1A0RB

Heterotrimeric complex of phosducin/transducin beta-gamma
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
339
structure length
339
Chain Sequence
SELDQLRQEAEQLKNQIRDARKACADATLSQITNNIDPVGRIQMRTRRTLRGHLAKIYAMHWGTDSRLLLSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNYVACGGLDNICSIYNLKTREGNVRVSRELAGHTGYLSCCRFLDDNQIVTSSGDTTCALWDIETGQQTTTFTGHTGDVMSLSLAPDTRLFVSGACDASAKLWDVREGMCRQTFTGHESDINAICFFPNGNAFATGSDDATCRLFDLRADQELMTYSHDNIICGITSVSFSKSGRLLLAGYDDFNCNVWDALKADRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Complex (transducer/transduction)
molecule keywords TRANSDUCIN (BETA SUBUNIT)
publication title Phosducin induces a structural change in transducin beta gamma.
pubmed doi rcsb
total genus 100
structure length 339
sequence length 339
ec nomenclature
pdb deposition date 1997-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 1a0rB00
3N0DA 2XYIA 4AOWA 3KRXB 5CXBB 4CI8A 2HKMA 3EG6A 1SQJA 5THAA 4FWWA 3IKOA 4KFMB 3UKRC 3I2NA 4A7JA 1PBYB 3EWEA 2IUVA 4ERZA 4ZN4A 2CO0A 4J0XA 4O9DA 1MG2A 3FM0A 2QXVA 4O1QD 1YFQA 3AL8B 5EMJB 3I7OA 3OKTA 3RRMC 5I5MA 2IURA 2OJYA 3PXTD 1ERJA 3OTTA 4FB1D 5IC7A 2PM6B 4ZOZA 5C9ZB 5HE2B 4J84A 4GQ2P 3JROA 2YB8B 2AQ5A 4GM8A 4J86A 2I3SA 5EMKB 2AGXA 2UZXB 4N14A 3J80g 4PBZA 5I5IA 3MKSB 3EI3A 4FA4D 4D6VA 3KRWB 1XKSA 5HE0B 5I5JA 3UVMA 4J0WA 3F3FA 4GMBA 4LG8A 4CI3A 3UVNA 3IJ0A 1U4CA 3CIKB 3RFGA 1GOTB 4J87A 1K8KC 4A2MA 4CI2A 2H13A 4A2LA 4A0AA 2H6QA 4A09B 4QQEA 2EBSA 5H14A 4ESGA 4LGNA 5FQDA 2YBAA 2I0SA 2G99A 4O45A 5EALA 4CZVA 3EI3B 4CZYA 3BG1A 2OK6A 3PSLA 5CXBA 2XL3A 3U4YA 1RI6A 2P9IC 1U2VC 2I0RA 2GC4A 4H5JA 5TDHB 2H47A 3PSCB 2XU7A 1K32A 4Y5RD 3OW8A 2IWKA 2IUQA 2CE8A 4ZOXA 4A0AB 2H6KA 3JPXA 5HE3B 2P9SC 3SHFA 5GSAA 3E0CA 4BH6A 3RSEC 4FA1D 4JSNC 5A2Qg 4CI1A 3RFHA 5FKRA 5IT9g 4J79A 3SN6B 3SLED 4E54A 5HE1B 1PEVA 4GZ8A 3UVLA 3IIWA 4X63B 4O3TB 2W18A 4QT8A 4ZOVA 4A08B 2B5NA 2H9LA 5B4WA 3FRXA 3FGBA 1XHMA 3NVQA 4GGCA 4FAVD 4J8GA 3I7NA 3SMRA 3CFSB 3MZLA 3JZHA 4ZOYA 2Q7QA 5C2WB 3I8EA 5TF2A 3VA6A 5HYNB 3I7HA 4E54B 2BCJB 5FLXg 5KDOB 2Z2NA 3VH0A 3OL2B 2B5MA 5FKTA 2YNOA 3DSMA 2IAAA 1TYQC 2H14A 4A09A 4JXMA 4L1QD 3C9CA 3BG0A 3DXMC 3I8CA 2PM7B 4PSWB 3UR4A 5IJ8E 4U7AA 5EARA 3V5WB 5FXYA 3SBRA 3ORVD 4I79A 3EI1A 3K27A 1N6EA 4CC9A 2HESX 5SXMA 5CYKA 2HJ4A 3C5MA 4MK0B 5K1CC 3UVKA 1Q47A 4FA5D 1PI6A 5EM2B 5GXHA 3RMZD 4XYIA 3JRPA 4BUJC 3JZGA 3OKWA 5EMLB 4CY1A 4GQ1A 5TEEA 2PM9A 2J57G 2H68A 1XIPA 3ODTA 3AL9A 2OVRB 4Z8LA 3BWSA 2TRCB 1A0RB 4AEZA 3EI1B 3F3GA 5C2VB 2O9KA 3SXTD 3OKYB 2CN2A 3EI2A 1GP2B 3RN1D 3V7DB 1JMXB 3C75H 5CYKB 3PE7A 2G9AA 3DM0A 4H5IA 3SFZA 3AFCA 4A08A 2GC7A 3PVUB 3ZWLB 3PXSD 5K19A 3JB9L 1PGUA 2P9LC 2PM9B 2UZYB 4JT5C 1P22A 5EAPA 2B4EA 3NVNA 5H1MA 4HDJA 1MG3A 4X61B 3CFVA 4K3ID 3ULEC 2AH0A 4GQBB 1JMZB 3W15A 3F3PA 1B9XA 4GGAA 2H3XA 1QNIA 4YVDA 4CZXA 3EI2B 3OL2A 5AMSA 1MDAH 4D0KA 2OVQB 4QL1A 1SQ9A 5CXCB 4IA9A 3RN0D 1JOFA 3PXWD 2J55H 4IMMA 3SCYA 2HYEA 2CNXA 2P9NC 5GXIA 1S4UX 4NSXA 4CY3A 2XL2A 3B7FA 2YMUA 3MKQA 4LG9A 4ERYA 4PBYA 3I7PA 4JT6C 1FWXA 4J77A 3I7LA 2HJBA 3JZNA 2OIZA 5EMMB 2H9PA 5EM2A 2H9NA 1OLZA 4A0BA 4CY2A 4PNKB 1OMWB 3EI4A 4J81A 3HFQA 1SHYB 5EAMA 4O3UB 2MTAH 4E5ZB 4R7AB 4OWRA 3J81g 2YNPA 1N6DA 1NR0A 3SWSD 4JD2C 5H17A 2GNQA 3SBQA 4X60B 4G56B 3OKYA 4J82A 1GG2B 4EWRA 2OVPB 2H6NA 3GFCA 5IGOA 3MMYA 5HQGA 2CN3A 3VGZA 2P9PC 4PC0A 2P9UC 5IGQA 5FKQA 2H9MA 4A0BB 3UKUC 4FHLA 4GM9A 3MXXA 4PSXB 1N6FA 2B5LA 3EI4B 5GMKn 2I3TA 2AGYA 4TZ4A 1TBGA 4A11A 4UI9R 1B9YA 4XYHA 3IJ1A 3L4OD 1L0QA 1R5MA 4GM3A 2AGZA 5TEFA 5AJAA 1JJUB 4L9OA 3C99A 3L4MD 4GGDA 5IJ7E 3SJLD 2AH1A 3JAMg 3IJCA 4JSVC 4L3HD 1VYHC 4K3JB 5CXCA 4ERQA 4PXWA 5FKSA 2PBIB 2CE9A 2HKRA 3EMHA 3UVOA 2J56H 2AGLA 5FA5B 4XEIC 2QC5A 4OZUA 4X3EA 4A11B 5AFU3 3EU7A 3V9FA 3SBPA 2IUPA 2Z2OA 5JWZA 4J8BA 1GXRA 2IWFA 3N0EA 4FAND 2HXCA 2I0TA 4J73A 4ES0A 3K26A 4L3GD 3I89A 4Y7RA 4BL0A 4JSPC 2YNNA 4CY5A 4QRJA 3GREA 2Z2PA 4JSXC 3AH8B 4E5ZA 2AGWA 3IIYA 2P9KC 4J78A 3DWLC 3PVWB 3AL8A 3I7KA 3NVXA 4FA9D 2OK4A 2CO0C 2BBKH 3DXKC 4U1EI 3RLMD 3P4FA 3MZKA 3A0FA 3SVWD 1NEXB
chains in the Genus database with same CATH superfamily
3N0DA 2XYIA 4NAAA 4AOWA 3KRXB 5CXBB 4CI8A 2HKMA 3EG6A 4MMXA 1SQJA 5THAA 4FWWA 1C9IA 1TYEA 1H2XA 3IKOA 4KFMB 3UKRC 3I2NA 4A7JA 1PBYB 3EWEA 2IUVA 4ERZA 4ZN4A 1VE6A 2CO0A 2EIDA 4J0XA 4O9DA 1MG2A 3FM0A 2QXVA 4O1QD 1YFQA 3AL8B 5EMJB 3DDUA 3I7OA 3OF7A 3ZE0A 3V4PA 3FCSA 3OKTA 3RRMC 5I5MA 2IURA 2OJYA 3PXTD 1ERJA 3OTTA 4FB1D 5IC7A 2PM6B 2EIBA 4ZOZA 5C9ZB 1H2WA 5HE2B 2XE4A 4J84A 4GQ2P 3JROA 2YB8B 2AQ5A 4GM8A 4J86A 4BP8A 2I3SA 5EMKB 3IVMA 4BP9A 2AGXA 2UZXB 4O02A 4N14A 3J80g 4PBZA 1I2MB 3T3MA 5I5IA 1UOQA 3MKSB 3EI3A 4FA4D 4D6VA 3KRWB 1XKSA 5HE0B 5I5JA 5E6SA 3NIGA 3UVMA 4J0WA 3O4JA 3F3FA 4GMBA 4LG8A 4CI3A 2WQ8A 3UVNA 3IJ0A 1U4CA 2VDNA 3O4IA 3CIKB 3ZE2A 3RFGA 1GOTB 4J87A 1K8KC 2VDPA 4A2MA 4CI2A 2H13A 4A2LA 3EQ8A 4A0AA 2H6QA 3IUMA 4AN0A 4QQEA 4A09B 2EBSA 4DNUA 5H14A 4ESGA 4LGNA 4RE5A 3IJEA 5FQDA 2YBAA 2I0SA 2G99A 3NIDA 4O45A 5EALA 4CZVA 3EI3B 4CZYA 1GOFA 3BG1A 1U8CA 2OK6A 3PSLA 5CXBA 2XL3A 3ZE1A 1RI6A 5E6RA 2P9IC 1U2VC 3QI0A 4L1MA 4AN1A 3U4YA 5HDBA 3EQ9A 2I0RA 4AMYA 2GC4A 4H5JA 5TDHB 2H47A 3PSCB 2XU7A 1K32A 4NBMA 4Y5RD 4AMZA 3OW8A 2IWKA 2IUQA 2CE8A 4RE6A 4ZOXA 3MUNA 4A0AB 2H6KA 3JPXA 5HE3B 2P9SC 3SHFA 3MVDK 5GSAA 3E0CA 4BH6A 3RSEC 4JHPC 4FA1D 3KCIA 4JSNC 5A2Qg 4CI1A 3RFHA 5FKRA 5IT9g 4J79A 4DNVA 3SN6B 3SLED 4E54A 5HE1B 3FCUA 1PEVA 4GZ8A 3UVLA 4WK2A 3IIWA 4X63B 4O3TB 2W18A 4QT8A 5M5SA 4ZOVA 4A08B 4DNWA 2B5NA 4BCCA 4BCBA 2H9LA 5B4WA 3FRXA 3FGBA 2XZGA 1XHMA 3NVQA 4GGCA 4FAVD 4J8GA 3I7NA 2VDMA 3SMRA 3CFSB 3MZLA 3JZHA 4WJKA 4ZOYA 2VDRA 2Q7QA 5C2WB 1A12A 3I8EA 5TF2A 3VA6A 5HYNB 3I7HA 4E54B 2BCJB 5FLXg 5KDOB 1JV2A 1E8MA 2Z2NA 3VH0A 3OL2B 2B5MA 5FKTA 2YNOA 3DSMA 2IAAA 1TYQC 2H14A 1YR2A 4A09A 4JXMA 4L1QD 3C9CA 3BG0A 3IUJA 3DXMC 3I8CA 2PM7B 3GD1I 4PSWB 3UR4A 5IJ8E 4U7AA 5EARA 3V5WB 5FXYA 3SBRA 3ORVD 4I79A 3QHYB 3EI1A 3K27A 2EICA 1O6FA 1N6EA 4CC9A 2HESX 3GC3B 5SXMA 3EQ7A 5CYKA 2HJ4A 2QZPA 3C5MA 4MK0B 4UM8A 5K1CC 3UVKA 1Q47A 4WK0A 1PI6A 4FA5D 5EM2B 2VZ3A 5GXHA 5E6UA 4IRZA 3RMZD 4XYIA 2HU8A 3JRPA 4BUJC 3JZGA 3OKWA 5EMLB 4CY1A 4NC4A 4GQ1A 5TEEA 2PM9A 1K3IA 2J57G 4G55A 2H68A 1XIPA 3ODTA 3AL9A 2OVRB 4Z8LA 3BWSA 1BPOA 2TRCB 1A0RB 4AEZA 3EI1B 3ZDXA 3F3GA 5C2VB 2O9KA 3SXTD 3OKYB 1UOPA 2CN2A 3EI2A 1QFMA 1GP2B 3RN1D 3V7DB 1JMXB 3IUNA 3C75H 5CYKB 3VI3A 3PE7A 2G9AA 3DM0A 3ZDZA 4MMZA 4H5IA 3SFZA 2VDQA 3AFCA 1M1XA 4A08A 2GC7A 3PVUB 3ZWLB 1VE7A 2XDWA 3K71A 4Z7QA 3PXSD 5K19A 3JB9L 1PGUA 2P9LC 2PM9B 1E5TA 2UZYB 4JT5C 1H2ZA 1O6GA 1P22A 5EAPA 2B4EA 3NVNA 5H1MA 4HDJA 4NENA 1MG3A 4X61B 3CFVA 4K3ID 3ULEC 2EIEA 2AH0A 4GQBB 1JMZB 2VC2A 3F3PA 3W15A 1B9XA 5M5TA 4GGAA 2H3XA 1QNIA 4YVDA 4CZXA 3EI2B 3OL2A 5AMSA 1MDAH 4D0KA 3VI4A 2OVQB 4QL1A 1SQ9A 5CXCB 4IA9A 4JHNA 1JOFA 3PXWD 2J55H 4IMMA 3RN0D 3SCYA 2HYEA 2CNXA 2P9NC 5GXIA 1S4UX 4NSXA 4CY3A 2XL2A 4MMYA 3B7FA 3IUQA 2YMUA 3MKQA 4LG9A 4ERYA 3V4VA 4AX4A 3IULA 4PBYA 3K72A 3I7PA 3O4GA 4JT6C 1FWXA 4J77A 3I7LA 2HJBA 3JZNA 2OIZA 5EMMB 2H9PA 5EM2A 2H9NA 1OLZA 4A0BA 4CY2A 2VDLA 4PNKB 1OMWB 3EI4A 4J81A 3HFQA 1SHYB 5EAMA 4O3UB 2MTAH 4E5ZB 4G1MA 4R7AB 4OWRA 3J81g 2YNPA 1H2YA 1N6DA 1NR0A 3SWSD 4JD2C 5H17A 2GNQA 2VDKA 3SBQA 4X60B 4G56B 3NIFA 5M5UA 1GOHA 3OKYA 4J82A 1GG2B 4EWRA 2OVPB 2VDOA 2H6NA 3GFCA 5IGOA 4D9SA 3MMYA 5HQGA 2CN3A 4O2WA 2P9PC 3VGZA 2HU7A 2P9UC 4PC0A 2HU5A 5IGQA 5FKQA 2H9MA 4BCDA 3UKUC 4FHLA 4A0BB 4GM9A 3MXXA 4PSXB 1N6FA 2B5LA 3EI4B 5GMKn 2I3TA 2AGYA 5FFGA 4TZ4A 1TBGA 4QAMA 4A11A 5M5RA 4UI9R 5C92A 1B9YA 1QFSA 4XYHA 3IJ1A 3L4OD 1L0QA 3T3PA 1GOGA 3ZDYA 1R5MA 4GM3A 2AGZA 5TEFA 5AJAA 1JJUB 3MUOA 4L9OA 3C99A 3K6SA 3L4MD 4GGDA 5IJ7E 3SJLD 2VZ1A 2AH1A 4G1EA 4WK4A 3JAMg 3IJCA 4JSVC 4L3HD 1VYHC 4K3JB 5CXCA 4ERQA 4PXWA 5FKSA 2PBIB 2CE9A 2HKRA 2JKXA 4Z7NA 4Z7OA 5FFOA 3EMHA 3UVOA 4UM9A 2J56H 1VZ2A 2AGLA 5FA5B 4XEIC 2QC5A 4OZUA 4X3EA 4A11B 5AFU3 3EU7A 3V9FA 3SBPA 2IUPA 1T2XA 2Z2OA 1L5GA 5C86A 4J8BA 5JWZA 1UTCA 1GXRA 2IWFA 3N0EA 4FAND 2HXCA 1VZ3A 2I0TA 4J73A 4ES0A 3K26A 1C9LA 4L3GD 1JTDB 3I89A 2BKLA 3IURA 4Y7RA 4BL0A 4JSPC 2YNNA 4CY5A 4QRJA 3GREA 2Z2PA 4JSXC 3AH8B 4E5ZA 2AGWA 3IIYA 2P9KC 2QR5A 3DWLC 4J78A 3PVWB 1UOOA 3AL8A 3I7KA 3NVXA 4FA9D 2OK4A 2CO0C 2BBKH 3DXKC 4U1EI 5M61A 3RLMD 3P4FA 5M5VA 3MZKA 3A0FA 3O4HA 1E8NA 3SVWD 1NEXB
chains in the Genus database with same CATH topology
3N0DA 2XYIA 4AOWA 3KRXB 5CXBB 4CI8A 2HKMA 3EG6A 1SQJA 5THAA 4FWWA 3IKOA 4KFMB 3UKRC 3I2NA 4A7JA 1PBYB 3EWEA 2IUVA 4ERZA 4ZN4A 2CO0A 4J0XA 4O9DA 1MG2A 3FM0A 2QXVA 4O1QD 1YFQA 3AL8B 5EMJB 3I7OA 3OKTA 3RRMC 5I5MA 2IURA 2OJYA 3PXTD 1ERJA 3OTTA 4FB1D 5IC7A 2PM6B 4ZOZA 5C9ZB 5HE2B 4J84A 4GQ2P 3JROA 2YB8B 2AQ5A 4GM8A 4J86A 2I3SA 5EMKB 2AGXA 2UZXB 4N14A 3J80g 4PBZA 5I5IA 3MKSB 3EI3A 4FA4D 4D6VA 3KRWB 1XKSA 5HE0B 5I5JA 3UVMA 4J0WA 3F3FA 4GMBA 4LG8A 4CI3A 3UVNA 3IJ0A 1U4CA 3CIKB 3RFGA 1GOTB 4J87A 1K8KC 4A2MA 4CI2A 2H13A 4A2LA 4A0AA 2H6QA 4A09B 4QQEA 2EBSA 5H14A 4ESGA 4LGNA 5FQDA 2YBAA 2I0SA 2G99A 4O45A 5EALA 4CZVA 3EI3B 4CZYA 3BG1A 2OK6A 3PSLA 5CXBA 2XL3A 3U4YA 1RI6A 2P9IC 1U2VC 2I0RA 2GC4A 4H5JA 5TDHB 2H47A 3PSCB 2XU7A 1K32A 4Y5RD 3OW8A 2IWKA 2IUQA 2CE8A 4ZOXA 4A0AB 2H6KA 3JPXA 5HE3B 2P9SC 3SHFA 5GSAA 3E0CA 4BH6A 3RSEC 4FA1D 4JSNC 5A2Qg 4CI1A 3RFHA 5FKRA 5IT9g 4J79A 3SN6B 3SLED 4E54A 5HE1B 1PEVA 4GZ8A 3UVLA 3IIWA 4X63B 4O3TB 2W18A 4QT8A 4ZOVA 4A08B 2B5NA 2H9LA 5B4WA 3FRXA 3FGBA 1XHMA 3NVQA 4GGCA 4FAVD 4J8GA 3I7NA 3SMRA 3CFSB 3MZLA 3JZHA 4ZOYA 2Q7QA 5C2WB 3I8EA 5TF2A 3VA6A 5HYNB 3I7HA 4E54B 2BCJB 5FLXg 5KDOB 2Z2NA 3VH0A 3OL2B 2B5MA 5FKTA 2YNOA 3DSMA 2IAAA 1TYQC 2H14A 4A09A 4JXMA 4L1QD 3C9CA 3BG0A 3DXMC 3I8CA 2PM7B 4PSWB 3UR4A 5IJ8E 4U7AA 5EARA 3V5WB 5FXYA 3SBRA 3ORVD 4I79A 3EI1A 3K27A 1N6EA 4CC9A 2HESX 5SXMA 5CYKA 2HJ4A 3C5MA 4MK0B 5K1CC 3UVKA 1Q47A 4FA5D 1PI6A 5EM2B 5GXHA 3RMZD 4XYIA 3JRPA 4BUJC 3JZGA 3OKWA 5EMLB 4CY1A 4GQ1A 5TEEA 2PM9A 2J57G 2H68A 1XIPA 3ODTA 3AL9A 2OVRB 4Z8LA 3BWSA 2TRCB 1A0RB 4AEZA 3EI1B 3F3GA 5C2VB 2O9KA 3SXTD 3OKYB 2CN2A 3EI2A 1GP2B 3RN1D 3V7DB 1JMXB 3C75H 5CYKB 3PE7A 2G9AA 3DM0A 4H5IA 3SFZA 3AFCA 4A08A 2GC7A 3PVUB 3ZWLB 3PXSD 5K19A 3JB9L 1PGUA 2P9LC 2PM9B 2UZYB 4JT5C 1P22A 5EAPA 2B4EA 3NVNA 5H1MA 4HDJA 1MG3A 4X61B 3CFVA 4K3ID 3ULEC 2AH0A 4GQBB 1JMZB 3W15A 3F3PA 1B9XA 4GGAA 2H3XA 1QNIA 4YVDA 4CZXA 3EI2B 3OL2A 5AMSA 1MDAH 4D0KA 2OVQB 4QL1A 1SQ9A 5CXCB 4IA9A 3RN0D 1JOFA 3PXWD 2J55H 4IMMA 3SCYA 2HYEA 2CNXA 2P9NC 5GXIA 1S4UX 4NSXA 4CY3A 2XL2A 3B7FA 2YMUA 3MKQA 4LG9A 4ERYA 4PBYA 3I7PA 4JT6C 1FWXA 4J77A 3I7LA 2HJBA 3JZNA 2OIZA 5EMMB 2H9PA 5EM2A 2H9NA 1OLZA 4A0BA 4CY2A 4PNKB 1OMWB 3EI4A 4J81A 3HFQA 1SHYB 5EAMA 4O3UB 2MTAH 4E5ZB 4R7AB 4OWRA 3J81g 2YNPA 1N6DA 1NR0A 3SWSD 4JD2C 5H17A 2GNQA 3SBQA 4X60B 4G56B 3OKYA 4J82A 1GG2B 4EWRA 2OVPB 2H6NA 3GFCA 5IGOA 3MMYA 5HQGA 2CN3A 3VGZA 2P9PC 4PC0A 2P9UC 5IGQA 5FKQA 2H9MA 4A0BB 3UKUC 4FHLA 4GM9A 3MXXA 4PSXB 1N6FA 2B5LA 3EI4B 5GMKn 2I3TA 2AGYA 4TZ4A 1TBGA 4A11A 4UI9R 1B9YA 4XYHA 3IJ1A 3L4OD 1L0QA 1R5MA 4GM3A 2AGZA 5TEFA 5AJAA 1JJUB 4L9OA 3C99A 3L4MD 4GGDA 5IJ7E 3SJLD 2AH1A 3JAMg 3IJCA 4JSVC 4L3HD 1VYHC 4K3JB 5CXCA 4ERQA 4PXWA 5FKSA 2PBIB 2CE9A 2HKRA 3EMHA 3UVOA 2J56H 2AGLA 5FA5B 4XEIC 2QC5A 4OZUA 4X3EA 4A11B 5AFU3 3EU7A 3V9FA 3SBPA 2IUPA 2Z2OA 5JWZA 4J8BA 1GXRA 2IWFA 3N0EA 4FAND 2HXCA 2I0TA 4J73A 4ES0A 3K26A 4L3GD 3I89A 4Y7RA 4BL0A 4JSPC 2YNNA 4CY5A 4QRJA 3GREA 2Z2PA 4JSXC 3AH8B 4E5ZA 2AGWA 3IIYA 2P9KC 4J78A 3DWLC 3PVWB 3AL8A 3I7KA 3NVXA 4FA9D 2OK4A 2CO0C 2BBKH 3DXKC 4U1EI 3RLMD 3P4FA 3MZKA 3A0FA 3SVWD 1NEXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N0D A;  2XYI A;  4AOW A;  3KRX B;  5CXB B;  4CI8 A;  2HKM A;  3EG6 A;  1SQJ A;  5THA A;  4FWW A;  3IKO A;  4KFM B;  3UKR C;  3I2N A;  4A7J A;  1PBY B;  3EWE A;  2IUV A;  4ERZ A;  4ZN4 A;  2CO0 A;  4J0X A;  4O9D A;  1MG2 A;  3FM0 A;  2QXV A;  4O1Q D;  1YFQ A;  3AL8 B;  5EMJ B;  3I7O A;  3OKT A;  3RRM C;  5I5M A;  2IUR A;  2OJY A;  3PXT D;  1ERJ A;  3OTT A;  4FB1 D;  5IC7 A;  2PM6 B;  4ZOZ A;  5C9Z B;  5HE2 B;  4J84 A;  4GQ2 P;  3JRO A;  2YB8 B;  2AQ5 A;  4GM8 A;  4J86 A;  2I3S A;  5EMK B;  2AGX A;  2UZX B;  4N14 A;  3J80 g;  4PBZ A;  5I5I A;  3MKS B;  3EI3 A;  4FA4 D;  4D6V A;  3KRW B;  1XKS A;  5HE0 B;  5I5J A;  3UVM A;  4J0W A;  3F3F A;  4GMB A;  4LG8 A;  4CI3 A;  3UVN A;  3IJ0 A;  1U4C A;  3CIK B;  3RFG A;  1GOT B;  4J87 A;  1K8K C;  4A2M A;  4CI2 A;  2H13 A;  4A2L A;  4A0A A;  2H6Q A;  4A09 B;  4QQE A;  2EBS A;  5H14 A;  4ESG A;  4LGN A;  5FQD A;  2YBA A;  2I0S A;  2G99 A;  4O45 A;  5EAL A;  4CZV A;  3EI3 B;  4CZY A;  3BG1 A;  2OK6 A;  3PSL A;  5CXB A;  2XL3 A;  3U4Y A;  1RI6 A;  2P9I C;  1U2V C;  2I0R A;  2GC4 A;  4H5J A;  5TDH B;  2H47 A;  3PSC B;  2XU7 A;  1K32 A;  4Y5R D;  3OW8 A;  2IWK A;  2IUQ A;  2CE8 A;  4ZOX A;  4A0A B;  2H6K A;  3JPX A;  5HE3 B;  2P9S C;  3SHF A;  5GSA A;  3E0C A;  4BH6 A;  3RSE C;  4FA1 D;  4JSN C;  5A2Q g;  4CI1 A;  3RFH A;  5FKR A;  5IT9 g;  4J79 A;  3SN6 B;  3SLE D;  4E54 A;  5HE1 B;  1PEV A;  4GZ8 A;  3UVL A;  3IIW A;  4X63 B;  4O3T B;  2W18 A;  4QT8 A;  4ZOV A;  4A08 B;  2B5N A;  2H9L A;  5B4W A;  3FRX A;  3FGB A;  1XHM A;  3NVQ A;  4GGC A;  4FAV D;  4J8G A;  3I7N A;  3SMR A;  3CFS B;  3MZL A;  3JZH A;  4ZOY A;  2Q7Q A;  5C2W B;  3I8E A;  5TF2 A;  3VA6 A;  5HYN B;  3I7H A;  4E54 B;  2BCJ B;  5FLX g;  5KDO B;  2Z2N A;  3VH0 A;  3OL2 B;  2B5M A;  5FKT A;  2YNO A;  3DSM A;  2IAA A;  1TYQ C;  2H14 A;  4A09 A;  4JXM A;  4L1Q D;  3C9C A;  3BG0 A;  3DXM C;  3I8C A;  2PM7 B;  4PSW B;  3UR4 A;  5IJ8 E;  4U7A A;  5EAR A;  3V5W B;  5FXY A;  3SBR A;  3ORV D;  4I79 A;  3EI1 A;  3K27 A;  1N6E A;  4CC9 A;  2HES X;  5SXM A;  5CYK A;  2HJ4 A;  3C5M A;  4MK0 B;  5K1C C;  3UVK A;  1Q47 A;  4FA5 D;  1PI6 A;  5EM2 B;  5GXH A;  3RMZ D;  4XYI A;  3JRP A;  4BUJ C;  3JZG A;  3OKW A;  5EML B;  4CY1 A;  4GQ1 A;  5TEE A;  2PM9 A;  2J57 G;  2H68 A;  1XIP A;  3ODT A;  3AL9 A;  2OVR B;  4Z8L A;  3BWS A;  2TRC B;  1A0R B;  4AEZ A;  3EI1 B;  3F3G A;  5C2V B;  2O9K A;  3SXT D;  3OKY B;  2CN2 A;  3EI2 A;  1GP2 B;  3RN1 D;  3V7D B;  1JMX B;  3C75 H;  5CYK B;  3PE7 A;  2G9A A;  3DM0 A;  4H5I A;  3SFZ A;  3AFC A;  4A08 A;  2GC7 A;  3PVU B;  3ZWL B;  3PXS D;  5K19 A;  3JB9 L;  1PGU A;  2P9L C;  2PM9 B;  2UZY B;  4JT5 C;  1P22 A;  5EAP A;  2B4E A;  3NVN A;  5H1M A;  4HDJ A;  1MG3 A;  4X61 B;  3CFV A;  4K3I D;  3ULE C;  2AH0 A;  4GQB B;  1JMZ B;  3W15 A;  3F3P A;  1B9X A;  4GGA A;  2H3X A;  1QNI A;  4YVD A;  4CZX A;  3EI2 B;  3OL2 A;  5AMS A;  1MDA H;  4D0K A;  2OVQ B;  4QL1 A;  1SQ9 A;  5CXC B;  4IA9 A;  3RN0 D;  1JOF A;  3PXW D;  2J55 H;  4IMM A;  3SCY A;  2HYE A;  2CNX A;  2P9N C;  5GXI A;  1S4U X;  4NSX A;  4CY3 A;  2XL2 A;  3B7F A;  2YMU A;  3MKQ A;  4LG9 A;  4ERY A;  4PBY A;  3I7P A;  4JT6 C;  1FWX A;  4J77 A;  3I7L A;  2HJB A;  3JZN A;  2OIZ A;  5EMM B;  2H9P A;  5EM2 A;  2H9N A;  1OLZ A;  4A0B A;  4CY2 A;  4PNK B;  1OMW B;  3EI4 A;  4J81 A;  3HFQ A;  1SHY B;  5EAM A;  4O3U B;  2MTA H;  4E5Z B;  4R7A B;  4OWR A;  3J81 g;  2YNP A;  1N6D A;  1NR0 A;  3SWS D;  4JD2 C;  5H17 A;  2GNQ A;  3SBQ A;  4X60 B;  4G56 B;  3OKY A;  4J82 A;  1GG2 B;  4EWR A;  2OVP B;  2H6N A;  3GFC A;  5IGO A;  3MMY A;  5HQG A;  2CN3 A;  3VGZ A;  2P9P C;  4PC0 A;  2P9U C;  5IGQ A;  5FKQ A;  2H9M A;  4A0B B;  3UKU C;  4FHL A;  4GM9 A;  3MXX A;  4PSX B;  1N6F A;  2B5L A;  3EI4 B;  5GMK n;  2I3T A;  2AGY A;  4TZ4 A;  1TBG A;  4A11 A;  4UI9 R;  1B9Y A;  4XYH A;  3IJ1 A;  3L4O D;  1L0Q A;  1R5M A;  4GM3 A;  2AGZ A;  5TEF A;  5AJA A;  1JJU B;  4L9O A;  3C99 A;  3L4M D;  4GGD A;  5IJ7 E;  3SJL D;  2AH1 A;  3JAM g;  3IJC A;  4JSV C;  4L3H D;  1VYH C;  4K3J B;  5CXC A;  4ERQ A;  4PXW A;  5FKS A;  2PBI B;  2CE9 A;  2HKR A;  3EMH A;  3UVO A;  2J56 H;  2AGL A;  5FA5 B;  4XEI C;  2QC5 A;  4OZU A;  4X3E A;  4A11 B;  5AFU 3;  3EU7 A;  3V9F A;  3SBP A;  2IUP A;  2Z2O A;  5JWZ A;  4J8B A;  1GXR A;  2IWF A;  3N0E A;  4FAN D;  2HXC A;  2I0T A;  4J73 A;  4ES0 A;  3K26 A;  4L3G D;  3I89 A;  4Y7R A;  4BL0 A;  4JSP C;  2YNN A;  4CY5 A;  4QRJ A;  3GRE A;  2Z2P A;  4JSX C;  3AH8 B;  4E5Z A;  2AGW A;  3IIY A;  2P9K C;  4J78 A;  3DWL C;  3PVW B;  3AL8 A;  3I7K A;  3NVX A;  4FA9 D;  2OK4 A;  2CO0 C;  2BBK H;  3DXK C;  4U1E I;  3RLM D;  3P4F A;  3MZK A;  3A0F A;  3SVW D;  1NEX B; 
#chains in the Genus database with same CATH topology
 3N0D A;  2XYI A;  4NAA A;  4AOW A;  3KRX B;  5CXB B;  4CI8 A;  2HKM A;  3EG6 A;  4MMX A;  1SQJ A;  5THA A;  4FWW A;  1C9I A;  1TYE A;  1H2X A;  3IKO A;  4KFM B;  3UKR C;  3I2N A;  4A7J A;  1PBY B;  3EWE A;  2IUV A;  4ERZ A;  4ZN4 A;  1VE6 A;  2CO0 A;  2EID A;  4J0X A;  4O9D A;  1MG2 A;  3FM0 A;  2QXV A;  4O1Q D;  1YFQ A;  3AL8 B;  5EMJ B;  3DDU A;  3I7O A;  3OF7 A;  3ZE0 A;  3V4P A;  3FCS A;  3OKT A;  3RRM C;  5I5M A;  2IUR A;  2OJY A;  3PXT D;  1ERJ A;  3OTT A;  4FB1 D;  5IC7 A;  2PM6 B;  2EIB A;  4ZOZ A;  5C9Z B;  1H2W A;  5HE2 B;  2XE4 A;  4J84 A;  4GQ2 P;  3JRO A;  2YB8 B;  2AQ5 A;  4GM8 A;  4J86 A;  4BP8 A;  2I3S A;  5EMK B;  3IVM A;  4BP9 A;  2AGX A;  2UZX B;  4O02 A;  4N14 A;  3J80 g;  4PBZ A;  1I2M B;  3T3M A;  5I5I A;  1UOQ A;  3MKS B;  3EI3 A;  4FA4 D;  4D6V A;  3KRW B;  1XKS A;  5HE0 B;  5I5J A;  5E6S A;  3NIG A;  3UVM A;  4J0W A;  3O4J A;  3F3F A;  4GMB A;  4LG8 A;  4CI3 A;  2WQ8 A;  3UVN A;  3IJ0 A;  1U4C A;  2VDN A;  3O4I A;  3CIK B;  3ZE2 A;  3RFG A;  1GOT B;  4J87 A;  1K8K C;  2VDP A;  4A2M A;  4CI2 A;  2H13 A;  4A2L A;  3EQ8 A;  4A0A A;  2H6Q A;  3IUM A;  4AN0 A;  4QQE A;  4A09 B;  2EBS A;  4DNU A;  5H14 A;  4ESG A;  4LGN A;  4RE5 A;  3IJE A;  5FQD A;  2YBA A;  2I0S A;  2G99 A;  3NID A;  4O45 A;  5EAL A;  4CZV A;  3EI3 B;  4CZY A;  1GOF A;  3BG1 A;  1U8C A;  2OK6 A;  3PSL A;  5CXB A;  2XL3 A;  3ZE1 A;  1RI6 A;  5E6R A;  2P9I C;  1U2V C;  3QI0 A;  4L1M A;  4AN1 A;  3U4Y A;  5HDB A;  3EQ9 A;  2I0R A;  4AMY A;  2GC4 A;  4H5J A;  5TDH B;  2H47 A;  3PSC B;  2XU7 A;  1K32 A;  4NBM A;  4Y5R D;  4AMZ A;  3OW8 A;  2IWK A;  2IUQ A;  2CE8 A;  4RE6 A;  4ZOX A;  3MUN A;  4A0A B;  2H6K A;  3JPX A;  5HE3 B;  2P9S C;  3SHF A;  3MVD K;  5GSA A;  3E0C A;  4BH6 A;  3RSE C;  4JHP C;  4FA1 D;  3KCI A;  4JSN C;  5A2Q g;  4CI1 A;  3RFH A;  5FKR A;  5IT9 g;  4J79 A;  4DNV A;  3SN6 B;  3SLE D;  4E54 A;  5HE1 B;  3FCU A;  1PEV A;  4GZ8 A;  3UVL A;  4WK2 A;  3IIW A;  4X63 B;  4O3T B;  2W18 A;  4QT8 A;  5M5S A;  4ZOV A;  4A08 B;  4DNW A;  2B5N A;  4BCC A;  4BCB A;  2H9L A;  5B4W A;  3FRX A;  3FGB A;  2XZG A;  1XHM A;  3NVQ A;  4GGC A;  4FAV D;  4J8G A;  3I7N A;  2VDM A;  3SMR A;  3CFS B;  3MZL A;  3JZH A;  4WJK A;  4ZOY A;  2VDR A;  2Q7Q A;  5C2W B;  1A12 A;  3I8E A;  5TF2 A;  3VA6 A;  5HYN B;  3I7H A;  4E54 B;  2BCJ B;  5FLX g;  5KDO B;  1JV2 A;  1E8M A;  2Z2N A;  3VH0 A;  3OL2 B;  2B5M A;  5FKT A;  2YNO A;  3DSM A;  2IAA A;  1TYQ C;  2H14 A;  1YR2 A;  4A09 A;  4JXM A;  4L1Q D;  3C9C A;  3BG0 A;  3IUJ A;  3DXM C;  3I8C A;  2PM7 B;  3GD1 I;  4PSW B;  3UR4 A;  5IJ8 E;  4U7A A;  5EAR A;  3V5W B;  5FXY A;  3SBR A;  3ORV D;  4I79 A;  3QHY B;  3EI1 A;  3K27 A;  2EIC A;  1O6F A;  1N6E A;  4CC9 A;  2HES X;  3GC3 B;  5SXM A;  3EQ7 A;  5CYK A;  2HJ4 A;  2QZP A;  3C5M A;  4MK0 B;  4UM8 A;  5K1C C;  3UVK A;  1Q47 A;  4WK0 A;  1PI6 A;  4FA5 D;  5EM2 B;  2VZ3 A;  5GXH A;  5E6U A;  4IRZ A;  3RMZ D;  4XYI A;  2HU8 A;  3JRP A;  4BUJ C;  3JZG A;  3OKW A;  5EML B;  4CY1 A;  4NC4 A;  4GQ1 A;  5TEE A;  2PM9 A;  1K3I A;  2J57 G;  4G55 A;  2H68 A;  1XIP A;  3ODT A;  3AL9 A;  2OVR B;  4Z8L A;  3BWS A;  1BPO A;  2TRC B;  1A0R B;  4AEZ A;  3EI1 B;  3ZDX A;  3F3G A;  5C2V B;  2O9K A;  3SXT D;  3OKY B;  1UOP A;  2CN2 A;  3EI2 A;  1QFM A;  1GP2 B;  3RN1 D;  3V7D B;  1JMX B;  3IUN A;  3C75 H;  5CYK B;  3VI3 A;  3PE7 A;  2G9A A;  3DM0 A;  3ZDZ A;  4MMZ A;  4H5I A;  3SFZ A;  2VDQ A;  3AFC A;  1M1X A;  4A08 A;  2GC7 A;  3PVU B;  3ZWL B;  1VE7 A;  2XDW A;  3K71 A;  4Z7Q A;  3PXS D;  5K19 A;  3JB9 L;  1PGU A;  2P9L C;  2PM9 B;  1E5T A;  2UZY B;  4JT5 C;  1H2Z A;  1O6G A;  1P22 A;  5EAP A;  2B4E A;  3NVN A;  5H1M A;  4HDJ A;  4NEN A;  1MG3 A;  4X61 B;  3CFV A;  4K3I D;  3ULE C;  2EIE A;  2AH0 A;  4GQB B;  1JMZ B;  2VC2 A;  3F3P A;  3W15 A;  1B9X A;  5M5T A;  4GGA A;  2H3X A;  1QNI A;  4YVD A;  4CZX A;  3EI2 B;  3OL2 A;  5AMS A;  1MDA H;  4D0K A;  3VI4 A;  2OVQ B;  4QL1 A;  1SQ9 A;  5CXC B;  4IA9 A;  4JHN A;  1JOF A;  3PXW D;  2J55 H;  4IMM A;  3RN0 D;  3SCY A;  2HYE A;  2CNX A;  2P9N C;  5GXI A;  1S4U X;  4NSX A;  4CY3 A;  2XL2 A;  4MMY A;  3B7F A;  3IUQ A;  2YMU A;  3MKQ A;  4LG9 A;  4ERY A;  3V4V A;  4AX4 A;  3IUL A;  4PBY A;  3K72 A;  3I7P A;  3O4G A;  4JT6 C;  1FWX A;  4J77 A;  3I7L A;  2HJB A;  3JZN A;  2OIZ A;  5EMM B;  2H9P A;  5EM2 A;  2H9N A;  1OLZ A;  4A0B A;  4CY2 A;  2VDL A;  4PNK B;  1OMW B;  3EI4 A;  4J81 A;  3HFQ A;  1SHY B;  5EAM A;  4O3U B;  2MTA H;  4E5Z B;  4G1M A;  4R7A B;  4OWR A;  3J81 g;  2YNP A;  1H2Y A;  1N6D A;  1NR0 A;  3SWS D;  4JD2 C;  5H17 A;  2GNQ A;  2VDK A;  3SBQ A;  4X60 B;  4G56 B;  3NIF A;  5M5U A;  1GOH A;  3OKY A;  4J82 A;  1GG2 B;  4EWR A;  2OVP B;  2VDO A;  2H6N A;  3GFC A;  5IGO A;  4D9S A;  3MMY A;  5HQG A;  2CN3 A;  4O2W A;  2P9P C;  3VGZ A;  2HU7 A;  2P9U C;  4PC0 A;  2HU5 A;  5IGQ A;  5FKQ A;  2H9M A;  4BCD A;  3UKU C;  4FHL A;  4A0B B;  4GM9 A;  3MXX A;  4PSX B;  1N6F A;  2B5L A;  3EI4 B;  5GMK n;  2I3T A;  2AGY A;  5FFG A;  4TZ4 A;  1TBG A;  4QAM A;  4A11 A;  5M5R A;  4UI9 R;  5C92 A;  1B9Y A;  1QFS A;  4XYH A;  3IJ1 A;  3L4O D;  1L0Q A;  3T3P A;  1GOG A;  3ZDY A;  1R5M A;  4GM3 A;  2AGZ A;  5TEF A;  5AJA A;  1JJU B;  3MUO A;  4L9O A;  3C99 A;  3K6S A;  3L4M D;  4GGD A;  5IJ7 E;  3SJL D;  2VZ1 A;  2AH1 A;  4G1E A;  4WK4 A;  3JAM g;  3IJC A;  4JSV C;  4L3H D;  1VYH C;  4K3J B;  5CXC A;  4ERQ A;  4PXW A;  5FKS A;  2PBI B;  2CE9 A;  2HKR A;  2JKX A;  4Z7N A;  4Z7O A;  5FFO A;  3EMH A;  3UVO A;  4UM9 A;  2J56 H;  1VZ2 A;  2AGL A;  5FA5 B;  4XEI C;  2QC5 A;  4OZU A;  4X3E A;  4A11 B;  5AFU 3;  3EU7 A;  3V9F A;  3SBP A;  2IUP A;  1T2X A;  2Z2O A;  1L5G A;  5C86 A;  4J8B A;  5JWZ A;  1UTC A;  1GXR A;  2IWF A;  3N0E A;  4FAN D;  2HXC A;  1VZ3 A;  2I0T A;  4J73 A;  4ES0 A;  3K26 A;  1C9L A;  4L3G D;  1JTD B;  3I89 A;  2BKL A;  3IUR A;  4Y7R A;  4BL0 A;  4JSP C;  2YNN A;  4CY5 A;  4QRJ A;  3GRE A;  2Z2P A;  4JSX C;  3AH8 B;  4E5Z A;  2AGW A;  3IIY A;  2P9K C;  2QR5 A;  3DWL C;  4J78 A;  3PVW B;  1UOO A;  3AL8 A;  3I7K A;  3NVX A;  4FA9 D;  2OK4 A;  2CO0 C;  2BBK H;  3DXK C;  4U1E I;  5M61 A;  3RLM D;  3P4F A;  5M5V A;  3MZK A;  3A0F A;  3O4H A;  1E8N A;  3SVW D;  1NEX B; 
#chains in the Genus database with same CATH homology
 3N0D A;  2XYI A;  4AOW A;  3KRX B;  5CXB B;  4CI8 A;  2HKM A;  3EG6 A;  1SQJ A;  5THA A;  4FWW A;  3IKO A;  4KFM B;  3UKR C;  3I2N A;  4A7J A;  1PBY B;  3EWE A;  2IUV A;  4ERZ A;  4ZN4 A;  2CO0 A;  4J0X A;  4O9D A;  1MG2 A;  3FM0 A;  2QXV A;  4O1Q D;  1YFQ A;  3AL8 B;  5EMJ B;  3I7O A;  3OKT A;  3RRM C;  5I5M A;  2IUR A;  2OJY A;  3PXT D;  1ERJ A;  3OTT A;  4FB1 D;  5IC7 A;  2PM6 B;  4ZOZ A;  5C9Z B;  5HE2 B;  4J84 A;  4GQ2 P;  3JRO A;  2YB8 B;  2AQ5 A;  4GM8 A;  4J86 A;  2I3S A;  5EMK B;  2AGX A;  2UZX B;  4N14 A;  3J80 g;  4PBZ A;  5I5I A;  3MKS B;  3EI3 A;  4FA4 D;  4D6V A;  3KRW B;  1XKS A;  5HE0 B;  5I5J A;  3UVM A;  4J0W A;  3F3F A;  4GMB A;  4LG8 A;  4CI3 A;  3UVN A;  3IJ0 A;  1U4C A;  3CIK B;  3RFG A;  1GOT B;  4J87 A;  1K8K C;  4A2M A;  4CI2 A;  2H13 A;  4A2L A;  4A0A A;  2H6Q A;  4A09 B;  4QQE A;  2EBS A;  5H14 A;  4ESG A;  4LGN A;  5FQD A;  2YBA A;  2I0S A;  2G99 A;  4O45 A;  5EAL A;  4CZV A;  3EI3 B;  4CZY A;  3BG1 A;  2OK6 A;  3PSL A;  5CXB A;  2XL3 A;  3U4Y A;  1RI6 A;  2P9I C;  1U2V C;  2I0R A;  2GC4 A;  4H5J A;  5TDH B;  2H47 A;  3PSC B;  2XU7 A;  1K32 A;  4Y5R D;  3OW8 A;  2IWK A;  2IUQ A;  2CE8 A;  4ZOX A;  4A0A B;  2H6K A;  3JPX A;  5HE3 B;  2P9S C;  3SHF A;  5GSA A;  3E0C A;  4BH6 A;  3RSE C;  4FA1 D;  4JSN C;  5A2Q g;  4CI1 A;  3RFH A;  5FKR A;  5IT9 g;  4J79 A;  3SN6 B;  3SLE D;  4E54 A;  5HE1 B;  1PEV A;  4GZ8 A;  3UVL A;  3IIW A;  4X63 B;  4O3T B;  2W18 A;  4QT8 A;  4ZOV A;  4A08 B;  2B5N A;  2H9L A;  5B4W A;  3FRX A;  3FGB A;  1XHM A;  3NVQ A;  4GGC A;  4FAV D;  4J8G A;  3I7N A;  3SMR A;  3CFS B;  3MZL A;  3JZH A;  4ZOY A;  2Q7Q A;  5C2W B;  3I8E A;  5TF2 A;  3VA6 A;  5HYN B;  3I7H A;  4E54 B;  2BCJ B;  5FLX g;  5KDO B;  2Z2N A;  3VH0 A;  3OL2 B;  2B5M A;  5FKT A;  2YNO A;  3DSM A;  2IAA A;  1TYQ C;  2H14 A;  4A09 A;  4JXM A;  4L1Q D;  3C9C A;  3BG0 A;  3DXM C;  3I8C A;  2PM7 B;  4PSW B;  3UR4 A;  5IJ8 E;  4U7A A;  5EAR A;  3V5W B;  5FXY A;  3SBR A;  3ORV D;  4I79 A;  3EI1 A;  3K27 A;  1N6E A;  4CC9 A;  2HES X;  5SXM A;  5CYK A;  2HJ4 A;  3C5M A;  4MK0 B;  5K1C C;  3UVK A;  1Q47 A;  4FA5 D;  1PI6 A;  5EM2 B;  5GXH A;  3RMZ D;  4XYI A;  3JRP A;  4BUJ C;  3JZG A;  3OKW A;  5EML B;  4CY1 A;  4GQ1 A;  5TEE A;  2PM9 A;  2J57 G;  2H68 A;  1XIP A;  3ODT A;  3AL9 A;  2OVR B;  4Z8L A;  3BWS A;  2TRC B;  1A0R B;  4AEZ A;  3EI1 B;  3F3G A;  5C2V B;  2O9K A;  3SXT D;  3OKY B;  2CN2 A;  3EI2 A;  1GP2 B;  3RN1 D;  3V7D B;  1JMX B;  3C75 H;  5CYK B;  3PE7 A;  2G9A A;  3DM0 A;  4H5I A;  3SFZ A;  3AFC A;  4A08 A;  2GC7 A;  3PVU B;  3ZWL B;  3PXS D;  5K19 A;  3JB9 L;  1PGU A;  2P9L C;  2PM9 B;  2UZY B;  4JT5 C;  1P22 A;  5EAP A;  2B4E A;  3NVN A;  5H1M A;  4HDJ A;  1MG3 A;  4X61 B;  3CFV A;  4K3I D;  3ULE C;  2AH0 A;  4GQB B;  1JMZ B;  3W15 A;  3F3P A;  1B9X A;  4GGA A;  2H3X A;  1QNI A;  4YVD A;  4CZX A;  3EI2 B;  3OL2 A;  5AMS A;  1MDA H;  4D0K A;  2OVQ B;  4QL1 A;  1SQ9 A;  5CXC B;  4IA9 A;  3RN0 D;  1JOF A;  3PXW D;  2J55 H;  4IMM A;  3SCY A;  2HYE A;  2CNX A;  2P9N C;  5GXI A;  1S4U X;  4NSX A;  4CY3 A;  2XL2 A;  3B7F A;  2YMU A;  3MKQ A;  4LG9 A;  4ERY A;  4PBY A;  3I7P A;  4JT6 C;  1FWX A;  4J77 A;  3I7L A;  2HJB A;  3JZN A;  2OIZ A;  5EMM B;  2H9P A;  5EM2 A;  2H9N A;  1OLZ A;  4A0B A;  4CY2 A;  4PNK B;  1OMW B;  3EI4 A;  4J81 A;  3HFQ A;  1SHY B;  5EAM A;  4O3U B;  2MTA H;  4E5Z B;  4R7A B;  4OWR A;  3J81 g;  2YNP A;  1N6D A;  1NR0 A;  3SWS D;  4JD2 C;  5H17 A;  2GNQ A;  3SBQ A;  4X60 B;  4G56 B;  3OKY A;  4J82 A;  1GG2 B;  4EWR A;  2OVP B;  2H6N A;  3GFC A;  5IGO A;  3MMY A;  5HQG A;  2CN3 A;  3VGZ A;  2P9P C;  4PC0 A;  2P9U C;  5IGQ A;  5FKQ A;  2H9M A;  4A0B B;  3UKU C;  4FHL A;  4GM9 A;  3MXX A;  4PSX B;  1N6F A;  2B5L A;  3EI4 B;  5GMK n;  2I3T A;  2AGY A;  4TZ4 A;  1TBG A;  4A11 A;  4UI9 R;  1B9Y A;  4XYH A;  3IJ1 A;  3L4O D;  1L0Q A;  1R5M A;  4GM3 A;  2AGZ A;  5TEF A;  5AJA A;  1JJU B;  4L9O A;  3C99 A;  3L4M D;  4GGD A;  5IJ7 E;  3SJL D;  2AH1 A;  3JAM g;  3IJC A;  4JSV C;  4L3H D;  1VYH C;  4K3J B;  5CXC A;  4ERQ A;  4PXW A;  5FKS A;  2PBI B;  2CE9 A;  2HKR A;  3EMH A;  3UVO A;  2J56 H;  2AGL A;  5FA5 B;  4XEI C;  2QC5 A;  4OZU A;  4X3E A;  4A11 B;  5AFU 3;  3EU7 A;  3V9F A;  3SBP A;  2IUP A;  2Z2O A;  5JWZ A;  4J8B A;  1GXR A;  2IWF A;  3N0E A;  4FAN D;  2HXC A;  2I0T A;  4J73 A;  4ES0 A;  3K26 A;  4L3G D;  3I89 A;  4Y7R A;  4BL0 A;  4JSP C;  2YNN A;  4CY5 A;  4QRJ A;  3GRE A;  2Z2P A;  4JSX C;  3AH8 B;  4E5Z A;  2AGW A;  3IIY A;  2P9K C;  4J78 A;  3DWL C;  3PVW B;  3AL8 A;  3I7K A;  3NVX A;  4FA9 D;  2OK4 A;  2CO0 C;  2BBK H;  3DXK C;  4U1E I;  3RLM D;  3P4F A;  3MZK A;  3A0F A;  3SVW D;  1NEX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...