3G71P

Co-crystal structure of bruceantin bound to the large ribosomal subunit
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title U2504 determines the species specificity of the A-site cleft antibiotics: the structures of tiamulin, homoharringtonine, and bruceantin bound to the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 44
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2009-02-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3g71P03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 3g71P01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 3g71P02
3CCMP 3CCVP 1S72P 1VQMP 1YJ9P 3CCEP 3I55P 3CCQP 1QVGO 1M1KQ 3I56P 1W2BO 3CPWO 3CCRP 1Q81Q 1NJIQ 1QVFO 1M90Q 2QA4P 1Q82Q 2OTLP 2QEXP 1YITP 1VQLP 3G71P 3OW2O 1YJNP 3CC4P 1VQ8P 3CMEP 1VQNP 3CD6P 1YJWP 3CMAP 1Q7YQ 1VQKP 1VQ4P 1VQ5P 1YI2P 1KQSO 1VQ7P 2OTJP 1KC8Q 1KD1Q 1K8AQ 1K9MQ 1JJ2O 3CC7P 1VQ6P 3CC2P 1K73Q 3CCUP 1Q86Q 3G4SP 3CXCO 3CCSP 1YIJP 1VQ9P 3CCJP 1YHQP 1VQOP 3CCLP 1N8RQ 1VQPP 3G6EP
chains in the Genus database with same CATH superfamily
3L74J 2NPSA 3H1HG 2HR3A 1N7SC 5KLVG 3O6QB 3H1HJ 2L6EA 2M3EA 4RO0A 1YI2P 1KC8Q 3RG2A 3F5HA 2QJKC 3H1LG 2CWOA 3TGUD 2JU1A 1L0LK 3RK2C 5KJ7C 1PFIA 3C1LA 4H13C 1PEUA 3HUSB 3TNUB 5HGLA 5AVZB 5AW3B 2GDYA 1R5SA 4HYTB 1RO0A 3KQGA 2K94A 1R5LA 2M5RA 1BCCE 3IAOA 3B4SA 1EC5A 2K3RA 2PEIA 4XFJA 4EYYQ 4U3FE 4N78E 2LOLA 2Q3IA 1YQ4C 3T97A 1UIXA 2FYUG 5GTHE 1IO4A 1MKMA 2FYNC 1KILE 4L76A 2GDWA 5BS2A 1NU1D 4GKGA 1X0TA 2KOPA 1L0LE 1AYIA 1EDIA 3RK3E 2QIWA 1KILC 3CI9A 4NPFX 4H2YC 2Q9IA 1IJDB 2GUVA 2Z5HA 1QL1A 3B5NA 3B8EB 5KKZB 3VMAA 1SQVK 3QWOC 1IFJA 4WY4B 3H1KJ 1NTKJ 2RMZA 3RL0g 4I6MC 3WMM0 3HYBA 2QNWA 1KQFB 1RE3C 2AFDA 3EJDA 5AVTB 2Z45A 3AE6C 5EW5E 2MR8A 5KAIH 2H8PD 3QH9A 5DCKA 5APSA 3AEEC 3R4YA 1S5LE 1EMVA 3VRLC 5APVA 1SQPJ 3VP9A 1XTGB 1JM0A 4GOEA 2KORA 3V2RA 2B87A 1S9KE 3L75G 1NGMB 1FZGA 3L75J 1VQ8P 1T8KA 2QJPC 3MD0A 4IPYA 5HGMA 1T6AA 1OVRA 2FQ2A 4I2LC 3B5IA 1FDIA 4R0MA 5M1BA 2V7QJ 5HV8A 2IYOA 4W80A 2DNWA 5APXA 3P32A 3H1ID 1M1JC 3G71P 2OGUA 1L0NK 2BEZF 2AXTE 1GMJA 3ABVC 2ZT9D 2Y9YA 1NTZG 1JB0J 2CK3H 3G0VA 3V6IA 1EZVD 1LJ2A 2LXBA 3L70E 1AVYA 1S5LX 1ZRTE 3RG6C 4GR2A 4K3AA 2KOSA 2KSEA 1GZLA 1LTTC 3CC7P 2BEQD 2YO3A 2GZEA 1UJZA 3A0BE 1YHQP 4H2XC 3Q1MA 1L0NE 2ZXXA 4ZKPA 1LTJA 1KB9H 5E79H 3GHGB 2I1JA 2D2CD 1NKZB 1FZCC 3SFEC 2KGDA 2PEKA 2ZT9C 4IL6H 3OA7A 2YKPA 4DOJA 1BCCJ 2R5DA 2KODA 1VPCA 1KB9I 3MZWB 4U3FJ 3WU2H 2JDIH 2K88A 2IBZG 1U57A 4H44B 1KZUB 4YTPC 1LT9B 2E43A 1IC2A 1USEA 1L0LJ 2ITAA 1DD4A 1W5CE 2W90A 1PP9E 5BU8B 2OYHA 1S2EA 1HJBA 2A06G 2W27A 3HD7D 1LTAC 1CEIA 2ZFCA 2B88A 2DW3A 4OGQD 4M3LA 2D2CC 3CWBE 1RE4C 2M8RA 1PEOA 4AQRD 2JKVA 2WSFJ 5GTIH 1NQ4A 2EFJA 2N98A 3TK1A 2HODA 3EFGA 5H2FE 2ZYGA 4I1LA 4U0EA 1SFCA 2LKMA 2M3BA 1VL2A 2YKQA 1N7SB 5KTBA 1QX8A 1KMIZ 1MFTA 2JYGA 4UB6E 4DT0A 3HE4A 2FY8A 1P84H 5F2KA 3LW5H 3FXDA 2E42A 1M7LA 1FDMA 3HD7C 1SQVG 3VTPC 1HGZA 2FAEA 2P67A 1SQVJ 4OH8B 4OGQC 1PGJA 1HF9A 1P84I 3G3ZA 3NTNA 2IFMA 3CXHH 2GYKA 4WY4D 1GK6A 2POHA 1G2CB 4XFYA 1WRGA 2J5UA 3V5BA 5AW9B 2VLNA 1LP1A 3H6PA 5CBNA 3CXHI 4GOFA 5CMZA 1AA0A 4PV1C 4XA4A 1JY3O 1EDLA 4KJMA 3OAKA 1T2KC 2FYNB 1QVGO 2FYZA 4ASWA 1GW4A 5KLVK 2MKVA 3LIDA 3L74D 3P8CD 4H0LD 1RF0A 3CX5D 3B5NC 1GXHA 1KILB 3H1HD 2K93A 1BDDA 5F2OA 2QJYB 4PH1A 4COPA 1WT6A 5CCHD 2P58A 4WY4C 1GU4A 3EJBA 4DZOA 1ZMBA 5AVWB 1M57D 3G29A 3KZIE 3RK3B 1TU3F 3L70J 2JGPA 5B5EH 3MHVA 4XROA 1OXZA 5AVYB 3DPHA 2ERHA 1DV5A 1KTMA 3P8CE 3IF4A 2PY8A 3OJAB 3H1HE 1L0NJ 3GF3A 5AW1B 5KLVE 3LMOA 1PL5A 2ZYDA 4H0LC 1OVUA 3B71A 3H1JG 1S72P 3H25A 2FYUK 3L35A 4HKGA 3H1JJ 1SQBG 2M8PA 1LNQA 1PIXA 3H1LE 5CCHC 2M5AA 1SVFA 4AYCA 2LIUA 5BVZA 3P8MC 4WWIA 4U0BA 1L0IA 3G1GA 1CI6B 3SWYA 1YYCA 1LTSC 4BPHA 3CCUP 1UIIA 1PPJG 4UHPB 5HGOA 5I4TG 2ZVNB 4C46A 3CCMP 1KQGB 1PP9J 1HGVA 1G1IA 3M9HA 2KYVA 2QJPB 2WWWA 1OZHA 3A0HE 2M8LA 3H1KD 3CWBG 1NTKD 2FYUE 3MTUE 2E75C 2A45H 1X8YA 3CWBJ 1ZV8A 1MZ8A 3EFFK 1N8RQ 4W7ZA 2CQ8A 2HG5D 3CCVP 1PEMA 3GMAA 1M1JB 3I55P 4AUWA 1AJYA 2YMKA 4BWNA 2H7HA 1T8ZA 3C8VA 3LIEA 2A45I 1E5WA 1N73B 4IFFA 2KSJA 2OYIB 2K0XA 3M1MA 1PV3A 3Q3DA 2LMLA 2L22A 4H44D 5HGNA 2CG5B 4BPFA 1SQPD 3JCUH 3AE7C 1HH0A 2XU6A 1U7JA 3NTEA 1RF1A 2I1KA 1LTJC 3VMZA 3L75D 1H0TA 1K05A 1RQUA 1URQA 2RH0A 4LGDE 2AEJA 1IFIA 1M56D 1MUUA 1FZCB 4PD4D 1KV4A 3Q5SA 1E6JP 4U0FA 2LTEA 5AVXB 1L0HA 2R5BA 4H44C 4C7NA 2ZVOB 1N7SD 3L75E 3BCCG 5TISE 3AEAC 4L75A 3BASA 1BXIA 1NTZK 3U1CA 2OYHC 2EHSA 1RH5B 5KAFH 2Z46A 3A2AA 3II6A 1JCCA 1HBWA 1NVOA 1W2BO 2WSEJ 2KLVA 1Y9BA 1N86A 3M0DC 3CMEP 5B66E 2KI7B 2XXMA 4OWFA 4R4LA 3CE7A 3WBHA 5AVRB 1CW5A 4F37A 1GU5A 3CCJP 1T3UA 1P84E 3FX0A 2WZ7A 1E0HA 2MD9A 2JJLA 5AW7B 1SFCC 2IPPA 2NPSB 3VN0A 1NWQA 4GIFA 5KLVJ 1H88A 1NTZE 3AE8C 3CXHE 3E1RA 2MY5A 2H88C 3DS1A 1BCCD 5APUA 4ASVA 4U3FD 4N78D 1VKUA 1OMIA 3H1LJ 3HD7B 1N7LA 3M06A 4IFMA 1GK4A 1DEBA 4XE5B 1KILD 5APTA 2CPBA 2XDJA 1LTBC 4OGQB 5APYA 3OW2O 2IBZD 1VQNP 1L0LD 4BXLA 3KHUA 1GL2A 2V4HA 3AEBC 2KLUA 3RK3D 3NY7B 1DD3A 1Q86Q 4PJ0H 1KN7A 2A06D 4WB4A 2N1TD 3T97B 1M90Q 3BATA 2Q7CA 2BCCG 2FYUJ 4PV1B 2BCCJ 2IBZE 2MVVA 2FBWC 4EOTA 1HUCA 4LC1A 1RF0C 1VHNA 1FC2C 2QJYC 2N9BA 3VMYA 2K1AA 2A06E 3B5NB 3FGAD 5KP6B 3SWKA 5CCGA 1GXGA 3RK3C 2E76C 4GODA 1LWUC 2FQ0A 2P9XA 5DJUB 4IFDK 4L74A 4YPCA 2N1TC 2SPZA 1SQVD 4ZMDA 2LXCB 2WMMA 3H32A 1S9KD 1YJ9P 3CPWO 2B89A 3CMAP 2CPSA 3NFQA 1QRJA 3KDPB 2YXRB 4H0LB 2G3AA 3CC2P 2QM7A 1SQVE 3PTZA 2Y0CA 2MR7A 3IR9A 4KHXA 2KZJA 1BE3G 2JQ4A 4Y28J 4EI2A 2B87B 1BE3J 4PH0A 1FE6A 1MV8A 2K0YA 1OR5A 1HJ0A 2WTYA 2K5XA 2N6ZA 4CPGA 3CX5H 3E7KA 1IZNB 2E1MA 1M1KQ 2H43A 2GDXA 1UNKA 2FKWB 3L70D 2PRRA 1FOSE 1ZRTD 1OW6A 2WPTA 2E75B 1DH3A 5AW2B 3JSVC 4ZKUA 3FXEA 1N73C 3L73E 5K5GB 2OYIC 1YIJP 4DG9A 1L0ND 3PLNA 2BASA 2KXPB 1FS0E 1IFNA 1NTZJ 1SQBK 2QE7H 5KP8B 1OIPA 2P7JA 1BDCA 2CNRA 3H1JD 1YJWP 1VQ4P 4JPZB 1AVOA 2FXOA 1K73Q 4UB8E 3IN6A 4COCA 1BSHA 4L73A 1ZNVA 1X3OA 1LTJB 1URQC 4Z1MH 1PPJD 1PP9D 3SWFA 1GPJA 3H1JE 4H2WC 2VLQA 1SQBE 1FJPA 2NPSD 1IK7A 4HJGH 3CWBD 3V2QA 1KYOE 3L4FA 4HB1A 3S4RA 1PPJE 1Q90D 3CC4P 2L91A 1KQSO 3TSIA 2OYHB 2FQ1A 2FVEA 3JC22 1LT9A 3AE3C 2GZJA 3MGNA 2K2QA 2L9FA 1GDTA 1FJKA 1VQPP 2PEQA 1PEQA 2VRSA 4JF7A 1J1DC 1K04A 2JAZA 2NPSC 4IZ6A 2PFXA 5CJ0A 2E74D 1PGQA 2IFNA 2HODB 1QLED 2C9NY 1NU1G 1SFCB 2YXQB 3EQ2A 5KLIC 2PENA 4PV1D 2AXCA 3SSUA 1EXJA 1SQQK 2HPCA 3HE4B 1JTHA 3G21A 3KPEA 1T2KD 4PD4H 4BPGA 1OFCX 1OWAA 4QKOA 1AV1A 2J59M 2VSQA 1L4AA 3S9OA 3B5ND 2WT7A 1SQXK 2A45G 3G6EP 1GL2C 3VP8A 1CZQA 2JU2A 2WITA 2CGQA 5CBOA 3F89A 2G8YA 2W8ZA 3AE1C 3CL3D 2E74C 1LP1B 4HKZH 5KJ7A 4LLHA 2PEMA 2QM8A 2K0DX 3AEGC 2XT1A 2QSIA 2P1JA 4RKUJ 3S1KA 3DS5A 4B86A 3BCCE 2YNYA 3L73G 3L73J 1SQXE 1VQKP 2ONTA 3HE5A 3BVHA 2K92A 3RL0D 2KWLA 5KLVD 5KAIE 1MFZA 3PJSK 4JYBA 2KGAA 4GR6A 3AE4C 2PAJA 3AEFC 4BRYA 2E76B 2FADA 1LWUB 1ZOYC 3H1LD 1ZP0C 3L72G 5GTHH 4I7ZC 2N1TB 3USSA 1ACPA 2OARA 3O8ZA 4W7YA 3L72J 1ZR2A 2KS1A 2LL8A 1FZAA 3H1IG 3N4XA 2E75D 3U43A 1DNYA 2W6JH 2AVAA 1RE3A 3RL0C 1G1JA 1Z6MA 3CD6P 1JMMA 1SQBJ 2M0BA 2M5AB 2AEFA 1T3JA 2Z4EA 3VMXA 2FYUD 2Q6QA 2BCCD 2XZ0D 2GM4A 2WSFH 5TJHA 3MIWA 3RBXA 2XNDH 2XZRA 2L4BA 3WUUA 3CLQA 1JEKA 2WPSA 3DS3A 2YO2A 1DIPA 5F2NA 5APQA 2R44A 4DCKA 1KB9D 1S5LH 2WSCH 2BCCE 1VDFA 3A7OA 3ITKA 3Q5PA 3A3YB 2GA1A 3CCRP 4OVNF 4IOIH 2FVFA 1JCDA 3GJNA 2NRGA 2E5TA 3PP5A 2GZGA 1EIAA 1NHLA 5AVVB 1EOQA 3GLMA 3EJEA 1KB9E 5E79E 2AF8A 3HTKB 2K9JA 3AE9C 3GKLC 1FZEA 1QEXA 2HYNA 4XFXA 3BRVB 2KK7A 4IL6E 2PEOA 1AQTA 4WYMA 1RF1B 1AUMA 2KP8A 2ZYAA 1VQ5P 1HTLC 1NAYA 2KGCA 1BE3D 3WU2E 1J1EB 2AXTH 1GD2E 1H0TB 1IMQA 1PGOA 4WBAA 1URQB 2L0QA 3L71G 2OYOA 1VQMP 3L71J 4EIJA 1X9VA 2AEMA 4D6TG 1SQQG 1YITP 2C0XA 4D6TJ 1SQQJ 1JMBA 2RKLA 1NOHA 4C7NB 3GZLA 1MZ9A 1SFCD 1DX7A 1BE3E 2C9LY 2OTKE 4U0CA 2KG9A 1OW8A 1RNIA 1P84D 3BCCJ 2KB7P 3EWKA 4R4MA 1SQXG 2ROQA 2O01H 2WPRA 3A0BH 4XRQA 5GTIE 2FFDA 1SQXJ 1M6EX 4A7PA 5AW8B 1NTZD 1Z56A 3CXHD 1NYHA 2KW2A 2KNCA 1L4AD 3P7KA 1VF5C 3N7NA 2ZAEB 3SFDC 2VLPA 2FXMA 3D70A 1J1DB 4IL6X 3CCQP 2I8DA 1EZVI 4WVZA 1FU1A 2XKMA 2OTLP 2DGYA 3H4EA 2P10A 2GZFA 2UWJE 3VOPA 4N6JA 1NKNA 3TF5A 5AVUB 2XV6A 1EDKA 5KLIB 3L74G 1RO2A 3TYYA 5EJDA 2Y0DA 1ZXGA 3O6QA 3G9RA 1A02F 3NMDA 2L5GB 1L4AC 2QEXP 5AW5B 2W6BA 3PH0A 1LTIC 1NO4A 2C0WA 3V4WA 3MUDA 1GL2B 2E76D 2KUBA 3HD7A 5H2FH 2KOOA 2N50A 2FHSC 3I56P 2E74B 4UB6H 2M8NA 3HUSA 3TNUA 4YXWH 1KFMA 4EDFA 3AE2C 2OTJP 1H89A 3AECC 1JJ2O 3WUTA 4ZNCA 1J2JB 5B5EE 1NU1K 3TGUE 2LKIA 1JY3N 2PNGA 2WPQA 3PHLA 2IYPA 2EHTA 1K30A 4U0DA 1KORA 1KD1Q 1YBKA 1D1DA 3P05A 2EG5A 1AFOA 3GG2A 1QL2A 3L37A 2W83C 3H32B 3Q2YA 2HFED 1IK9A 1BGYG 3H1KG 1NTMG 4I7ZB 1NTKG 4WY4A 1BGYJ 1NTMJ 1D7MA 1NU1E 3D6ZA 2KR5A 1DEEG 3B4QA 2LF4A 2BQ1E 2WSEH 5AW0B 5KP7B 4MN4C 1X22A 4RJTA 1EXIA 2YKOA 3RL0B 3E1IA 1JNMA 3KZIH 1S1CX 1VQLP 2W6AA 2JWAA 2Q5UA 3AEDC 3DS0A 1SQPG 3MP7B 1JY3P 2KOGA 1ZW0A 3L73D 5CCHA 4JYCA 3V2PA 2KGEA 4C7RA 2RN0A 4QNBA 3L36A 3D6YA 2Q1KA 3CX5I 4NPDA 1URQD 5BS1A 2MJZA 2X2BA 3LW5J 3L72D 3JCUE 3GW6A 2JB0A 2J58A 5CJ4A 1SP4A 4RESB 2QA4P 1YJNP 4Y99C 3GZMA 1OX3A 3A0HH 2FACA 1SQBD 4U7JA 1E79H 2PEJA 1RF1C 2LIWA 1PGPA 3L72E 1VQOP 1J1EC 1OVVA 1KYOD 2EIAA 3U1AA 1IUQA 3H1IE 4PXHB 2BUOA 3KXDA 4CA3A 3W67A 5KAFE 3CCSP 3GHGA 3D71A 2QRXA 1EZVE 2KG6A 1BCCG 2MVUA 2K37A 3G26A 1RY3A 7CEIA 3TGUG 1ZR4A 2N9YB 4U3FG 3V4QA 1JY2N 3TGUJ 2FFDC 1R8EA 3LRYA 3CXCO 3HZQA 2O01N 2N6YA 1HWTC 2YIUB 2JBGA 1L0LG 2MF4A 4TLFA 1RHZB 1FBMA 2WQYC 1NH4A 1YQ3C 3H47A 1LTGC 5AW4B 3RGUA 1GL2D 4KT0J 1VF5B 2R3SA 4QMAA 1XTCC 2QVAA 4N3YB 1ZLLA 1ZMEC 1VQ9P 3M0DA 5TISH 1FAVA 1YTZI 1Y47A 3CCEP 2R32A 1NU1J 3DS4A 2WSSH 1FDOA 3L71D 1FR2A 3BRTB 2HPCB 1JTHB 3M91A 1M6NA 2GZIA 4PJ0E 2V7QH 5B66H 1K9MQ 4D6TD 1SQQD 1GTWA 1N7SA 2IDBA 3FWNA 2JEEA 1L2PA 1JY2P 4PD4I 1L4AB 2WT7B 3MUDC 3PRJA 5CCGD 3BCCD 2WSCJ 3GF7A 2QJKB 1SQXD 3M9BA 3L71E 2KZIA 1A43A 1IFMA 2YMYA 3RK2B 1M74A 1N2DC 3HUSC 1FZBA 2HLOA 4D6TE 1SQQE 2BHVA 4O9BA 1IFPA 1G2CA 4H13B 1M8OB 1NAFA 5BU5A 4M0IA 5APWA 3K5BA 1AF8A 3M0AA 3A5TA 1VQ7P 2Z44A 3HE5B 2QG4A 5CCGC 2XNXA 2B9BA 2WVRA 1GW3A 1HVVA 2XV5A 2VLOA 3M9QA 3RBZA 1F80D 4BRYB 2IZ1A 2O1KA 1BSNA 1KILA 3DTJA 5KKZC 1SLQA 3VYIA 1A02J 3L70G 1LGHB 2ZXEB 2KS1B 1LT1A 1LWUA 2OQQA 3H1IJ 1USDA 1QVFO 2FXPA 2N1TA 2N5IA 2AFEA 1Q82Q 2IBZI 3L74E 3TDKA 3KYQA 1L0NG 4JBZA 1IFDA 2O01J 3CX5E 1H8AA 4GT1A 1S4XA 1KLPA 1EZVG 3G4SP 3MGEA 4YXDC 5C39A 2ZJSE 1KFNA 1BAJA 2Q3EA 1S3JA 2FVAA 1CI6A 2KG8A 3R2PA 2IX7C 5L8RJ 1JO5A 1K8AQ 2P2UA 5DJTB 3ZDMA 1PP9G 2E5YA 1CSBA 4K35A 2Y0EA 3AE5C 3WUVA 1JOCA 3W68A 1NTMK 1NTKK 1IMPA 4DJGA 3V2NA 5HVCA 2LPKA 1BGYD 1NTMD 3E2DA 2NZ2A 1WMKA 1HQBA 1A8OA 2PGDA 2JWDA 4GDOA 2JP3A 3Q5RA 5CZDB 1M1JA 2O3JA 2R3CA 2K9JB 4Y99B 1Q81Q 1N73A 2IZ0A 1HY8A 2O1JA 2OYIA 2H89C 2N5HA 1KQLA 1W2EA 2K9YA 1SQPK 1BGYE 3H1KE 1NTME 1SS1A 1NTKE 3HTKA 2JYLA 5EFWB 1OW7A 1VF5D 2GUSA 1YTZT 2JO1A 1RQVA 1U7MA 2WPVB 4MRTC 1EDJA 3GHGC 2XZ1C 4U0AA 2KOQA 1Q2NA 5JPAA 2JO0A 3UIAA 4NEOA 3I5CA 4XFZA 1FZCA 4UB8H 5AW6B 1SQPE 5AVSB 1QGKB 2ZT9B 3NXSA 1X79B 1JY2O 1NJIQ 2KIKA 1EQ7A 3DS2A 1LT9C 3Q20A 2YIUC 2FFDB 3U59A 1JUNA 1Q7YQ 2LR2A 3C9IA 2Y9ZA 4NPEA 1ZN5A 1VQ6P 2Z5IA 2KNCB 5AVQB 3IFMA 3G28A 4TT3H 1PZQA 1FZFA 2JR8A 4HH2A 3FWLA 4PD4E 2PP6A 1KYOH 3RK2D 4JQ0D 1FOSF 5KJ7D 5CHXA 3H0DA 2D2CB 1AQ5A 4H13D 3G1IA 1RE4A 2NO8A 1Y8AA 4PWVB 3HRNA 1KYOI 3CCLP
chains in the Genus database with same CATH topology
3CCMP 1VQMP 2PENA 3I56P 4XFYA 1W2BO 1Q81Q 2M8NA 3H47A 3G21A 4QNBA 5DCKA 1YITP 2L6EA 2PEKA 3DTJA 3CMEP 3CD6P 1YJWP 2P9XA 1VQ4P 2XXMA 2M8LA 1YI2P 5BS1A 3VRLC 2OTJP 1KC8Q 2KODA 3WBHA 1JJ2O 2JYLA 1K73Q 4U0CA 1VQ9P 2CWOA 3CCJP 1RNIA 4COCA 1N8RQ 3G6EP 3CCVP 1PEMA 1YJ9P 3CCEP 3I55P 1QVGO 4XRQA 3CPWO 3DS4A 1QVFO 1M6EX 2QA4P 1Q82Q 3DS3A 1YJNP 1VQ8P 1K30A 1PEUA 3CMAP 4U0AA 4U0DA 1M6NA 5HGLA 5F2NA 3M1MA 5F2OA 5JPAA 1QRJA 1RO0A 4IPYA 2PEMA 4PH1A 4COPA 2JO0A 1KD1Q 1K9MQ 1D1DA 3P05A 5HGMA 3DS1A 3CC2P 5HGNA 2PEJA 3G4SP 2XT1A 2EG5A 3MGEA 1ZMBA 1VQOP 3B5IA 4XFZA 2PEIA 3G29A 1BAJA 3CCQP 3DS5A 3CCRP 1NJIQ 1PEOA 2EIAA 3NTEA 4XROA 2OTLP 3DS2A 3Q20A 4PH0A 2DGYA 1IUQA 3G71P 5BS2A 3DPHA 3OW2O 3CC4P 1VQNP 3H4EA 1Q7YQ 1VQKP 2ONTA 2BUOA 2PY8A 1A43A 1KQSO 2EFJA 1EIAA 2LF4A 2BQ1E 1K8AQ 1EOQA 1M74A 1VQ6P 2XV6A 4U0EA 1Q86Q 3CCSP 2BHVA 1RO2A 3G28A 2E1MA 1VQPP 2JYGA 1S72P 2PEQA 4GR6A 3G0VA 1M1KQ 1PEQA 4XFXA 1E6JP 4U0FA 1M90Q 2PEOA 5F2KA 2M8PA 4M0IA 2QEXP 1VQLP 3G26A 4WYMA 1AUMA 2OARA 3RG6C 3DS0A 1VQ5P 4GR2A 4U0BA 3E2DA 3HYBA 3G1GA 1VQ7P 3H0DA 2Z44A 3CC7P 3G1IA 1A8OA 3CCUP 3LRYA 3CXCO 2Z45A 3HZQA 1YIJP 5HGOA 1YHQP 5I4TG 3CCLP 2Z46A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCM P;  3CCV P;  1S72 P;  1VQM P;  1YJ9 P;  3CCE P;  3I55 P;  3CCQ P;  1QVG O;  1M1K Q;  3I56 P;  1W2B O;  3CPW O;  3CCR P;  1Q81 Q;  1NJI Q;  1QVF O;  1M90 Q;  2QA4 P;  1Q82 Q;  2OTL P;  2QEX P;  1YIT P;  1VQL P;  3G71 P;  3OW2 O;  1YJN P;  3CC4 P;  1VQ8 P;  3CME P;  1VQN P;  3CD6 P;  1YJW P;  3CMA P;  1Q7Y Q;  1VQK P;  1VQ4 P;  1VQ5 P;  1YI2 P;  1KQS O;  1VQ7 P;  2OTJ P;  1KC8 Q;  1KD1 Q;  1K8A Q;  1K9M Q;  1JJ2 O;  3CC7 P;  1VQ6 P;  3CC2 P;  1K73 Q;  3CCU P;  1Q86 Q;  3G4S P;  3CXC O;  3CCS P;  1YIJ P;  1VQ9 P;  3CCJ P;  1YHQ P;  1VQO P;  3CCL P;  1N8R Q;  1VQP P;  3G6E P; 
#chains in the Genus database with same CATH topology
 3L74 J;  2NPS A;  3H1H G;  2HR3 A;  1N7S C;  5KLV G;  3O6Q B;  3H1H J;  2L6E A;  2M3E A;  4RO0 A;  1YI2 P;  1KC8 Q;  3RG2 A;  3F5H A;  2QJK C;  3H1L G;  2CWO A;  3TGU D;  2JU1 A;  1L0L K;  3RK2 C;  5KJ7 C;  1PFI A;  3C1L A;  4H13 C;  1PEU A;  3HUS B;  3TNU B;  5HGL A;  5AVZ B;  5AW3 B;  2GDY A;  1R5S A;  4HYT B;  1RO0 A;  3KQG A;  2K94 A;  1R5L A;  2M5R A;  1BCC E;  3IAO A;  3B4S A;  1EC5 A;  2K3R A;  2PEI A;  4XFJ A;  4EYY Q;  4U3F E;  4N78 E;  2LOL A;  2Q3I A;  1YQ4 C;  3T97 A;  1UIX A;  2FYU G;  5GTH E;  1IO4 A;  1MKM A;  2FYN C;  1KIL E;  4L76 A;  2GDW A;  5BS2 A;  1NU1 D;  4GKG A;  1X0T A;  2KOP A;  1L0L E;  1AYI A;  1EDI A;  3RK3 E;  2QIW A;  1KIL C;  3CI9 A;  4NPF X;  4H2Y C;  2Q9I A;  1IJD B;  2GUV A;  2Z5H A;  1QL1 A;  3B5N A;  3B8E B;  5KKZ B;  3VMA A;  1SQV K;  3QWO C;  1IFJ A;  4WY4 B;  3H1K J;  1NTK J;  2RMZ A;  3RL0 g;  4I6M C;  3WMM 0;  3HYB A;  2QNW A;  1KQF B;  1RE3 C;  2AFD A;  3EJD A;  5AVT B;  2Z45 A;  3AE6 C;  5EW5 E;  2MR8 A;  5KAI H;  2H8P D;  3QH9 A;  5DCK A;  5APS A;  3AEE C;  3R4Y A;  1S5L E;  1EMV A;  3VRL C;  5APV A;  1SQP J;  3VP9 A;  1XTG B;  1JM0 A;  4GOE A;  2KOR A;  3V2R A;  2B87 A;  1S9K E;  3L75 G;  1NGM B;  1FZG A;  3L75 J;  1VQ8 P;  1T8K A;  2QJP C;  3MD0 A;  4IPY A;  5HGM A;  1T6A A;  1OVR A;  2FQ2 A;  4I2L C;  3B5I A;  1FDI A;  4R0M A;  5M1B A;  2V7Q J;  5HV8 A;  2IYO A;  4W80 A;  2DNW A;  5APX A;  3P32 A;  3H1I D;  1M1J C;  3G71 P;  2OGU A;  1L0N K;  2BEZ F;  2AXT E;  1GMJ A;  3ABV C;  2ZT9 D;  2Y9Y A;  1NTZ G;  1JB0 J;  2CK3 H;  3G0V A;  3V6I A;  1EZV D;  1LJ2 A;  2LXB A;  3L70 E;  1AVY A;  1S5L X;  1ZRT E;  3RG6 C;  4GR2 A;  4K3A A;  2KOS A;  2KSE A;  1GZL A;  1LTT C;  3CC7 P;  2BEQ D;  2YO3 A;  2GZE A;  1UJZ A;  3A0B E;  1YHQ P;  4H2X C;  3Q1M A;  1L0N E;  2ZXX A;  4ZKP A;  1LTJ A;  1KB9 H;  5E79 H;  3GHG B;  2I1J A;  2D2C D;  1NKZ B;  1FZC C;  3SFE C;  2KGD A;  2PEK A;  2ZT9 C;  4IL6 H;  3OA7 A;  2YKP A;  4DOJ A;  1BCC J;  2R5D A;  2KOD A;  1VPC A;  1KB9 I;  3MZW B;  4U3F J;  3WU2 H;  2JDI H;  2K88 A;  2IBZ G;  1U57 A;  4H44 B;  1KZU B;  4YTP C;  1LT9 B;  2E43 A;  1IC2 A;  1USE A;  1L0L J;  2ITA A;  1DD4 A;  1W5C E;  2W90 A;  1PP9 E;  5BU8 B;  2OYH A;  1S2E A;  1HJB A;  2A06 G;  2W27 A;  3HD7 D;  1LTA C;  1CEI A;  2ZFC A;  2B88 A;  2DW3 A;  4OGQ D;  4M3L A;  2D2C C;  3CWB E;  1RE4 C;  2M8R A;  1PEO A;  4AQR D;  2JKV A;  2WSF J;  5GTI H;  1NQ4 A;  2EFJ A;  2N98 A;  3TK1 A;  2HOD A;  3EFG A;  5H2F E;  2ZYG A;  4I1L A;  4U0E A;  1SFC A;  2LKM A;  2M3B A;  1VL2 A;  2YKQ A;  1N7S B;  5KTB A;  1QX8 A;  1KMI Z;  1MFT A;  2JYG A;  4UB6 E;  4DT0 A;  3HE4 A;  2FY8 A;  1P84 H;  5F2K A;  3LW5 H;  3FXD A;  2E42 A;  1M7L A;  1FDM A;  3HD7 C;  1SQV G;  3VTP C;  1HGZ A;  2FAE A;  2P67 A;  1SQV J;  4OH8 B;  4OGQ C;  1PGJ A;  1HF9 A;  1P84 I;  3G3Z A;  3NTN A;  2IFM A;  3CXH H;  2GYK A;  4WY4 D;  1GK6 A;  2POH A;  1G2C B;  4XFY A;  1WRG A;  2J5U A;  3V5B A;  5AW9 B;  2VLN A;  1LP1 A;  3H6P A;  5CBN A;  3CXH I;  4GOF A;  5CMZ A;  1AA0 A;  4PV1 C;  4XA4 A;  1JY3 O;  1EDL A;  4KJM A;  3OAK A;  1T2K C;  2FYN B;  1QVG O;  2FYZ A;  4ASW A;  1GW4 A;  5KLV K;  2MKV A;  3LID A;  3L74 D;  3P8C D;  4H0L D;  1RF0 A;  3CX5 D;  3B5N C;  1GXH A;  1KIL B;  3H1H D;  2K93 A;  1BDD A;  5F2O A;  2QJY B;  4PH1 A;  4COP A;  1WT6 A;  5CCH D;  2P58 A;  4WY4 C;  1GU4 A;  3EJB A;  4DZO A;  1ZMB A;  5AVW B;  1M57 D;  3G29 A;  3KZI E;  3RK3 B;  1TU3 F;  3L70 J;  2JGP A;  5B5E H;  3MHV A;  4XRO A;  1OXZ A;  5AVY B;  3DPH A;  2ERH A;  1DV5 A;  1KTM A;  3P8C E;  3IF4 A;  2PY8 A;  3OJA B;  3H1H E;  1L0N J;  3GF3 A;  5AW1 B;  5KLV E;  3LMO A;  1PL5 A;  2ZYD A;  4H0L C;  1OVU A;  3B71 A;  3H1J G;  1S72 P;  3H25 A;  2FYU K;  3L35 A;  4HKG A;  3H1J J;  1SQB G;  2M8P A;  1LNQ A;  1PIX A;  3H1L E;  5CCH C;  2M5A A;  1SVF A;  4AYC A;  2LIU A;  5BVZ A;  3P8M C;  4WWI A;  4U0B A;  1L0I A;  3G1G A;  1CI6 B;  3SWY A;  1YYC A;  1LTS C;  4BPH A;  3CCU P;  1UII A;  1PPJ G;  4UHP B;  5HGO A;  5I4T G;  2ZVN B;  4C46 A;  3CCM P;  1KQG B;  1PP9 J;  1HGV A;  1G1I A;  3M9H A;  2KYV A;  2QJP B;  2WWW A;  1OZH A;  3A0H E;  2M8L A;  3H1K D;  3CWB G;  1NTK D;  2FYU E;  3MTU E;  2E75 C;  2A45 H;  1X8Y A;  3CWB J;  1ZV8 A;  1MZ8 A;  3EFF K;  1N8R Q;  4W7Z A;  2CQ8 A;  2HG5 D;  3CCV P;  1PEM A;  3GMA A;  1M1J B;  3I55 P;  4AUW A;  1AJY A;  2YMK A;  4BWN A;  2H7H A;  1T8Z A;  3C8V A;  3LIE A;  2A45 I;  1E5W A;  1N73 B;  4IFF A;  2KSJ A;  2OYI B;  2K0X A;  3M1M A;  1PV3 A;  3Q3D A;  2LML A;  2L22 A;  4H44 D;  5HGN A;  2CG5 B;  4BPF A;  1SQP D;  3JCU H;  3AE7 C;  1HH0 A;  2XU6 A;  1U7J A;  3NTE A;  1RF1 A;  2I1K A;  1LTJ C;  3VMZ A;  3L75 D;  1H0T A;  1K05 A;  1RQU A;  1URQ A;  2RH0 A;  4LGD E;  2AEJ A;  1IFI A;  1M56 D;  1MUU A;  1FZC B;  4PD4 D;  1KV4 A;  3Q5S A;  1E6J P;  4U0F A;  2LTE A;  5AVX B;  1L0H A;  2R5B A;  4H44 C;  4C7N A;  2ZVO B;  1N7S D;  3L75 E;  3BCC G;  5TIS E;  3AEA C;  4L75 A;  3BAS A;  1BXI A;  1NTZ K;  3U1C A;  2OYH C;  2EHS A;  1RH5 B;  5KAF H;  2Z46 A;  3A2A A;  3II6 A;  1JCC A;  1HBW A;  1NVO A;  1W2B O;  2WSE J;  2KLV A;  1Y9B A;  1N86 A;  3M0D C;  3CME P;  5B66 E;  2KI7 B;  2XXM A;  4OWF A;  4R4L A;  3CE7 A;  3WBH A;  5AVR B;  1CW5 A;  4F37 A;  1GU5 A;  3CCJ P;  1T3U A;  1P84 E;  3FX0 A;  2WZ7 A;  1E0H A;  2MD9 A;  2JJL A;  5AW7 B;  1SFC C;  2IPP A;  2NPS B;  3VN0 A;  1NWQ A;  4GIF A;  5KLV J;  1H88 A;  1NTZ E;  3AE8 C;  3CXH E;  3E1R A;  2MY5 A;  2H88 C;  3DS1 A;  1BCC D;  5APU A;  4ASV A;  4U3F D;  4N78 D;  1VKU A;  1OMI A;  3H1L J;  3HD7 B;  1N7L A;  3M06 A;  4IFM A;  1GK4 A;  1DEB A;  4XE5 B;  1KIL D;  5APT A;  2CPB A;  2XDJ A;  1LTB C;  4OGQ B;  5APY A;  3OW2 O;  2IBZ D;  1VQN P;  1L0L D;  4BXL A;  3KHU A;  1GL2 A;  2V4H A;  3AEB C;  2KLU A;  3RK3 D;  3NY7 B;  1DD3 A;  1Q86 Q;  4PJ0 H;  1KN7 A;  2A06 D;  4WB4 A;  2N1T D;  3T97 B;  1M90 Q;  3BAT A;  2Q7C A;  2BCC G;  2FYU J;  4PV1 B;  2BCC J;  2IBZ E;  2MVV A;  2FBW C;  4EOT A;  1HUC A;  4LC1 A;  1RF0 C;  1VHN A;  1FC2 C;  2QJY C;  2N9B A;  3VMY A;  2K1A A;  2A06 E;  3B5N B;  3FGA D;  5KP6 B;  3SWK A;  5CCG A;  1GXG A;  3RK3 C;  2E76 C;  4GOD A;  1LWU C;  2FQ0 A;  2P9X A;  5DJU B;  4IFD K;  4L74 A;  4YPC A;  2N1T C;  2SPZ A;  1SQV D;  4ZMD A;  2LXC B;  2WMM A;  3H32 A;  1S9K D;  1YJ9 P;  3CPW O;  2B89 A;  3CMA P;  2CPS A;  3NFQ A;  1QRJ A;  3KDP B;  2YXR B;  4H0L B;  2G3A A;  3CC2 P;  2QM7 A;  1SQV E;  3PTZ A;  2Y0C A;  2MR7 A;  3IR9 A;  4KHX A;  2KZJ A;  1BE3 G;  2JQ4 A;  4Y28 J;  4EI2 A;  2B87 B;  1BE3 J;  4PH0 A;  1FE6 A;  1MV8 A;  2K0Y A;  1OR5 A;  1HJ0 A;  2WTY A;  2K5X A;  2N6Z A;  4CPG A;  3CX5 H;  3E7K A;  1IZN B;  2E1M A;  1M1K Q;  2H43 A;  2GDX A;  1UNK A;  2FKW B;  3L70 D;  2PRR A;  1FOS E;  1ZRT D;  1OW6 A;  2WPT A;  2E75 B;  1DH3 A;  5AW2 B;  3JSV C;  4ZKU A;  3FXE A;  1N73 C;  3L73 E;  5K5G B;  2OYI C;  1YIJ P;  4DG9 A;  1L0N D;  3PLN A;  2BAS A;  2KXP B;  1FS0 E;  1IFN A;  1NTZ J;  1SQB K;  2QE7 H;  5KP8 B;  1OIP A;  2P7J A;  1BDC A;  2CNR A;  3H1J D;  1YJW P;  1VQ4 P;  4JPZ B;  1AVO A;  2FXO A;  1K73 Q;  4UB8 E;  3IN6 A;  4COC A;  1BSH A;  4L73 A;  1ZNV A;  1X3O A;  1LTJ B;  1URQ C;  4Z1M H;  1PPJ D;  1PP9 D;  3SWF A;  1GPJ A;  3H1J E;  4H2W C;  2VLQ A;  1SQB E;  1FJP A;  2NPS D;  1IK7 A;  4HJG H;  3CWB D;  3V2Q A;  1KYO E;  3L4F A;  4HB1 A;  3S4R A;  1PPJ E;  1Q90 D;  3CC4 P;  2L91 A;  1KQS O;  3TSI A;  2OYH B;  2FQ1 A;  2FVE A;  3JC2 2;  1LT9 A;  3AE3 C;  2GZJ A;  3MGN A;  2K2Q A;  2L9F A;  1GDT A;  1FJK A;  1VQP P;  2PEQ A;  1PEQ A;  2VRS A;  4JF7 A;  1J1D C;  1K04 A;  2JAZ A;  2NPS C;  4IZ6 A;  2PFX A;  5CJ0 A;  2E74 D;  1PGQ A;  2IFN A;  2HOD B;  1QLE D;  2C9N Y;  1NU1 G;  1SFC B;  2YXQ B;  3EQ2 A;  5KLI C;  2PEN A;  4PV1 D;  2AXC A;  3SSU A;  1EXJ A;  1SQQ K;  2HPC A;  3HE4 B;  1JTH A;  3G21 A;  3KPE A;  1T2K D;  4PD4 H;  4BPG A;  1OFC X;  1OWA A;  4QKO A;  1AV1 A;  2J59 M;  2VSQ A;  1L4A A;  3S9O A;  3B5N D;  2WT7 A;  1SQX K;  2A45 G;  3G6E P;  1GL2 C;  3VP8 A;  1CZQ A;  2JU2 A;  2WIT A;  2CGQ A;  5CBO A;  3F89 A;  2G8Y A;  2W8Z A;  3AE1 C;  3CL3 D;  2E74 C;  1LP1 B;  4HKZ H;  5KJ7 A;  4LLH A;  2PEM A;  2QM8 A;  2K0D X;  3AEG C;  2XT1 A;  2QSI A;  2P1J A;  4RKU J;  3S1K A;  3DS5 A;  4B86 A;  3BCC E;  2YNY A;  3L73 G;  3L73 J;  1SQX E;  1VQK P;  2ONT A;  3HE5 A;  3BVH A;  2K92 A;  3RL0 D;  2KWL A;  5KLV D;  5KAI E;  1MFZ A;  3PJS K;  4JYB A;  2KGA A;  4GR6 A;  3AE4 C;  2PAJ A;  3AEF C;  4BRY A;  2E76 B;  2FAD A;  1LWU B;  1ZOY C;  3H1L D;  1ZP0 C;  3L72 G;  5GTH H;  4I7Z C;  2N1T B;  3USS A;  1ACP A;  2OAR A;  3O8Z A;  4W7Y A;  3L72 J;  1ZR2 A;  2KS1 A;  2LL8 A;  1FZA A;  3H1I G;  3N4X A;  2E75 D;  3U43 A;  1DNY A;  2W6J H;  2AVA A;  1RE3 A;  3RL0 C;  1G1J A;  1Z6M A;  3CD6 P;  1JMM A;  1SQB J;  2M0B A;  2M5A B;  2AEF A;  1T3J A;  2Z4E A;  3VMX A;  2FYU D;  2Q6Q A;  2BCC D;  2XZ0 D;  2GM4 A;  2WSF H;  5TJH A;  3MIW A;  3RBX A;  2XND H;  2XZR A;  2L4B A;  3WUU A;  3CLQ A;  1JEK A;  2WPS A;  3DS3 A;  2YO2 A;  1DIP A;  5F2N A;  5APQ A;  2R44 A;  4DCK A;  1KB9 D;  1S5L H;  2WSC H;  2BCC E;  1VDF A;  3A7O A;  3ITK A;  3Q5P A;  3A3Y B;  2GA1 A;  3CCR P;  4OVN F;  4IOI H;  2FVF A;  1JCD A;  3GJN A;  2NRG A;  2E5T A;  3PP5 A;  2GZG A;  1EIA A;  1NHL A;  5AVV B;  1EOQ A;  3GLM A;  3EJE A;  1KB9 E;  5E79 E;  2AF8 A;  3HTK B;  2K9J A;  3AE9 C;  3GKL C;  1FZE A;  1QEX A;  2HYN A;  4XFX A;  3BRV B;  2KK7 A;  4IL6 E;  2PEO A;  1AQT A;  4WYM A;  1RF1 B;  1AUM A;  2KP8 A;  2ZYA A;  1VQ5 P;  1HTL C;  1NAY A;  2KGC A;  1BE3 D;  3WU2 E;  1J1E B;  2AXT H;  1GD2 E;  1H0T B;  1IMQ A;  1PGO A;  4WBA A;  1URQ B;  2L0Q A;  3L71 G;  2OYO A;  1VQM P;  3L71 J;  4EIJ A;  1X9V A;  2AEM A;  4D6T G;  1SQQ G;  1YIT P;  2C0X A;  4D6T J;  1SQQ J;  1JMB A;  2RKL A;  1NOH A;  4C7N B;  3GZL A;  1MZ9 A;  1SFC D;  1DX7 A;  1BE3 E;  2C9L Y;  2OTK E;  4U0C A;  2KG9 A;  1OW8 A;  1RNI A;  1P84 D;  3BCC J;  2KB7 P;  3EWK A;  4R4M A;  1SQX G;  2ROQ A;  2O01 H;  2WPR A;  3A0B H;  4XRQ A;  5GTI E;  2FFD A;  1SQX J;  1M6E X;  4A7P A;  5AW8 B;  1NTZ D;  1Z56 A;  3CXH D;  1NYH A;  2KW2 A;  2KNC A;  1L4A D;  3P7K A;  1VF5 C;  3N7N A;  2ZAE B;  3SFD C;  2VLP A;  2FXM A;  3D70 A;  1J1D B;  4IL6 X;  3CCQ P;  2I8D A;  1EZV I;  4WVZ A;  1FU1 A;  2XKM A;  2OTL P;  2DGY A;  3H4E A;  2P10 A;  2GZF A;  2UWJ E;  3VOP A;  4N6J A;  1NKN A;  3TF5 A;  5AVU B;  2XV6 A;  1EDK A;  5KLI B;  3L74 G;  1RO2 A;  3TYY A;  5EJD A;  2Y0D A;  1ZXG A;  3O6Q A;  3G9R A;  1A02 F;  3NMD A;  2L5G B;  1L4A C;  2QEX P;  5AW5 B;  2W6B A;  3PH0 A;  1LTI C;  1NO4 A;  2C0W A;  3V4W A;  3MUD A;  1GL2 B;  2E76 D;  2KUB A;  3HD7 A;  5H2F H;  2KOO A;  2N50 A;  2FHS C;  3I56 P;  2E74 B;  4UB6 H;  2M8N A;  3HUS A;  3TNU A;  4YXW H;  1KFM A;  4EDF A;  3AE2 C;  2OTJ P;  1H89 A;  3AEC C;  1JJ2 O;  3WUT A;  4ZNC A;  1J2J B;  5B5E E;  1NU1 K;  3TGU E;  2LKI A;  1JY3 N;  2PNG A;  2WPQ A;  3PHL A;  2IYP A;  2EHT A;  1K30 A;  4U0D A;  1KOR A;  1KD1 Q;  1YBK A;  1D1D A;  3P05 A;  2EG5 A;  1AFO A;  3GG2 A;  1QL2 A;  3L37 A;  2W83 C;  3H32 B;  3Q2Y A;  2HFE D;  1IK9 A;  1BGY G;  3H1K G;  1NTM G;  4I7Z B;  1NTK G;  4WY4 A;  1BGY J;  1NTM J;  1D7M A;  1NU1 E;  3D6Z A;  2KR5 A;  1DEE G;  3B4Q A;  2LF4 A;  2BQ1 E;  2WSE H;  5AW0 B;  5KP7 B;  4MN4 C;  1X22 A;  4RJT A;  1EXI A;  2YKO A;  3RL0 B;  3E1I A;  1JNM A;  3KZI H;  1S1C X;  1VQL P;  2W6A A;  2JWA A;  2Q5U A;  3AED C;  3DS0 A;  1SQP G;  3MP7 B;  1JY3 P;  2KOG A;  1ZW0 A;  3L73 D;  5CCH A;  4JYC A;  3V2P A;  2KGE A;  4C7R A;  2RN0 A;  4QNB A;  3L36 A;  3D6Y A;  2Q1K A;  3CX5 I;  4NPD A;  1URQ D;  5BS1 A;  2MJZ A;  2X2B A;  3LW5 J;  3L72 D;  3JCU E;  3GW6 A;  2JB0 A;  2J58 A;  5CJ4 A;  1SP4 A;  4RES B;  2QA4 P;  1YJN P;  4Y99 C;  3GZM A;  1OX3 A;  3A0H H;  2FAC A;  1SQB D;  4U7J A;  1E79 H;  2PEJ A;  1RF1 C;  2LIW A;  1PGP A;  3L72 E;  1VQO P;  1J1E C;  1OVV A;  1KYO D;  2EIA A;  3U1A A;  1IUQ A;  3H1I E;  4PXH B;  2BUO A;  3KXD A;  4CA3 A;  3W67 A;  5KAF E;  3CCS P;  3GHG A;  3D71 A;  2QRX A;  1EZV E;  2KG6 A;  1BCC G;  2MVU A;  2K37 A;  3G26 A;  1RY3 A;  7CEI A;  3TGU G;  1ZR4 A;  2N9Y B;  4U3F G;  3V4Q A;  1JY2 N;  3TGU J;  2FFD C;  1R8E A;  3LRY A;  3CXC O;  3HZQ A;  2O01 N;  2N6Y A;  1HWT C;  2YIU B;  2JBG A;  1L0L G;  2MF4 A;  4TLF A;  1RHZ B;  1FBM A;  2WQY C;  1NH4 A;  1YQ3 C;  3H47 A;  1LTG C;  5AW4 B;  3RGU A;  1GL2 D;  4KT0 J;  1VF5 B;  2R3S A;  4QMA A;  1XTC C;  2QVA A;  4N3Y B;  1ZLL A;  1ZME C;  1VQ9 P;  3M0D A;  5TIS H;  1FAV A;  1YTZ I;  1Y47 A;  3CCE P;  2R32 A;  1NU1 J;  3DS4 A;  2WSS H;  1FDO A;  3L71 D;  1FR2 A;  3BRT B;  2HPC B;  1JTH B;  3M91 A;  1M6N A;  2GZI A;  4PJ0 E;  2V7Q H;  5B66 H;  1K9M Q;  4D6T D;  1SQQ D;  1GTW A;  1N7S A;  2IDB A;  3FWN A;  2JEE A;  1L2P A;  1JY2 P;  4PD4 I;  1L4A B;  2WT7 B;  3MUD C;  3PRJ A;  5CCG D;  3BCC D;  2WSC J;  3GF7 A;  2QJK B;  1SQX D;  3M9B A;  3L71 E;  2KZI A;  1A43 A;  1IFM A;  2YMY A;  3RK2 B;  1M74 A;  1N2D C;  3HUS C;  1FZB A;  2HLO A;  4D6T E;  1SQQ E;  2BHV A;  4O9B A;  1IFP A;  1G2C A;  4H13 B;  1M8O B;  1NAF A;  5BU5 A;  4M0I A;  5APW A;  3K5B A;  1AF8 A;  3M0A A;  3A5T A;  1VQ7 P;  2Z44 A;  3HE5 B;  2QG4 A;  5CCG C;  2XNX A;  2B9B A;  2WVR A;  1GW3 A;  1HVV A;  2XV5 A;  2VLO A;  3M9Q A;  3RBZ A;  1F80 D;  4BRY B;  2IZ1 A;  2O1K A;  1BSN A;  1KIL A;  3DTJ A;  5KKZ C;  1SLQ A;  3VYI A;  1A02 J;  3L70 G;  1LGH B;  2ZXE B;  2KS1 B;  1LT1 A;  1LWU A;  2OQQ A;  3H1I J;  1USD A;  1QVF O;  2FXP A;  2N1T A;  2N5I A;  2AFE A;  1Q82 Q;  2IBZ I;  3L74 E;  3TDK A;  3KYQ A;  1L0N G;  4JBZ A;  1IFD A;  2O01 J;  3CX5 E;  1H8A A;  4GT1 A;  1S4X A;  1KLP A;  1EZV G;  3G4S P;  3MGE A;  4YXD C;  5C39 A;  2ZJS E;  1KFN A;  1BAJ A;  2Q3E A;  1S3J A;  2FVA A;  1CI6 A;  2KG8 A;  3R2P A;  2IX7 C;  5L8R J;  1JO5 A;  1K8A Q;  2P2U A;  5DJT B;  3ZDM A;  1PP9 G;  2E5Y A;  1CSB A;  4K35 A;  2Y0E A;  3AE5 C;  3WUV A;  1JOC A;  3W68 A;  1NTM K;  1NTK K;  1IMP A;  4DJG A;  3V2N A;  5HVC A;  2LPK A;  1BGY D;  1NTM D;  3E2D A;  2NZ2 A;  1WMK A;  1HQB A;  1A8O A;  2PGD A;  2JWD A;  4GDO A;  2JP3 A;  3Q5R A;  5CZD B;  1M1J A;  2O3J A;  2R3C A;  2K9J B;  4Y99 B;  1Q81 Q;  1N73 A;  2IZ0 A;  1HY8 A;  2O1J A;  2OYI A;  2H89 C;  2N5H A;  1KQL A;  1W2E A;  2K9Y A;  1SQP K;  1BGY E;  3H1K E;  1NTM E;  1SS1 A;  1NTK E;  3HTK A;  2JYL A;  5EFW B;  1OW7 A;  1VF5 D;  2GUS A;  1YTZ T;  2JO1 A;  1RQV A;  1U7M A;  2WPV B;  4MRT C;  1EDJ A;  3GHG C;  2XZ1 C;  4U0A A;  2KOQ A;  1Q2N A;  5JPA A;  2JO0 A;  3UIA A;  4NEO A;  3I5C A;  4XFZ A;  1FZC A;  4UB8 H;  5AW6 B;  1SQP E;  5AVS B;  1QGK B;  2ZT9 B;  3NXS A;  1X79 B;  1JY2 O;  1NJI Q;  2KIK A;  1EQ7 A;  3DS2 A;  1LT9 C;  3Q20 A;  2YIU C;  2FFD B;  3U59 A;  1JUN A;  1Q7Y Q;  2LR2 A;  3C9I A;  2Y9Z A;  4NPE A;  1ZN5 A;  1VQ6 P;  2Z5I A;  2KNC B;  5AVQ B;  3IFM A;  3G28 A;  4TT3 H;  1PZQ A;  1FZF A;  2JR8 A;  4HH2 A;  3FWL A;  4PD4 E;  2PP6 A;  1KYO H;  3RK2 D;  4JQ0 D;  1FOS F;  5KJ7 D;  5CHX A;  3H0D A;  2D2C B;  1AQ5 A;  4H13 D;  3G1I A;  1RE4 A;  2NO8 A;  1Y8A A;  4PWV B;  3HRN A;  1KYO I;  3CCL P; 
#chains in the Genus database with same CATH homology
 3CCM P;  1VQM P;  2PEN A;  3I56 P;  4XFY A;  1W2B O;  1Q81 Q;  2M8N A;  3H47 A;  3G21 A;  4QNB A;  5DCK A;  1YIT P;  2L6E A;  2PEK A;  3DTJ A;  3CME P;  3CD6 P;  1YJW P;  2P9X A;  1VQ4 P;  2XXM A;  2M8L A;  1YI2 P;  5BS1 A;  3VRL C;  2OTJ P;  1KC8 Q;  2KOD A;  3WBH A;  1JJ2 O;  2JYL A;  1K73 Q;  4U0C A;  1VQ9 P;  2CWO A;  3CCJ P;  1RNI A;  4COC A;  1N8R Q;  3G6E P;  3CCV P;  1PEM A;  1YJ9 P;  3CCE P;  3I55 P;  1QVG O;  4XRQ A;  3CPW O;  3DS4 A;  1QVF O;  1M6E X;  2QA4 P;  1Q82 Q;  3DS3 A;  1YJN P;  1VQ8 P;  1K30 A;  1PEU A;  3CMA P;  4U0A A;  4U0D A;  1M6N A;  5HGL A;  5F2N A;  3M1M A;  5F2O A;  5JPA A;  1QRJ A;  1RO0 A;  4IPY A;  2PEM A;  4PH1 A;  4COP A;  2JO0 A;  1KD1 Q;  1K9M Q;  1D1D A;  3P05 A;  5HGM A;  3DS1 A;  3CC2 P;  5HGN A;  2PEJ A;  3G4S P;  2XT1 A;  2EG5 A;  3MGE A;  1ZMB A;  1VQO P;  3B5I A;  4XFZ A;  2PEI A;  3G29 A;  1BAJ A;  3CCQ P;  3DS5 A;  3CCR P;  1NJI Q;  1PEO A;  2EIA A;  3NTE A;  4XRO A;  2OTL P;  3DS2 A;  3Q20 A;  4PH0 A;  2DGY A;  1IUQ A;  3G71 P;  5BS2 A;  3DPH A;  3OW2 O;  3CC4 P;  1VQN P;  3H4E A;  1Q7Y Q;  1VQK P;  2ONT A;  2BUO A;  2PY8 A;  1A43 A;  1KQS O;  2EFJ A;  1EIA A;  2LF4 A;  2BQ1 E;  1K8A Q;  1EOQ A;  1M74 A;  1VQ6 P;  2XV6 A;  4U0E A;  1Q86 Q;  3CCS P;  2BHV A;  1RO2 A;  3G28 A;  2E1M A;  1VQP P;  2JYG A;  1S72 P;  2PEQ A;  4GR6 A;  3G0V A;  1M1K Q;  1PEQ A;  4XFX A;  1E6J P;  4U0F A;  1M90 Q;  2PEO A;  5F2K A;  2M8P A;  4M0I A;  2QEX P;  1VQL P;  3G26 A;  4WYM A;  1AUM A;  2OAR A;  3RG6 C;  3DS0 A;  1VQ5 P;  4GR2 A;  4U0B A;  3E2D A;  3HYB A;  3G1G A;  1VQ7 P;  3H0D A;  2Z44 A;  3CC7 P;  3G1I A;  1A8O A;  3CCU P;  3LRY A;  3CXC O;  2Z45 A;  3HZQ A;  1YIJ P;  5HGO A;  1YHQ P;  5I4T G;  3CCL P;  2Z46 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...