3EMHA

Structural basis of wdr5-mll interaction
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
300
structure length
300
Chain Sequence
PNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WD repeat-containing protein 5
publication title WDR5 Interacts with Mixed Lineage Leukemia (MLL) Protein via the Histone H3-binding Pocket.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
total genus 100
structure length 300
sequence length 300
ec nomenclature
pdb deposition date 2008-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3emhA00
2I0TA 4J84A 4PXWA 4FAVD 1N6DA 4EWRA 2Z2PA 5EM2B 3F3GA 4ZOZA 2OIZA 3IIWA 5C9ZB 5I5IA 5K1CC 1FWXA 4FA4D 1PEVA 3MKQA 2XL3A 4X60B 3F3PA 4AOWA 3MMYA 5THAA 3UVNA 2B5LA 2J57G 3EI2B 2XYIA 3PVWB 2H6NA 1YFQA 5CXBB 1GXRA 4PC0A 3DSMA 3PSLA 3EG6A 3F3FA 3L4MD 4E5ZA 2GNQA 3K26A 5CXCA 1MG2A 3IKOA 4E54B 3I7LA 4YVDA 4GM8A 2PM9B 2HKMA 3C5MA 3UVLA 4BL0A 4CZVA 3AFCA 4JT6C 2IUVA 5IGQA 5GXIA 4ZN4A 3W15A 3JRPA 2P9UC 1U2VC 1S4UX 3PSCB 3V5WB 3MZLA 5JWZA 5GMKn 4A2LA 2J55H 3UVKA 5GSAA 4CZYA 4FA1D 4D0KA 3RSEC 3KRWB 5EARA 5IT9g 3SCYA 4JD2C 4CC9A 1R5MA 4J0WA 3SWSD 3SBQA 2QXVA 4KFMB 2BCJB 3AL8B 4CI8A 4FB1D 3OL2A 4ERZA 3SHFA 2J56H 4PBYA 5FKSA 5SXMA 4ZOYA 2PM7B 2IWFA 3I8CA 2H3XA 2H9PA 2OK4A 4GMBA 4FA5D 4FWWA 1VYHC 3UVOA 1P22A 4CI3A 1XHMA 4GM3A 5AMSA 4JSNC 3EI1A 5FLXg 2B5MA 2YMUA 3EI4A 3OW8A 2UZXB 4IA9A 4I79A 5HE2B 3VA6A 5K19A 5FQDA 4GQ2P 2TRCB 5I5JA 4FHLA 3E0CA 1GG2B 1ERJA 2IUQA 1JMXB 1Q47A 3DWLC 2Z2OA 4QQEA 2HESX 3I7KA 4NSXA 2AGLA 3JZGA 3I7OA 4A0BB 3GFCA 2HYEA 1XIPA 5TEEA 2CE9A 2H6QA 5IC7A 3SN6B 3AL9A 4AEZA 2GC7A 4IMMA 4JSPC 1RI6A 5EMMB 2CN3A 3EU7A 2CNXA 2AGXA 5I5MA 3B7FA 4ES0A 4J82A 4JXMA 4CY2A 1K8KC 1NEXB 4J8BA 2B5NA 4O45A 5FKTA 3UKRC 3UR4A 4A0AA 2CO0C 4LGNA 4ESGA 3OKTA 4TZ4A 5IJ8E 3V7DB 3P4FA 3SFZA 4A2MA 2AH0A 4OZUA 5CYKB 5TF2A 1N6FA 3I7NA 1JMZB 2AGWA 2AH1A 2H9LA 2OVRB 1OLZA 1N6EA 4JT5C 3RLMD 3FGBA 4BUJC 2HXCA 4CY5A 2CE8A 2YB8B 5EMKB 2I3TA 2P9PC 2PM6B 3C75H 4CZXA 2YNPA 3BWSA 4ZOVA 3DM0A 4CY3A 4FA9D 3MXXA 4OWRA 4UI9R 4A11A 3RN1D 2EBSA 4LG9A 2P9KC 2PBIB 4JSXC 3KRXB 4O9DA 4R7AB 2CO0A 4A08A 4X63B 3RFHA 3SXTD 4J86A 3RFGA 1L0QA 5FKQA 3RRMC 4PBZA 1B9XA 5H1MA 4E5ZB 5CXCB 2AGYA 3NVXA 2I0SA 1NR0A 3ORVD 5TEFA 1A0RB 5HE3B 1SQJA 5HE0B 5FA5B 1TBGA 2H9MA 3OKYA 2O9KA 4QL1A 3OTTA 4A09A 4CI1A 3HFQA 4XEIC 4HDJA 3FM0A 5A2Qg 3PXWD 4K3ID 2Z2NA 4J0XA 4GZ8A 5C2WB 4L3GD 3MKSB 5IGOA 4O3UB 4J79A 3RMZD 3EI3A 3BG1A 4N14A 2XL2A 3IJ0A 3K27A 3NVNA 2HJBA 3OL2B 3SBPA 2G99A 4XYHA 3ULEC 3PXTD 3CIKB 3IJ1A 3JROA 2CN2A 5HE1B 3JB9L 5IJ7E 3SJLD 3C9CA 3EI4B 5H14A 2I0RA 2YNNA 3SMRA 2OVQB 5EM2A 3FRXA 3ODTA 3A0FA 2IURA 5B4WA 4GQ1A 1MG3A 3J80g 4Y7RA 2H68A 1OMWB 2H13A 5EAPA 3L4OD 3EI2A 4J73A 3UVMA 2W18A 5CXBA 2OVPB 4BH6A 1TYQC 4U1EI 3JAMg 4J8GA 4U7AA 4LG8A 1B9YA 1K32A 2H6KA 5EAMA 2GC4A 3PVUB 4E54A 1XKSA 2P9NC 4MK0B 2HJ4A 2PM9A 5TDHB 4ERQA 4FAND 4GGAA 3GREA 3NVQA 5H17A 2HKRA 2UZYB 4GGCA 2P9SC 3DXKC 4A0AB 3RN0D 2H14A 3C99A 3I89A 2G9AA 2OK6A 2XU7A 3EWEA 4D6VA 2BBKH 3CFVA 5FXYA 4G56B 4CI2A 2I3SA 3U4YA 3OKWA 1U4CA 2B4EA 3VH0A 3JZHA 3AL8A 3J81g 3IIYA 4PNKB 2H9NA 4L3HD 1PI6A 5AFU3 1PGUA 2IAAA 3IJCA 4J78A 3EMHA 4PSWB 4A11B 4X61B 4ZOXA 4Y5RD 4K3JB 1PBYB 3CFSB 5AJAA 4A08B 3N0DA 4O1QD 4PSXB 4A7JA 3DXMC 2IWKA 1SQ9A 3BG0A 1JOFA 3I7HA 2P9IC 4GQBB 5GXHA 3VGZA 5HQGA 4QRJA 3N0EA 2Q7QA 4GGDA 3I8EA 4A0BA 2MTAH 4J87A 4JSVC 4QT8A 3OKYB 3SBRA 1JJUB 5EMLB 4CY1A 4J77A 3I2NA 4XYIA 2AQ5A 4A09B 3SLED 3AH8B 4H5IA 5HYNB 3MZKA 5EMJB 4H5JA 3EI1B 2P9LC 3EI3B 4O3TB 3V9FA 2AGZA 2IUPA 4ERYA 5EALA 5FKRA 3I7PA 1SHYB 4J81A 1MDAH 3PE7A 4L9OA 3SVWD 2OJYA 3ZWLB 1GP2B 5CYKA 3JPXA 4Z8LA 3PXSD 2YBAA 2YNOA 4X3EA 1GOTB 4GM9A 3JZNA 2QC5A 5C2VB 1QNIA 2H47A 4L1QD 3UKUC 5KDOB
chains in the Genus database with same CATH superfamily
4QAMA 2I0TA 4J84A 4PXWA 4FAVD 5M5VA 5E6UA 1N6DA 4EWRA 2Z2PA 5EM2B 3F3GA 4ZOZA 2OIZA 3IIWA 5C9ZB 5I5IA 5K1CC 1FWXA 1C9IA 3NIFA 1PEVA 4FA4D 3MKQA 2QZPA 2VZ1A 2JKXA 1VE7A 2XL3A 4X60B 3F3PA 4G55A 4AOWA 3MMYA 5THAA 3FCUA 2B5LA 2J57G 3UVNA 2XYIA 3EI2B 3PVWB 2H6NA 1O6GA 1YFQA 3ZDZA 5CXBB 1E8MA 1GXRA 4PC0A 3VI3A 3DSMA 3PSLA 3EG6A 3F3FA 3L4MD 4E5ZA 2GNQA 3K26A 5CXCA 1MG2A 4BCDA 3IKOA 4E54B 1L5GA 3I7LA 4YVDA 2VDPA 4GM8A 2PM9B 2HKMA 3C5MA 3UVLA 4MMZA 4NENA 4BL0A 4CZVA 3AFCA 4JT6C 2VDLA 2IUVA 5IGQA 5GXIA 4ZN4A 4NAAA 3W15A 3JRPA 3IJEA 2P9UC 1U2VC 1S4UX 3PSCB 4MMXA 3V5WB 3MZLA 2VDMA 5JWZA 4DNUA 3IUNA 5GMKn 3O4HA 4A2LA 2J55H 1JTDB 1VZ3A 3UVKA 5GSAA 4CZYA 2VDOA 4FA1D 4D0KA 3RSEC 3KRWB 1C9LA 5EARA 5IT9g 3SCYA 4JD2C 1U8CA 1R5MA 4J0WA 3SWSD 4CC9A 3SBQA 2QXVA 4KFMB 2BCJB 4JHPC 3AL8B 4CI8A 4FB1D 3OL2A 4ERZA 3SHFA 2J56H 4PBYA 5FKSA 5SXMA 4ZOYA 2PM7B 2IWFA 3I8CA 2H3XA 2H9PA 2OK4A 4GMBA 4FA5D 5M5UA 4FWWA 1VYHC 3UVOA 1P22A 4AN1A 4CI3A 2HU7A 4O02A 4G1MA 1XHMA 4NC4A 4GM3A 1QFSA 5AMSA 4JSNC 3EI1A 5FLXg 2B5MA 2YMUA 3EI4A 4WJKA 3IULA 3OW8A 2UZXB 3ZE2A 4IA9A 4I79A 5HE2B 2XDWA 4DNVA 3VA6A 2HU5A 5K19A 1VE6A 5FQDA 4GQ2P 2TRCB 5I5JA 4FHLA 3E0CA 1GG2B 1ERJA 2IUQA 1JMXB 1Q47A 3DWLC 2Z2OA 4QQEA 2HESX 3QI0A 3I7KA 4NSXA 2AGLA 3JZGA 3I7OA 4A0BB 3GFCA 2HYEA 1XIPA 5TEEA 2CE9A 2H6QA 5IC7A 3SN6B 3AL9A 1E5TA 2GC7A 4IMMA 4AEZA 4JSPC 4L1MA 4WK0A 1RI6A 5EMMB 2CN3A 3EU7A 5E6SA 2CNXA 2AGXA 3GD1I 5I5MA 3B7FA 4ES0A 2VDNA 4J82A 4JXMA 5FFGA 4CY2A 1K8KC 1NEXB 4J8BA 2B5NA 4O45A 5FKTA 3UKRC 3UR4A 4A0AA 4AMZA 3IUJA 2CO0C 4LGNA 4ESGA 3OKTA 3K71A 4TZ4A 5IJ8E 3V7DB 3P4FA 2EIEA 3SFZA 4A2MA 2AH0A 3MVDK 1UOOA 4OZUA 5CYKB 5TF2A 1N6FA 3I7NA 1JMZB 4D9SA 2AGWA 2AH1A 2H9LA 2OVRB 1OLZA 1N6EA 4JT5C 3RLMD 1BPOA 3EQ7A 3FGBA 4BUJC 2HXCA 4BCCA 4CY5A 2CE8A 2YB8B 3OF7A 2I3TA 2P9PC 5EMKB 2PM6B 5E6RA 3C75H 4CZXA 2YNPA 3BWSA 4ZOVA 3KCIA 3DM0A 4CY3A 3ZE0A 4FA9D 3MXXA 1GOHA 4OWRA 3V4VA 4UI9R 4A11A 3RN1D 2EBSA 2HU8A 4LG9A 2P9KC 2PBIB 4JSXC 5M61A 3KRXB 4O9DA 4R7AB 2CO0A 4A08A 4X63B 3RFHA 3SXTD 4J86A 3RFGA 1L0QA 5FKQA 3RRMC 4PBZA 1B9XA 5H1MA 3ZDYA 4E5ZB 1T2XA 5CXCB 2AGYA 3NVXA 2I0SA 1NR0A 3ORVD 5TEFA 1H2WA 3DDUA 1A0RB 5HE3B 1SQJA 1H2ZA 5HE0B 1QFMA 1TBGA 5FA5B 2H9MA 3OKYA 2O9KA 1A12A 3OTTA 4QL1A 4A09A 4CI1A 3HFQA 4XEIC 4HDJA 1JV2A 3FM0A 5A2Qg 3PXWD 4K3ID 2Z2NA 4J0XA 4GZ8A 5C2WB 4L3GD 5C92A 2EIDA 3MKSB 5IGOA 2XE4A 4O3UB 4J79A 3RMZD 3EI3A 1H2XA 3BG1A 4N14A 2XL2A 3IJ0A 3K27A 5M5TA 3K72A 3NVNA 2VDRA 3T3MA 2HJBA 3OL2B 3SBPA 2G99A 4XYHA 1M1XA 3ULEC 3PXTD 3CIKB 3IJ1A 1O6FA 3JROA 2CN2A 5HE1B 3JB9L 4BP9A 4AN0A 5IJ7E 3SJLD 4Z7OA 3C9CA 3IUMA 2QR5A 3EI4B 5H14A 2I0RA 2YNNA 3IURA 3FCSA 1E8NA 3SMRA 2OVQB 1UOQA 5EM2A 3FRXA 3ODTA 5M5SA 3A0FA 2IURA 5B4WA 4GQ1A 1MG3A 3IUQA 3J80g 4Y7RA 2H68A 1OMWB 2H13A 2WQ8A 5EAPA 3L4OD 3EI2A 4J73A 3UVMA 2W18A 5CXBA 2OVPB 3GC3B 1TYQC 4BH6A 4U1EI 3JAMg 4J8GA 3O4IA 4UM8A 4U7AA 1B9YA 4LG8A 1K32A 2H6KA 2VC2A 2GC4A 3PVUB 5EAMA 1XKSA 4E54A 1K3IA 2P9NC 4MK0B 2HJ4A 2PM9A 3IVMA 5TDHB 4ERQA 4FAND 4GGAA 3GREA 3NVQA 5H17A 4AX4A 2HKRA 3NIGA 2UZYB 4GGCA 2P9SC 3DXKC 4A0AB 3RN0D 2H14A 3C99A 3I89A 2G9AA 2OK6A 2XU7A 5FFOA 3EWEA 3VI4A 4D6VA 2BBKH 3CFVA 3NIDA 4WK2A 1UTCA 5FXYA 4Z7QA 4G56B 4Z7NA 4CI2A 2EIBA 3MUNA 4DNWA 2BKLA 2I3SA 3U4YA 3OKWA 1U4CA 2B4EA 3VH0A 3JZHA 3AL8A 1GOGA 3J81g 4G1EA 3IIYA 4PNKB 2H9NA 4L3HD 1GOFA 1PI6A 2XZGA 5AFU3 1PGUA 2IAAA 1TYEA 2VZ3A 3IJCA 4J78A 3EQ9A 3ZE1A 3EMHA 4PSWB 4A11B 4X61B 4ZOXA 4Y5RD 3QHYB 4K3JB 5HDBA 1PBYB 3CFSB 3K6SA 5AJAA 4A08B 3N0DA 4O1QD 4PSXB 4A7JA 3DXMC 2IWKA 1SQ9A 3BG0A 2VDKA 1JOFA 3I7HA 2P9IC 4GQBB 4WK4A 3T3PA 1I2MB 5GXHA 3VGZA 3ZDXA 5HQGA 4QRJA 3N0EA 2Q7QA 4JHNA 4GGDA 4BP8A 3I8EA 5C86A 4A0BA 4UM9A 2MTAH 4AMYA 4J87A 4JSVC 4QT8A 3OKYB 4RE5A 3SBRA 3V4PA 1JJUB 5EMLB 4CY1A 4J77A 3I2NA 4XYIA 2AQ5A 4IRZA 4A09B 3SLED 3AH8B 4H5IA 4O2WA 5HYNB 3MZKA 5EMJB 4H5JA 1VZ2A 2EICA 3EI1B 4MMYA 4NBMA 2P9LC 3EI3B 4O3TB 3V9FA 2AGZA 4RE6A 2IUPA 3O4JA 4ERYA 5EALA 5FKRA 3I7PA 1SHYB 4J81A 1MDAH 3PE7A 1YR2A 4L9OA 3SVWD 2OJYA 1UOPA 3O4GA 3ZWLB 1GP2B 2VDQA 5CYKA 3JPXA 4Z8LA 3PXSD 2YBAA 3EQ8A 5M5RA 2YNOA 4X3EA 1GOTB 4GM9A 4BCBA 3JZNA 3MUOA 2QC5A 5C2VB 1QNIA 1H2YA 2H47A 4L1QD 3UKUC 5KDOB
chains in the Genus database with same CATH topology
2I0TA 4J84A 4PXWA 4FAVD 1N6DA 4EWRA 2Z2PA 5EM2B 3F3GA 4ZOZA 2OIZA 3IIWA 5C9ZB 5I5IA 5K1CC 1FWXA 4FA4D 1PEVA 3MKQA 2XL3A 4X60B 3F3PA 4AOWA 3MMYA 5THAA 3UVNA 2B5LA 2J57G 3EI2B 2XYIA 3PVWB 2H6NA 1YFQA 5CXBB 1GXRA 4PC0A 3DSMA 3PSLA 3EG6A 3F3FA 3L4MD 4E5ZA 2GNQA 3K26A 5CXCA 1MG2A 3IKOA 4E54B 3I7LA 4YVDA 4GM8A 2PM9B 2HKMA 3C5MA 3UVLA 4BL0A 4CZVA 3AFCA 4JT6C 2IUVA 5IGQA 5GXIA 4ZN4A 3W15A 3JRPA 2P9UC 1U2VC 1S4UX 3PSCB 3V5WB 3MZLA 5JWZA 5GMKn 4A2LA 2J55H 3UVKA 5GSAA 4CZYA 4FA1D 4D0KA 3RSEC 3KRWB 5EARA 5IT9g 3SCYA 4JD2C 4CC9A 1R5MA 4J0WA 3SWSD 3SBQA 2QXVA 4KFMB 2BCJB 3AL8B 4CI8A 4FB1D 3OL2A 4ERZA 3SHFA 2J56H 4PBYA 5FKSA 5SXMA 4ZOYA 2PM7B 2IWFA 3I8CA 2H3XA 2H9PA 2OK4A 4GMBA 4FA5D 4FWWA 1VYHC 3UVOA 1P22A 4CI3A 1XHMA 4GM3A 5AMSA 4JSNC 3EI1A 5FLXg 2B5MA 2YMUA 3EI4A 3OW8A 2UZXB 4IA9A 4I79A 5HE2B 3VA6A 5K19A 5FQDA 4GQ2P 2TRCB 5I5JA 4FHLA 3E0CA 1GG2B 1ERJA 2IUQA 1JMXB 1Q47A 3DWLC 2Z2OA 4QQEA 2HESX 3I7KA 4NSXA 2AGLA 3JZGA 3I7OA 4A0BB 3GFCA 2HYEA 1XIPA 5TEEA 2CE9A 2H6QA 5IC7A 3SN6B 3AL9A 4AEZA 2GC7A 4IMMA 4JSPC 1RI6A 5EMMB 2CN3A 3EU7A 2CNXA 2AGXA 5I5MA 3B7FA 4ES0A 4J82A 4JXMA 4CY2A 1K8KC 1NEXB 4J8BA 2B5NA 4O45A 5FKTA 3UKRC 3UR4A 4A0AA 2CO0C 4LGNA 4ESGA 3OKTA 4TZ4A 5IJ8E 3V7DB 3P4FA 3SFZA 4A2MA 2AH0A 4OZUA 5CYKB 5TF2A 1N6FA 3I7NA 1JMZB 2AGWA 2AH1A 2H9LA 2OVRB 1OLZA 1N6EA 4JT5C 3RLMD 3FGBA 4BUJC 2HXCA 4CY5A 2CE8A 2YB8B 5EMKB 2I3TA 2P9PC 2PM6B 3C75H 4CZXA 2YNPA 3BWSA 4ZOVA 3DM0A 4CY3A 4FA9D 3MXXA 4OWRA 4UI9R 4A11A 3RN1D 2EBSA 4LG9A 2P9KC 2PBIB 4JSXC 3KRXB 4O9DA 4R7AB 2CO0A 4A08A 4X63B 3RFHA 3SXTD 4J86A 3RFGA 1L0QA 5FKQA 3RRMC 4PBZA 1B9XA 5H1MA 4E5ZB 5CXCB 2AGYA 3NVXA 2I0SA 1NR0A 3ORVD 5TEFA 1A0RB 5HE3B 1SQJA 5HE0B 5FA5B 1TBGA 2H9MA 3OKYA 2O9KA 4QL1A 3OTTA 4A09A 4CI1A 3HFQA 4XEIC 4HDJA 3FM0A 5A2Qg 3PXWD 4K3ID 2Z2NA 4J0XA 4GZ8A 5C2WB 4L3GD 3MKSB 5IGOA 4O3UB 4J79A 3RMZD 3EI3A 3BG1A 4N14A 2XL2A 3IJ0A 3K27A 3NVNA 2HJBA 3OL2B 3SBPA 2G99A 4XYHA 3ULEC 3PXTD 3CIKB 3IJ1A 3JROA 2CN2A 5HE1B 3JB9L 5IJ7E 3SJLD 3C9CA 3EI4B 5H14A 2I0RA 2YNNA 3SMRA 2OVQB 5EM2A 3FRXA 3ODTA 3A0FA 2IURA 5B4WA 4GQ1A 1MG3A 3J80g 4Y7RA 2H68A 1OMWB 2H13A 5EAPA 3L4OD 3EI2A 4J73A 3UVMA 2W18A 5CXBA 2OVPB 4BH6A 1TYQC 4U1EI 3JAMg 4J8GA 4U7AA 4LG8A 1B9YA 1K32A 2H6KA 5EAMA 2GC4A 3PVUB 4E54A 1XKSA 2P9NC 4MK0B 2HJ4A 2PM9A 5TDHB 4ERQA 4FAND 4GGAA 3GREA 3NVQA 5H17A 2HKRA 2UZYB 4GGCA 2P9SC 3DXKC 4A0AB 3RN0D 2H14A 3C99A 3I89A 2G9AA 2OK6A 2XU7A 3EWEA 4D6VA 2BBKH 3CFVA 5FXYA 4G56B 4CI2A 2I3SA 3U4YA 3OKWA 1U4CA 2B4EA 3VH0A 3JZHA 3AL8A 3J81g 3IIYA 4PNKB 2H9NA 4L3HD 1PI6A 5AFU3 1PGUA 2IAAA 3IJCA 4J78A 3EMHA 4PSWB 4A11B 4X61B 4ZOXA 4Y5RD 4K3JB 1PBYB 3CFSB 5AJAA 4A08B 3N0DA 4O1QD 4PSXB 4A7JA 3DXMC 2IWKA 1SQ9A 3BG0A 1JOFA 3I7HA 2P9IC 4GQBB 5GXHA 3VGZA 5HQGA 4QRJA 3N0EA 2Q7QA 4GGDA 3I8EA 4A0BA 2MTAH 4J87A 4JSVC 4QT8A 3OKYB 3SBRA 1JJUB 5EMLB 4CY1A 4J77A 3I2NA 4XYIA 2AQ5A 4A09B 3SLED 3AH8B 4H5IA 5HYNB 3MZKA 5EMJB 4H5JA 3EI1B 2P9LC 3EI3B 4O3TB 3V9FA 2AGZA 2IUPA 4ERYA 5EALA 5FKRA 3I7PA 1SHYB 4J81A 1MDAH 3PE7A 4L9OA 3SVWD 2OJYA 3ZWLB 1GP2B 5CYKA 3JPXA 4Z8LA 3PXSD 2YBAA 2YNOA 4X3EA 1GOTB 4GM9A 3JZNA 2QC5A 5C2VB 1QNIA 2H47A 4L1QD 3UKUC 5KDOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I0T A;  4J84 A;  4PXW A;  4FAV D;  1N6D A;  4EWR A;  2Z2P A;  5EM2 B;  3F3G A;  4ZOZ A;  2OIZ A;  3IIW A;  5C9Z B;  5I5I A;  5K1C C;  1FWX A;  4FA4 D;  1PEV A;  3MKQ A;  2XL3 A;  4X60 B;  3F3P A;  4AOW A;  3MMY A;  5THA A;  3UVN A;  2B5L A;  2J57 G;  3EI2 B;  2XYI A;  3PVW B;  2H6N A;  1YFQ A;  5CXB B;  1GXR A;  4PC0 A;  3DSM A;  3PSL A;  3EG6 A;  3F3F A;  3L4M D;  4E5Z A;  2GNQ A;  3K26 A;  5CXC A;  1MG2 A;  3IKO A;  4E54 B;  3I7L A;  4YVD A;  4GM8 A;  2PM9 B;  2HKM A;  3C5M A;  3UVL A;  4BL0 A;  4CZV A;  3AFC A;  4JT6 C;  2IUV A;  5IGQ A;  5GXI A;  4ZN4 A;  3W15 A;  3JRP A;  2P9U C;  1U2V C;  1S4U X;  3PSC B;  3V5W B;  3MZL A;  5JWZ A;  5GMK n;  4A2L A;  2J55 H;  3UVK A;  5GSA A;  4CZY A;  4FA1 D;  4D0K A;  3RSE C;  3KRW B;  5EAR A;  5IT9 g;  3SCY A;  4JD2 C;  4CC9 A;  1R5M A;  4J0W A;  3SWS D;  3SBQ A;  2QXV A;  4KFM B;  2BCJ B;  3AL8 B;  4CI8 A;  4FB1 D;  3OL2 A;  4ERZ A;  3SHF A;  2J56 H;  4PBY A;  5FKS A;  5SXM A;  4ZOY A;  2PM7 B;  2IWF A;  3I8C A;  2H3X A;  2H9P A;  2OK4 A;  4GMB A;  4FA5 D;  4FWW A;  1VYH C;  3UVO A;  1P22 A;  4CI3 A;  1XHM A;  4GM3 A;  5AMS A;  4JSN C;  3EI1 A;  5FLX g;  2B5M A;  2YMU A;  3EI4 A;  3OW8 A;  2UZX B;  4IA9 A;  4I79 A;  5HE2 B;  3VA6 A;  5K19 A;  5FQD A;  4GQ2 P;  2TRC B;  5I5J A;  4FHL A;  3E0C A;  1GG2 B;  1ERJ A;  2IUQ A;  1JMX B;  1Q47 A;  3DWL C;  2Z2O A;  4QQE A;  2HES X;  3I7K A;  4NSX A;  2AGL A;  3JZG A;  3I7O A;  4A0B B;  3GFC A;  2HYE A;  1XIP A;  5TEE A;  2CE9 A;  2H6Q A;  5IC7 A;  3SN6 B;  3AL9 A;  4AEZ A;  2GC7 A;  4IMM A;  4JSP C;  1RI6 A;  5EMM B;  2CN3 A;  3EU7 A;  2CNX A;  2AGX A;  5I5M A;  3B7F A;  4ES0 A;  4J82 A;  4JXM A;  4CY2 A;  1K8K C;  1NEX B;  4J8B A;  2B5N A;  4O45 A;  5FKT A;  3UKR C;  3UR4 A;  4A0A A;  2CO0 C;  4LGN A;  4ESG A;  3OKT A;  4TZ4 A;  5IJ8 E;  3V7D B;  3P4F A;  3SFZ A;  4A2M A;  2AH0 A;  4OZU A;  5CYK B;  5TF2 A;  1N6F A;  3I7N A;  1JMZ B;  2AGW A;  2AH1 A;  2H9L A;  2OVR B;  1OLZ A;  1N6E A;  4JT5 C;  3RLM D;  3FGB A;  4BUJ C;  2HXC A;  4CY5 A;  2CE8 A;  2YB8 B;  5EMK B;  2I3T A;  2P9P C;  2PM6 B;  3C75 H;  4CZX A;  2YNP A;  3BWS A;  4ZOV A;  3DM0 A;  4CY3 A;  4FA9 D;  3MXX A;  4OWR A;  4UI9 R;  4A11 A;  3RN1 D;  2EBS A;  4LG9 A;  2P9K C;  2PBI B;  4JSX C;  3KRX B;  4O9D A;  4R7A B;  2CO0 A;  4A08 A;  4X63 B;  3RFH A;  3SXT D;  4J86 A;  3RFG A;  1L0Q A;  5FKQ A;  3RRM C;  4PBZ A;  1B9X A;  5H1M A;  4E5Z B;  5CXC B;  2AGY A;  3NVX A;  2I0S A;  1NR0 A;  3ORV D;  5TEF A;  1A0R B;  5HE3 B;  1SQJ A;  5HE0 B;  5FA5 B;  1TBG A;  2H9M A;  3OKY A;  2O9K A;  4QL1 A;  3OTT A;  4A09 A;  4CI1 A;  3HFQ A;  4XEI C;  4HDJ A;  3FM0 A;  5A2Q g;  3PXW D;  4K3I D;  2Z2N A;  4J0X A;  4GZ8 A;  5C2W B;  4L3G D;  3MKS B;  5IGO A;  4O3U B;  4J79 A;  3RMZ D;  3EI3 A;  3BG1 A;  4N14 A;  2XL2 A;  3IJ0 A;  3K27 A;  3NVN A;  2HJB A;  3OL2 B;  3SBP A;  2G99 A;  4XYH A;  3ULE C;  3PXT D;  3CIK B;  3IJ1 A;  3JRO A;  2CN2 A;  5HE1 B;  3JB9 L;  5IJ7 E;  3SJL D;  3C9C A;  3EI4 B;  5H14 A;  2I0R A;  2YNN A;  3SMR A;  2OVQ B;  5EM2 A;  3FRX A;  3ODT A;  3A0F A;  2IUR A;  5B4W A;  4GQ1 A;  1MG3 A;  3J80 g;  4Y7R A;  2H68 A;  1OMW B;  2H13 A;  5EAP A;  3L4O D;  3EI2 A;  4J73 A;  3UVM A;  2W18 A;  5CXB A;  2OVP B;  4BH6 A;  1TYQ C;  4U1E I;  3JAM g;  4J8G A;  4U7A A;  4LG8 A;  1B9Y A;  1K32 A;  2H6K A;  5EAM A;  2GC4 A;  3PVU B;  4E54 A;  1XKS A;  2P9N C;  4MK0 B;  2HJ4 A;  2PM9 A;  5TDH B;  4ERQ A;  4FAN D;  4GGA A;  3GRE A;  3NVQ A;  5H17 A;  2HKR A;  2UZY B;  4GGC A;  2P9S C;  3DXK C;  4A0A B;  3RN0 D;  2H14 A;  3C99 A;  3I89 A;  2G9A A;  2OK6 A;  2XU7 A;  3EWE A;  4D6V A;  2BBK H;  3CFV A;  5FXY A;  4G56 B;  4CI2 A;  2I3S A;  3U4Y A;  3OKW A;  1U4C A;  2B4E A;  3VH0 A;  3JZH A;  3AL8 A;  3J81 g;  3IIY A;  4PNK B;  2H9N A;  4L3H D;  1PI6 A;  5AFU 3;  1PGU A;  2IAA A;  3IJC A;  4J78 A;  3EMH A;  4PSW B;  4A11 B;  4X61 B;  4ZOX A;  4Y5R D;  4K3J B;  1PBY B;  3CFS B;  5AJA A;  4A08 B;  3N0D A;  4O1Q D;  4PSX B;  4A7J A;  3DXM C;  2IWK A;  1SQ9 A;  3BG0 A;  1JOF A;  3I7H A;  2P9I C;  4GQB B;  5GXH A;  3VGZ A;  5HQG A;  4QRJ A;  3N0E A;  2Q7Q A;  4GGD A;  3I8E A;  4A0B A;  2MTA H;  4J87 A;  4JSV C;  4QT8 A;  3OKY B;  3SBR A;  1JJU B;  5EML B;  4CY1 A;  4J77 A;  3I2N A;  4XYI A;  2AQ5 A;  4A09 B;  3SLE D;  3AH8 B;  4H5I A;  5HYN B;  3MZK A;  5EMJ B;  4H5J A;  3EI1 B;  2P9L C;  3EI3 B;  4O3T B;  3V9F A;  2AGZ A;  2IUP A;  4ERY A;  5EAL A;  5FKR A;  3I7P A;  1SHY B;  4J81 A;  1MDA H;  3PE7 A;  4L9O A;  3SVW D;  2OJY A;  3ZWL B;  1GP2 B;  5CYK A;  3JPX A;  4Z8L A;  3PXS D;  2YBA A;  2YNO A;  4X3E A;  1GOT B;  4GM9 A;  3JZN A;  2QC5 A;  5C2V B;  1QNI A;  2H47 A;  4L1Q D;  3UKU C;  5KDO B; 
#chains in the Genus database with same CATH topology
 4QAM A;  2I0T A;  4J84 A;  4PXW A;  4FAV D;  5M5V A;  5E6U A;  1N6D A;  4EWR A;  2Z2P A;  5EM2 B;  3F3G A;  4ZOZ A;  2OIZ A;  3IIW A;  5C9Z B;  5I5I A;  5K1C C;  1FWX A;  1C9I A;  3NIF A;  1PEV A;  4FA4 D;  3MKQ A;  2QZP A;  2VZ1 A;  2JKX A;  1VE7 A;  2XL3 A;  4X60 B;  3F3P A;  4G55 A;  4AOW A;  3MMY A;  5THA A;  3FCU A;  2B5L A;  2J57 G;  3UVN A;  2XYI A;  3EI2 B;  3PVW B;  2H6N A;  1O6G A;  1YFQ A;  3ZDZ A;  5CXB B;  1E8M A;  1GXR A;  4PC0 A;  3VI3 A;  3DSM A;  3PSL A;  3EG6 A;  3F3F A;  3L4M D;  4E5Z A;  2GNQ A;  3K26 A;  5CXC A;  1MG2 A;  4BCD A;  3IKO A;  4E54 B;  1L5G A;  3I7L A;  4YVD A;  2VDP A;  4GM8 A;  2PM9 B;  2HKM A;  3C5M A;  3UVL A;  4MMZ A;  4NEN A;  4BL0 A;  4CZV A;  3AFC A;  4JT6 C;  2VDL A;  2IUV A;  5IGQ A;  5GXI A;  4ZN4 A;  4NAA A;  3W15 A;  3JRP A;  3IJE A;  2P9U C;  1U2V C;  1S4U X;  3PSC B;  4MMX A;  3V5W B;  3MZL A;  2VDM A;  5JWZ A;  4DNU A;  3IUN A;  5GMK n;  3O4H A;  4A2L A;  2J55 H;  1JTD B;  1VZ3 A;  3UVK A;  5GSA A;  4CZY A;  2VDO A;  4FA1 D;  4D0K A;  3RSE C;  3KRW B;  1C9L A;  5EAR A;  5IT9 g;  3SCY A;  4JD2 C;  1U8C A;  1R5M A;  4J0W A;  3SWS D;  4CC9 A;  3SBQ A;  2QXV A;  4KFM B;  2BCJ B;  4JHP C;  3AL8 B;  4CI8 A;  4FB1 D;  3OL2 A;  4ERZ A;  3SHF A;  2J56 H;  4PBY A;  5FKS A;  5SXM A;  4ZOY A;  2PM7 B;  2IWF A;  3I8C A;  2H3X A;  2H9P A;  2OK4 A;  4GMB A;  4FA5 D;  5M5U A;  4FWW A;  1VYH C;  3UVO A;  1P22 A;  4AN1 A;  4CI3 A;  2HU7 A;  4O02 A;  4G1M A;  1XHM A;  4NC4 A;  4GM3 A;  1QFS A;  5AMS A;  4JSN C;  3EI1 A;  5FLX g;  2B5M A;  2YMU A;  3EI4 A;  4WJK A;  3IUL A;  3OW8 A;  2UZX B;  3ZE2 A;  4IA9 A;  4I79 A;  5HE2 B;  2XDW A;  4DNV A;  3VA6 A;  2HU5 A;  5K19 A;  1VE6 A;  5FQD A;  4GQ2 P;  2TRC B;  5I5J A;  4FHL A;  3E0C A;  1GG2 B;  1ERJ A;  2IUQ A;  1JMX B;  1Q47 A;  3DWL C;  2Z2O A;  4QQE A;  2HES X;  3QI0 A;  3I7K A;  4NSX A;  2AGL A;  3JZG A;  3I7O A;  4A0B B;  3GFC A;  2HYE A;  1XIP A;  5TEE A;  2CE9 A;  2H6Q A;  5IC7 A;  3SN6 B;  3AL9 A;  1E5T A;  2GC7 A;  4IMM A;  4AEZ A;  4JSP C;  4L1M A;  4WK0 A;  1RI6 A;  5EMM B;  2CN3 A;  3EU7 A;  5E6S A;  2CNX A;  2AGX A;  3GD1 I;  5I5M A;  3B7F A;  4ES0 A;  2VDN A;  4J82 A;  4JXM A;  5FFG A;  4CY2 A;  1K8K C;  1NEX B;  4J8B A;  2B5N A;  4O45 A;  5FKT A;  3UKR C;  3UR4 A;  4A0A A;  4AMZ A;  3IUJ A;  2CO0 C;  4LGN A;  4ESG A;  3OKT A;  3K71 A;  4TZ4 A;  5IJ8 E;  3V7D B;  3P4F A;  2EIE A;  3SFZ A;  4A2M A;  2AH0 A;  3MVD K;  1UOO A;  4OZU A;  5CYK B;  5TF2 A;  1N6F A;  3I7N A;  1JMZ B;  4D9S A;  2AGW A;  2AH1 A;  2H9L A;  2OVR B;  1OLZ A;  1N6E A;  4JT5 C;  3RLM D;  1BPO A;  3EQ7 A;  3FGB A;  4BUJ C;  2HXC A;  4BCC A;  4CY5 A;  2CE8 A;  2YB8 B;  3OF7 A;  2I3T A;  2P9P C;  5EMK B;  2PM6 B;  5E6R A;  3C75 H;  4CZX A;  2YNP A;  3BWS A;  4ZOV A;  3KCI A;  3DM0 A;  4CY3 A;  3ZE0 A;  4FA9 D;  3MXX A;  1GOH A;  4OWR A;  3V4V A;  4UI9 R;  4A11 A;  3RN1 D;  2EBS A;  2HU8 A;  4LG9 A;  2P9K C;  2PBI B;  4JSX C;  5M61 A;  3KRX B;  4O9D A;  4R7A B;  2CO0 A;  4A08 A;  4X63 B;  3RFH A;  3SXT D;  4J86 A;  3RFG A;  1L0Q A;  5FKQ A;  3RRM C;  4PBZ A;  1B9X A;  5H1M A;  3ZDY A;  4E5Z B;  1T2X A;  5CXC B;  2AGY A;  3NVX A;  2I0S A;  1NR0 A;  3ORV D;  5TEF A;  1H2W A;  3DDU A;  1A0R B;  5HE3 B;  1SQJ A;  1H2Z A;  5HE0 B;  1QFM A;  1TBG A;  5FA5 B;  2H9M A;  3OKY A;  2O9K A;  1A12 A;  3OTT A;  4QL1 A;  4A09 A;  4CI1 A;  3HFQ A;  4XEI C;  4HDJ A;  1JV2 A;  3FM0 A;  5A2Q g;  3PXW D;  4K3I D;  2Z2N A;  4J0X A;  4GZ8 A;  5C2W B;  4L3G D;  5C92 A;  2EID A;  3MKS B;  5IGO A;  2XE4 A;  4O3U B;  4J79 A;  3RMZ D;  3EI3 A;  1H2X A;  3BG1 A;  4N14 A;  2XL2 A;  3IJ0 A;  3K27 A;  5M5T A;  3K72 A;  3NVN A;  2VDR A;  3T3M A;  2HJB A;  3OL2 B;  3SBP A;  2G99 A;  4XYH A;  1M1X A;  3ULE C;  3PXT D;  3CIK B;  3IJ1 A;  1O6F A;  3JRO A;  2CN2 A;  5HE1 B;  3JB9 L;  4BP9 A;  4AN0 A;  5IJ7 E;  3SJL D;  4Z7O A;  3C9C A;  3IUM A;  2QR5 A;  3EI4 B;  5H14 A;  2I0R A;  2YNN A;  3IUR A;  3FCS A;  1E8N A;  3SMR A;  2OVQ B;  1UOQ A;  5EM2 A;  3FRX A;  3ODT A;  5M5S A;  3A0F A;  2IUR A;  5B4W A;  4GQ1 A;  1MG3 A;  3IUQ A;  3J80 g;  4Y7R A;  2H68 A;  1OMW B;  2H13 A;  2WQ8 A;  5EAP A;  3L4O D;  3EI2 A;  4J73 A;  3UVM A;  2W18 A;  5CXB A;  2OVP B;  3GC3 B;  1TYQ C;  4BH6 A;  4U1E I;  3JAM g;  4J8G A;  3O4I A;  4UM8 A;  4U7A A;  1B9Y A;  4LG8 A;  1K32 A;  2H6K A;  2VC2 A;  2GC4 A;  3PVU B;  5EAM A;  1XKS A;  4E54 A;  1K3I A;  2P9N C;  4MK0 B;  2HJ4 A;  2PM9 A;  3IVM A;  5TDH B;  4ERQ A;  4FAN D;  4GGA A;  3GRE A;  3NVQ A;  5H17 A;  4AX4 A;  2HKR A;  3NIG A;  2UZY B;  4GGC A;  2P9S C;  3DXK C;  4A0A B;  3RN0 D;  2H14 A;  3C99 A;  3I89 A;  2G9A A;  2OK6 A;  2XU7 A;  5FFO A;  3EWE A;  3VI4 A;  4D6V A;  2BBK H;  3CFV A;  3NID A;  4WK2 A;  1UTC A;  5FXY A;  4Z7Q A;  4G56 B;  4Z7N A;  4CI2 A;  2EIB A;  3MUN A;  4DNW A;  2BKL A;  2I3S A;  3U4Y A;  3OKW A;  1U4C A;  2B4E A;  3VH0 A;  3JZH A;  3AL8 A;  1GOG A;  3J81 g;  4G1E A;  3IIY A;  4PNK B;  2H9N A;  4L3H D;  1GOF A;  1PI6 A;  2XZG A;  5AFU 3;  1PGU A;  2IAA A;  1TYE A;  2VZ3 A;  3IJC A;  4J78 A;  3EQ9 A;  3ZE1 A;  3EMH A;  4PSW B;  4A11 B;  4X61 B;  4ZOX A;  4Y5R D;  3QHY B;  4K3J B;  5HDB A;  1PBY B;  3CFS B;  3K6S A;  5AJA A;  4A08 B;  3N0D A;  4O1Q D;  4PSX B;  4A7J A;  3DXM C;  2IWK A;  1SQ9 A;  3BG0 A;  2VDK A;  1JOF A;  3I7H A;  2P9I C;  4GQB B;  4WK4 A;  3T3P A;  1I2M B;  5GXH A;  3VGZ A;  3ZDX A;  5HQG A;  4QRJ A;  3N0E A;  2Q7Q A;  4JHN A;  4GGD A;  4BP8 A;  3I8E A;  5C86 A;  4A0B A;  4UM9 A;  2MTA H;  4AMY A;  4J87 A;  4JSV C;  4QT8 A;  3OKY B;  4RE5 A;  3SBR A;  3V4P A;  1JJU B;  5EML B;  4CY1 A;  4J77 A;  3I2N A;  4XYI A;  2AQ5 A;  4IRZ A;  4A09 B;  3SLE D;  3AH8 B;  4H5I A;  4O2W A;  5HYN B;  3MZK A;  5EMJ B;  4H5J A;  1VZ2 A;  2EIC A;  3EI1 B;  4MMY A;  4NBM A;  2P9L C;  3EI3 B;  4O3T B;  3V9F A;  2AGZ A;  4RE6 A;  2IUP A;  3O4J A;  4ERY A;  5EAL A;  5FKR A;  3I7P A;  1SHY B;  4J81 A;  1MDA H;  3PE7 A;  1YR2 A;  4L9O A;  3SVW D;  2OJY A;  1UOP A;  3O4G A;  3ZWL B;  1GP2 B;  2VDQ A;  5CYK A;  3JPX A;  4Z8L A;  3PXS D;  2YBA A;  3EQ8 A;  5M5R A;  2YNO A;  4X3E A;  1GOT B;  4GM9 A;  4BCB A;  3JZN A;  3MUO A;  2QC5 A;  5C2V B;  1QNI A;  1H2Y A;  2H47 A;  4L1Q D;  3UKU C;  5KDO B; 
#chains in the Genus database with same CATH homology
 2I0T A;  4J84 A;  4PXW A;  4FAV D;  1N6D A;  4EWR A;  2Z2P A;  5EM2 B;  3F3G A;  4ZOZ A;  2OIZ A;  3IIW A;  5C9Z B;  5I5I A;  5K1C C;  1FWX A;  4FA4 D;  1PEV A;  3MKQ A;  2XL3 A;  4X60 B;  3F3P A;  4AOW A;  3MMY A;  5THA A;  3UVN A;  2B5L A;  2J57 G;  3EI2 B;  2XYI A;  3PVW B;  2H6N A;  1YFQ A;  5CXB B;  1GXR A;  4PC0 A;  3DSM A;  3PSL A;  3EG6 A;  3F3F A;  3L4M D;  4E5Z A;  2GNQ A;  3K26 A;  5CXC A;  1MG2 A;  3IKO A;  4E54 B;  3I7L A;  4YVD A;  4GM8 A;  2PM9 B;  2HKM A;  3C5M A;  3UVL A;  4BL0 A;  4CZV A;  3AFC A;  4JT6 C;  2IUV A;  5IGQ A;  5GXI A;  4ZN4 A;  3W15 A;  3JRP A;  2P9U C;  1U2V C;  1S4U X;  3PSC B;  3V5W B;  3MZL A;  5JWZ A;  5GMK n;  4A2L A;  2J55 H;  3UVK A;  5GSA A;  4CZY A;  4FA1 D;  4D0K A;  3RSE C;  3KRW B;  5EAR A;  5IT9 g;  3SCY A;  4JD2 C;  4CC9 A;  1R5M A;  4J0W A;  3SWS D;  3SBQ A;  2QXV A;  4KFM B;  2BCJ B;  3AL8 B;  4CI8 A;  4FB1 D;  3OL2 A;  4ERZ A;  3SHF A;  2J56 H;  4PBY A;  5FKS A;  5SXM A;  4ZOY A;  2PM7 B;  2IWF A;  3I8C A;  2H3X A;  2H9P A;  2OK4 A;  4GMB A;  4FA5 D;  4FWW A;  1VYH C;  3UVO A;  1P22 A;  4CI3 A;  1XHM A;  4GM3 A;  5AMS A;  4JSN C;  3EI1 A;  5FLX g;  2B5M A;  2YMU A;  3EI4 A;  3OW8 A;  2UZX B;  4IA9 A;  4I79 A;  5HE2 B;  3VA6 A;  5K19 A;  5FQD A;  4GQ2 P;  2TRC B;  5I5J A;  4FHL A;  3E0C A;  1GG2 B;  1ERJ A;  2IUQ A;  1JMX B;  1Q47 A;  3DWL C;  2Z2O A;  4QQE A;  2HES X;  3I7K A;  4NSX A;  2AGL A;  3JZG A;  3I7O A;  4A0B B;  3GFC A;  2HYE A;  1XIP A;  5TEE A;  2CE9 A;  2H6Q A;  5IC7 A;  3SN6 B;  3AL9 A;  4AEZ A;  2GC7 A;  4IMM A;  4JSP C;  1RI6 A;  5EMM B;  2CN3 A;  3EU7 A;  2CNX A;  2AGX A;  5I5M A;  3B7F A;  4ES0 A;  4J82 A;  4JXM A;  4CY2 A;  1K8K C;  1NEX B;  4J8B A;  2B5N A;  4O45 A;  5FKT A;  3UKR C;  3UR4 A;  4A0A A;  2CO0 C;  4LGN A;  4ESG A;  3OKT A;  4TZ4 A;  5IJ8 E;  3V7D B;  3P4F A;  3SFZ A;  4A2M A;  2AH0 A;  4OZU A;  5CYK B;  5TF2 A;  1N6F A;  3I7N A;  1JMZ B;  2AGW A;  2AH1 A;  2H9L A;  2OVR B;  1OLZ A;  1N6E A;  4JT5 C;  3RLM D;  3FGB A;  4BUJ C;  2HXC A;  4CY5 A;  2CE8 A;  2YB8 B;  5EMK B;  2I3T A;  2P9P C;  2PM6 B;  3C75 H;  4CZX A;  2YNP A;  3BWS A;  4ZOV A;  3DM0 A;  4CY3 A;  4FA9 D;  3MXX A;  4OWR A;  4UI9 R;  4A11 A;  3RN1 D;  2EBS A;  4LG9 A;  2P9K C;  2PBI B;  4JSX C;  3KRX B;  4O9D A;  4R7A B;  2CO0 A;  4A08 A;  4X63 B;  3RFH A;  3SXT D;  4J86 A;  3RFG A;  1L0Q A;  5FKQ A;  3RRM C;  4PBZ A;  1B9X A;  5H1M A;  4E5Z B;  5CXC B;  2AGY A;  3NVX A;  2I0S A;  1NR0 A;  3ORV D;  5TEF A;  1A0R B;  5HE3 B;  1SQJ A;  5HE0 B;  5FA5 B;  1TBG A;  2H9M A;  3OKY A;  2O9K A;  4QL1 A;  3OTT A;  4A09 A;  4CI1 A;  3HFQ A;  4XEI C;  4HDJ A;  3FM0 A;  5A2Q g;  3PXW D;  4K3I D;  2Z2N A;  4J0X A;  4GZ8 A;  5C2W B;  4L3G D;  3MKS B;  5IGO A;  4O3U B;  4J79 A;  3RMZ D;  3EI3 A;  3BG1 A;  4N14 A;  2XL2 A;  3IJ0 A;  3K27 A;  3NVN A;  2HJB A;  3OL2 B;  3SBP A;  2G99 A;  4XYH A;  3ULE C;  3PXT D;  3CIK B;  3IJ1 A;  3JRO A;  2CN2 A;  5HE1 B;  3JB9 L;  5IJ7 E;  3SJL D;  3C9C A;  3EI4 B;  5H14 A;  2I0R A;  2YNN A;  3SMR A;  2OVQ B;  5EM2 A;  3FRX A;  3ODT A;  3A0F A;  2IUR A;  5B4W A;  4GQ1 A;  1MG3 A;  3J80 g;  4Y7R A;  2H68 A;  1OMW B;  2H13 A;  5EAP A;  3L4O D;  3EI2 A;  4J73 A;  3UVM A;  2W18 A;  5CXB A;  2OVP B;  4BH6 A;  1TYQ C;  4U1E I;  3JAM g;  4J8G A;  4U7A A;  4LG8 A;  1B9Y A;  1K32 A;  2H6K A;  5EAM A;  2GC4 A;  3PVU B;  4E54 A;  1XKS A;  2P9N C;  4MK0 B;  2HJ4 A;  2PM9 A;  5TDH B;  4ERQ A;  4FAN D;  4GGA A;  3GRE A;  3NVQ A;  5H17 A;  2HKR A;  2UZY B;  4GGC A;  2P9S C;  3DXK C;  4A0A B;  3RN0 D;  2H14 A;  3C99 A;  3I89 A;  2G9A A;  2OK6 A;  2XU7 A;  3EWE A;  4D6V A;  2BBK H;  3CFV A;  5FXY A;  4G56 B;  4CI2 A;  2I3S A;  3U4Y A;  3OKW A;  1U4C A;  2B4E A;  3VH0 A;  3JZH A;  3AL8 A;  3J81 g;  3IIY A;  4PNK B;  2H9N A;  4L3H D;  1PI6 A;  5AFU 3;  1PGU A;  2IAA A;  3IJC A;  4J78 A;  3EMH A;  4PSW B;  4A11 B;  4X61 B;  4ZOX A;  4Y5R D;  4K3J B;  1PBY B;  3CFS B;  5AJA A;  4A08 B;  3N0D A;  4O1Q D;  4PSX B;  4A7J A;  3DXM C;  2IWK A;  1SQ9 A;  3BG0 A;  1JOF A;  3I7H A;  2P9I C;  4GQB B;  5GXH A;  3VGZ A;  5HQG A;  4QRJ A;  3N0E A;  2Q7Q A;  4GGD A;  3I8E A;  4A0B A;  2MTA H;  4J87 A;  4JSV C;  4QT8 A;  3OKY B;  3SBR A;  1JJU B;  5EML B;  4CY1 A;  4J77 A;  3I2N A;  4XYI A;  2AQ5 A;  4A09 B;  3SLE D;  3AH8 B;  4H5I A;  5HYN B;  3MZK A;  5EMJ B;  4H5J A;  3EI1 B;  2P9L C;  3EI3 B;  4O3T B;  3V9F A;  2AGZ A;  2IUP A;  4ERY A;  5EAL A;  5FKR A;  3I7P A;  1SHY B;  4J81 A;  1MDA H;  3PE7 A;  4L9O A;  3SVW D;  2OJY A;  3ZWL B;  1GP2 B;  5CYK A;  3JPX A;  4Z8L A;  3PXS D;  2YBA A;  2YNO A;  4X3E A;  1GOT B;  4GM9 A;  3JZN A;  2QC5 A;  5C2V B;  1QNI A;  2H47 A;  4L1Q D;  3UKU C;  5KDO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...