;  1H88 A;  1JY2 N;  3LW5 J;  4OGQ C;  5BVZ A;  2WTY A;  2ZAE B;  3L73 D;  1T2K D;  1SQV J;  2V4H A;  2NPS D;  1SQP D;  3V2Q A;  1DEB A;  4H13 C;  3CWB G;  2MF4 A;  1QL2 A;  2OTK E;  1KIL A;  3B5N D;  1LJ2 A;  3P8M C;  2GUS A;  2B88 A;  1IJD B;  3S1K A;  1KQS O;  3P05 A;  2WZ7 A;  2IZ0 A;  5KLV D;  2O1J A;  1YHQ P;  3U1C A;  3CCU P;  1L0L D;  1AQ5 A;  2K3R A;  1HF9 A;  1S1C X;  3CX5 H;  1LTJ B;  1NJI Q;  1KOR A;  2KR5 A;  1ZR2 A;  2YKP A;  4YTP C;  4RO0 A;  2ZT9 C;  4XA4 A;  3Q5R A;  2B89 A;  2VLQ A;  1NQ4 A;  4DT0 A;  2FFD A;  3H1J G;  2KIK A;  2W8Z A;  1NH4 A;  2MKV A;  1FDI A;  2KOS A;  2G3A A;  3GKL C;  3F89 A;  1BE3 E;  5GTH H;  3VN0 A;  2V7Q J;  1X22 A;  1NU1 G;  3AE7 C;  1FJP A;  3TGU G;  2QNW A;  4KT0 J;  2NO8 A;  1GMJ A;  3H1K E;  5K5G B;  1ZLL A;  2AVA A;  3V5B A;  1N8R Q;  5F2N A;  2KNC A;  3WUV A;  3AEG C;  2R5B A;  2M5R A;  1R5S A;  3K5B A;  5APV A;  2GDY A;  1M57 D;  1SLQ A;  1GU5 A;  3RL0 C;  1MUU A;  3RK3 E;  3DS4 A;  4W7Y A;  2O01 J;  3IR9 A;  2W6J H;  2WIT A;  3KZI H;  1KMI Z;  3R2P A;  3CCE P;  1FOS E;  1Q7Y Q;  2OYO A;  2Y9Y A;  2FYN C;  3H32 B;  3TDK A;  2KUB A;  1GW3 A;  4B86 A;  4PJ0 H;  1PEM A;  4Z1M H;  3CD6 P;  3B71 A;  1FDM A;  4HYT B;  3CL3 D;  1VQO P;  2AEM A;  2J59 M;  2CG5 B;  1ZRT D;  2N1T D;  3HD7 A;  4L74 A;  3H4E A;  2GZE A;  3V6I A;  1NTM D;  2FQ1 A;  3B5I A;  2Y9Z A;  1BCC G;  3H1I G;  3VMY A;  1NHL A;  2HR3 A;  3FWN A;  4OWF A;  4WY4 A;  4W80 A;  2H43 A;  3BCC E;  3LIE A;  1UIX A;  3WUT A;  1NAF A;  2R3C A;  2JDI H;  3CXH H;  1LTJ C;  4U0F A;  1KYO I;  1GL2 B;  1LWU A;  3SFE C;  1PL5 A;  1UII A;  2ZJS E;  5B5E E;  5KAF H;  4PXH B;  1FE6 A;  4KJM A;  1PPJ G;  3H6P A;  1KFM A;  3VMZ A;  2FVE A;  2PAJ A;  4A7P A;  4QNB A;  4PD4 H;  1KN7 A;  1T3U A;  1N2D C;  2NPS B;  3C8V A;  2ZYD A;  3RL0 g;  4NPD A;  3B5N B;  3QWO C;  3Q2Y A;  1KTM A;  2BCC D;  3L70 G;  1P84 I;  3E2D A;  2MVV A;  1ACP A;  3KYQ A;  2KLV A;  2MY5 A;  2W90 A;  2ONT A;  3D71 A;  1PP9 E;  1L0N K;  3MD0 A;  1SQV D;  2W83 C;  3AE5 C;  1OW7 A;  2K93 A;  3CX5 E;  2CPB A;  1L4A D;  2FYU K;  1HGZ A;  3A0H E;  3V4W A;  2LKI A;  1JY2 O;  5APS A;  1BE3 D;  1LP1 A;  4BWN A;  2LR2 A;  2JU1 A;  2E1M A;  4H2Y C;  3B4S A;  2PEM A;  4UB8 H;  1L0N E;  3NXS A;  4RES B;  2QM7 A;  1W2B O;  3AE2 C;  4QMA A;  2JAZ A;  3DS3 A;  1RE4 A;  1IFP A;  1SQQ K;  3L74 J;  4C7N B;  3MHV A;  5BU5 A;  5GTH E;  1MZ9 A;  5JPA A;  4D6T E;  3CCS P;  1P84 H;  5AW5 B;  3DS1 A;  3WU2 E;  2ZVO B;  1M74 A;  5AW2 B;  5APQ A;  1GD2 E;  1SQV G;  2JQ4 A;  1IK9 A;  2BQ1 E;  2R3S A;  3QH9 A;  2Z44 A; 
#chains in the Genus database with same CATH homology
 4XRQ A;  1QVF O;  2PEJ A;  3DS2 A;  2XT1 A;  3G1G A;  1AUM A;  5HGN A;  1VQK P;  3HYB A;  4GR6 A;  1PEO A;  5F2K A;  3CXC O;  4QNB A;  1K73 Q;  2M8P A;  1VQL P;  1VQP P;  2XV6 A;  3G1I A;  3CPW O;  3CC4 P;  2QA4 P;  1KC8 Q;  1VQ6 P;  3G6E P;  1QVG O;  5BS1 A;  1ZMB A;  1K8A Q;  4PH1 A;  3I55 P;  5HGO A;  1N8R Q;  4U0A A;  5F2N A;  5HGL A;  3E2D A;  2L6E A;  4U0E A;  2KOD A;  4COC A;  5I4T G;  4XFX A;  3CME P;  2BUO A;  2OTL P;  1A43 A;  2PEO A;  3VRL C;  3G29 A;  1BAJ A;  2ONT A;  3NTE A;  3DPH A;  3G26 A;  3H0D A;  3DS4 A;  3OW2 O;  1IUQ A;  4M0I A;  4U0D A;  4U0C A;  1A8O A;  1EIA A;  2M8L A;  1D1D A;  2QEX P;  2JO0 A;  2BHV A;  2Z45 A;  3CCE P;  4PH0 A;  1Q7Y Q;  2PEN A;  1YJN P;  1EOQ A;  1M6N A;  5F2O A;  2PEI A;  3LRY A;  1K30 A;  1E6J P;  2E1M A;  1YIT P;  2EFJ A;  2PEM A;  3G21 A;  3DTJ A;  4XFY A;  1PEM A;  1KQS O;  3CD6 P;  3P05 A;  1RO0 A;  3G0V A;  3CCR P;  4IPY A;  1VQM P;  2CWO A;  1VQN P;  1VQO P;  1PEQ A;  1YHQ P;  4U0B A;  1W2B O;  3CCU P;  1K9M Q;  2M8N A;  5HGM A;  3DS0 A;  3G28 A;  3CCM P;  3CC2 P;  4GR2 A;  3DS5 A;  4XRO A;  3DS3 A;  1Q86 Q;  2JYL A;  1M6E X;  3CCQ P;  3H4E A;  2DGY A;  3Q20 A;  1S72 P;  1NJI Q;  1Q82 Q;  1M1K Q;  1JJ2 O;  5BS2 A;  1YI2 P;  3G71 P;  3B5I A;  4XFZ A;  2EIA A;  3MGE A;  3CCV P;  1QRJ A;  1YIJ P;  2PY8 A;  3H47 A;  3HZQ A;  1RO2 A;  4COP A;  1YJW P;  3M1M A;  1VQ9 P;  1YJ9 P;  3CMA P;  5JPA A;  2Z46 A;  1VQ4 P;  3I56 P;  2PEK A;  3CCS P;  3CC7 P;  1VQ5 P;  1VQ7 P;  4WYM A;  2OTJ P;  2XXM A;  1M90 Q;  2P9X A;  1Q81 Q;  1PEU A;  3DS1 A;  2EG5 A;  1M74 A;  2JYG A;  4U0F A;  1RNI A;  3CCL P;  2OAR A;  3RG6 C;  3CCJ P;  2BQ1 E;  1KD1 Q;  2PEQ A;  2LF4 A;  3WBH A;  5DCK A;  3G4S P;  1VQ8 P;  2Z44 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...