3EMHA

Structural basis of wdr5-mll interaction
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
300
structure length
300
Chain Sequence
b'PNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WD repeat-containing protein 5
molecule tags Gene regulation
source organism Homo sapiens
publication title WDR5 Interacts with Mixed Lineage Leukemia (MLL) Protein via the Histone H3-binding Pocket.
pubmed doi rcsb
total genus 100
structure length 300
sequence length 300
ec nomenclature
pdb deposition date 2008-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3emhA00
5GMKn 2PM6B 2IUQA 2CO0C 3OL2A 2H3XA 3EI1A 1NEXB 5EALA 4U7AA 4A08A 3AH8B 4PNKB 3RFGA 4J86A 5IGOA 4J77A 5FKRA 3KRXB 3DM0A 4Y5RD 2CE9A 4K3ID 3F3PA 3W15A 4EWRA 2P9PC 5I5IA 4PSXB 3MZKA 5AMSA 2AH1A 2B4EA 1GXRA 1MDAH 3SWSD 3I89A 3PSCB 3SJLD 3F3GA 5IGQA 1ERJA 4J8BA 2GNQA 2OJYA 2PM9A 1TBGA 1N6FA 3IKOA 3EG6A 3JZNA 4JD2C 3SLED 2H9PA 1B9YA 4A0AB 5HE0B 3EU7A 3K27A 4G56B 2B5MA 3KRWB 4O3UB 1PI6A 4AOWA 4L1QD 4ZN4A 4I79A 4J87A 3U4YA 3NVNA 5H14A 2YNPA 5EMMB 4XYIA 1OMWB 2P9SC 4Y7RA 1XIPA 4HDJA 2BCJB 2AGXA 4O3TB 4ERZA 1K8KC 2H9LA 2HJ4A 4GM9A 4FA9D 2IWKA 2PM7B 4A2LA 3UR4A 5FQDA 2OVRB 2YMUA 4JSPC 4E54B 5CXCA 3JPXA 1QNIA 2CN3A 4ZOXA 5EMLB 4QL1A 5GSAA 3E0CA 3PVUB 3N0EA 3DXMC 1PBYB 3OKYB 5HQGA 2HKMA 2I3SA 4GQ2P 5CXBA 3HFQA 5IJ8E 2HJBA 3V9FA 2J57G 4A2MA 2Z2PA 4X60B 3ODTA 1NR0A 3OW8A 5HE3B 4ZOVA 2XL2A 4GMBA 3I7NA 3SBQA 4PC0A 2H6QA 3AL8B 3GFCA 4QQEA 3PXWD 4O9DA 4FHLA 3I2NA 3EMHA 3UVKA 4CY5A 2I0TA 4ES0A 1RI6A 2H68A 4E5ZA 5IT9g 4PXWA 1SQ9A 4QT8A 3CFVA 4JSVC 3JROA 3AFCA 3RFHA 4L3HD 5FKTA 4TZ4A 5EMJB 4D6VA 1B9XA 2H9NA 3MKSB 5KDOB 3DWLC 3MZLA 3CFSB 3PXSD 4JSNC 3B7FA 3UKRC 1MG2A 4J8GA 4E54A 5TF2A 3SCYA 2H6KA 2XYIA 1N6EA 3BG0A 2BBKH 3A0FA 5TDHB 5AJAA 4J79A 3C9CA 4LG9A 3SHFA 1JOFA 4N14A 2XU7A 2EBSA 5CYKA 3VA6A 4L9OA 3C75H 3SBRA 2I0RA 4YVDA 1A0RB 4FWWA 4J0XA 2OVPB 4CY1A 5FA5B 4U1EI 5AFU3 3EI2A 2P9IC 1MG3A 4XYHA 3N0DA 2OVQB 3UVNA 2H13A 2P9LC 4L3GD 5EM2A 1Q47A 1U2VC 5THAA 3V7DB 2J55H 4GGAA 4O45A 4O1QD 2AGYA 2H14A 5C2WB 2IURA 4KFMB 3BWSA 5HE1B 3JRPA 3SXTD 4JT5C 5FKSA 5K19A 5IC7A 2HESX 2QXVA 5C2VB 3J81g 4FB1D 3AL9A 2O9KA 3EI2B 5EMKB 2QC5A 4J82A 1R5MA 3EWEA 3C99A 3I7PA 5FKQA 4ZOZA 3SFZA 3I7HA 3NVQA 1FWXA 5CXBB 3SBPA 2B5LA 5HYNB 3I7KA 1SHYB 3VGZA 5CYKB 3MKQA 5SXMA 2G99A 5H1MA 5K1CC 1S4UX 4A7JA 5H17A 4X63B 1VYHC 3I8EA 4A08B 5EM2B 1PGUA 1JMZB 4QRJA 4A0AA 3UVLA 1N6DA 5HE2B 3RRMC 2AGZA 3IJ1A 2AH0A 2G9AA 5B4WA 4CI1A 3RMZD 4D0KA 2OIZA 4JT6C 3EI4B 4A09A 1L0QA 2TRCB 3CIKB 4FAND 4E5ZB 3I7OA 3BG1A 3OKYA 3J80g 2W18A 1XHMA 4JSXC 4JXMA 4FAVD 3AL8A 2HXCA 2CN2A 3SVWD 4CI3A 2I3TA 1TYQC 3DSMA 2GC7A 3GREA 4BUJC 2IAAA 3K26A 4H5JA 4J0WA 3ZWLB 2CNXA 2J56H 2YNNA 4MK0B 4H5IA 4NSXA 4BH6A 2AGLA 4GZ8A 3UVOA 4ESGA 3RN1D 4UI9R 4BL0A 2CO0A 5FLXg 5CXCB 1GP2B 3IJ0A 4A11B 3EI1B 4J84A 3JAMg 4J73A 4CY3A 1U4CA 3FGBA 3JZGA 3L4MD 1P22A 4X61B 2H6NA 2XL3A 1K32A 4FA1D 4GGDA 3MMYA 4AEZA 4ZOYA 4OZUA 3RN0D 2Z2NA 2P9KC 4GQBB 2OK6A 3EI3A 3JB9L 3RLMD 3L4OD 3IIWA 2YBAA 1JJUB 3OTTA 3PXTD 3IIYA 4X3EA 2OK4A 2IUVA 5I5MA 4J81A 2PM9B 2IUPA 4K3JB 2AQ5A 5FXYA 3OL2B 4GQ1A 2IWFA 1GG2B 4A11A 4CI8A 5JWZA 4PBYA 4A0BB 5EAPA 3EI3B 4GM8A 2P9UC 3SMRA 5A2Qg 4CZXA 3V5WB 5TEEA 3I7LA 3FM0A 2UZXB 3SN6B 4CZVA 3PVWB 3P4FA 4CY2A 4GGCA 3OKTA 4FA5D 2PBIB 4GM3A 5IJ7E 3UKUC 3NVXA 4PBZA 5C9ZB 3MXXA 4J78A 5GXHA 4LGNA 5I5JA 3PE7A 3ORVD 2H9MA 2YNOA 1PEVA 1YFQA 2UZYB 4ERQA 2HYEA 3I8CA 4R7AB 3EI4A 4A09B 2Q7QA 3ULEC 4ERYA 2Z2OA 4IA9A 2GC4A 2MTAH 5TEFA 3C5MA 2P9NC 4CZYA 5EARA 2YB8B 3RSEC 3VH0A 3FRXA 1JMXB 3IJCA 4CI2A 5GXIA 2H47A 1GOTB 3PSLA 4IMMA 2I0SA 1SQJA 2CE8A 3UVMA 2AGWA 5EAMA 4PSWB 1XKSA 3F3FA 3JZHA 4XEIC 4LG8A 4OWRA 2B5NA 3DXKC 4FA4D 2HKRA 4Z8LA 1OLZA 3OKWA 4A0BA 4CC9A
chains in the Genus database with same CATH superfamily
5GMKn 4AN1A 2PM6B 2IUQA 2CO0C 3OL2A 4AMZA 2H3XA 3EI1A 1NEXB 5EALA 1H2XA 4IRZA 4U7AA 4A08A 3AH8B 4PNKB 3RFGA 4J86A 5IGOA 4J77A 4G1EA 5FKRA 3T3MA 3KRXB 3DM0A 4Y5RD 2CE9A 4K3ID 3F3PA 3W15A 4EWRA 2P9PC 5I5IA 4PSXB 3MZKA 5AMSA 2AH1A 2HU5A 3K71A 2B4EA 1GXRA 1MDAH 3SWSD 3I89A 3PSCB 2BKLA 3SJLD 3F3GA 5IGQA 1ERJA 4J8BA 2GNQA 2OJYA 2PM9A 1TBGA 1N6FA 3IKOA 3EG6A 3JZNA 4JD2C 3SLED 2H9PA 1B9YA 4BP9A 5HE0B 3EU7A 4A0AB 3K27A 4G56B 2B5MA 4JHPC 3KRWB 4O3UB 1PI6A 4AOWA 4L1QD 4ZN4A 4I79A 4NC4A 2EIDA 1H2YA 4J87A 3U4YA 3NVNA 5H14A 2YNPA 3K72A 5EMMB 5E6SA 4XYIA 1OMWB 2P9SC 4Y7RA 1XIPA 4HDJA 2BCJB 1VE6A 2AGXA 4O3TB 4ERZA 1K8KC 2H9LA 2HJ4A 4GM9A 4FA9D 4DNWA 2IWKA 2PM7B 4A2LA 3ZDZA 5M5SA 1C9IA 3UR4A 5FQDA 2OVRB 2YMUA 4JSPC 4E54B 5CXCA 3JPXA 1QNIA 1T2XA 2CN3A 4ZOXA 5EMLB 4QL1A 5GSAA 4WK2A 3E0CA 3PVUB 4Z7NA 3N0EA 3DXMC 4G1MA 1PBYB 3OKYB 3NIFA 5HQGA 2HKMA 3EQ7A 2I3SA 4GQ2P 4NENA 5CXBA 3HFQA 5IJ8E 4QAMA 2HJBA 3V9FA 2J57G 4A2MA 2Z2PA 4X60B 3ODTA 1NR0A 3OW8A 4WJKA 5HE3B 4ZOVA 2XL2A 3FCSA 1JV2A 4GMBA 3I7NA 3SBQA 1I2MB 4PC0A 2H6QA 3AL8B 1UOPA 3GFCA 4QQEA 1E8NA 3PXWD 4O9DA 4FHLA 3K6SA 3I2NA 2VDRA 3EMHA 3UVKA 4CY5A 2I0TA 4ES0A 1RI6A 2H68A 4E5ZA 1QFMA 5IT9g 4PXWA 1SQ9A 4QT8A 1H2WA 3CFVA 4MMXA 4JSVC 3JROA 3AFCA 3RFHA 4L3HD 5FKTA 4TZ4A 1E5TA 5FFOA 3ZDYA 5EMJB 4AMYA 4D6VA 1B9XA 2H9NA 3MKSB 5KDOB 3DWLC 3MZLA 3PXSD 1M1XA 3CFSB 3OF7A 4JSNC 3B7FA 3UKRC 1MG2A 4J8GA 2VDKA 4E54A 5TF2A 5M61A 4DNVA 2XZGA 3SCYA 2H6KA 2XYIA 1VE7A 2VZ3A 3ZE0A 4AX4A 2JKXA 1N6EA 3BG0A 2BBKH 3A0FA 5TDHB 5AJAA 4DNUA 3EQ8A 4J79A 3C9CA 3EQ9A 4LG9A 3SHFA 1JOFA 4N14A 2XU7A 2EBSA 5CYKA 3VA6A 4L9OA 1H2ZA 3C75H 3SBRA 2I0RA 4YVDA 1A0RB 4FWWA 1C9LA 4J0XA 2OVPB 4CY1A 5M5UA 5FA5B 4U1EI 5AFU3 3EI2A 2P9IC 1MG3A 4XYHA 3N0DA 2OVQB 3T3PA 3UVNA 2H13A 5C92A 2P9LC 4L3GD 1L5GA 1BPOA 5EM2A 1Q47A 2VDLA 1U2VC 5THAA 3V7DB 2J55H 4GGAA 4O45A 4O1QD 2AGYA 2H14A 3IJEA 5C2WB 2IURA 4KFMB 3DDUA 3BWSA 5HE1B 3MVDK 3JRPA 2EICA 3SXTD 4JT5C 5FKSA 5K19A 5IC7A 3IUMA 2HESX 2QXVA 3V4PA 3O4GA 5C2VB 2VDPA 3J81g 4FB1D 3AL9A 2O9KA 3EI2B 5EMKB 2QC5A 4J82A 1R5MA 3EWEA 3C99A 3I7PA 1UOOA 5FKQA 4ZOZA 1VZ2A 3I7HA 3NVQA 3SFZA 1FWXA 3IUJA 5CXBB 3SBPA 2B5LA 5HYNB 3I7KA 1SHYB 3VGZA 4O02A 5CYKB 3MKQA 5SXMA 2G99A 3ZDXA 2XDWA 5H1MA 5K1CC 1S4UX 4UM9A 2EIEA 5H17A 4X63B 4A7JA 1VYHC 2WQ8A 3I8EA 4A08B 1E8MA 5EM2B 1PGUA 1YR2A 4RE5A 1JMZB 4QRJA 2XE4A 4AN0A 4A0AA 3UVLA 3O4IA 1N6DA 5HE2B 3RRMC 2AGZA 3IJ1A 2AH0A 3FCUA 2G9AA 5B4WA 4CI1A 3RMZD 4JHNA 4D0KA 2OIZA 4JT6C 3EI4B 4A09A 1L0QA 2TRCB 3CIKB 3O4HA 4FAND 4E5ZB 3I7OA 3BG1A 1GOHA 3OKYA 3J80g 2W18A 1XHMA 2QR5A 5M5VA 3GD1I 4JSXC 4JXMA 4FAVD 3AL8A 2HXCA 2CN2A 5M5RA 3NIDA 3SVWD 4CI3A 2I3TA 1K3IA 1TYQC 2VDMA 3DSMA 2GC7A 3GREA 4BUJC 2IAAA 3K26A 4H5JA 1U8CA 4J0WA 3ZWLB 2CNXA 2J56H 2YNNA 4MK0B 4H5IA 3IULA 4NSXA 4BH6A 2AGLA 4GZ8A 3UVOA 4BCBA 4ESGA 3MUOA 3RN1D 1O6FA 4UI9R 4BL0A 2CO0A 5FLXg 5CXCB 1GP2B 3IJ0A 5M5TA 5E6UA 4G55A 4A11B 4Z7OA 3EI1B 4MMZA 4O2WA 4J84A 3JAMg 4J73A 4CY3A 1O6GA 1U4CA 3FGBA 3JZGA 3L4MD 1P22A 3ZE2A 4NAAA 4X61B 2H6NA 2XL3A 1K32A 4WK0A 4FA1D 4GGDA 2VDOA 3MMYA 4AEZA 4ZOYA 2EIBA 4OZUA 3RN0D 2Z2NA 2P9KC 1TYEA 4GQBB 2OK6A 3EI3A 3JB9L 3RLMD 3L4OD 3IIWA 2YBAA 4NBMA 1JJUB 1QFSA 3OTTA 3V4VA 3PXTD 3IIYA 3NIGA 4X3EA 2OK4A 5FFGA 2IUVA 5I5MA 4J81A 2PM9B 2IUPA 4K3JB 2AQ5A 5C86A 3VI3A 1A12A 5FXYA 3OL2B 3IUNA 1UOQA 4GQ1A 2IWFA 1GG2B 4A11A 4CI8A 5JWZA 4PBYA 4A0BB 5EAPA 3EI3B 4GM8A 2P9UC 3SMRA 5A2Qg 4CZXA 3V5WB 5TEEA 3ZE1A 3I7LA 3FM0A 3O4JA 2UZXB 3SN6B 4CZVA 3PVWB 4WK4A 3VI4A 3P4FA 4CY2A 4GGCA 4UM8A 3QHYB 2VDQA 3OKTA 4FA5D 2PBIB 3IVMA 4Z7QA 4GM3A 3IURA 1JTDB 4BCDA 5IJ7E 3UKUC 3NVXA 3QI0A 4RE6A 4PBZA 5C9ZB 3MXXA 4J78A 5GXHA 4LGNA 4MMYA 2VC2A 5I5JA 3PE7A 1UTCA 3ORVD 2H9MA 2VZ1A 2YNOA 1PEVA 1YFQA 2UZYB 4ERQA 2HYEA 3KCIA 3I8CA 4R7AB 4D9SA 3EI4A 4BP8A 4A09B 2VDNA 2Q7QA 3ULEC 4ERYA 2Z2OA 4IA9A 2GC4A 3GC3B 2MTAH 5TEFA 1VZ3A 3C5MA 2P9NC 4CZYA 5EARA 2YB8B 3RSEC 3VH0A 3FRXA 1JMXB 3IJCA 4CI2A 5GXIA 2H47A 1GOTB 3PSLA 5HDBA 4IMMA 2I0SA 1SQJA 2CE8A 3UVMA 1GOFA 2HU7A 2AGWA 5EAMA 4PSWB 1XKSA 1GOGA 3F3FA 3JZHA 4LG8A 4XEIC 4L1MA 4OWRA 2B5NA 3DXKC 2QZPA 4FA4D 2HKRA 4Z8LA 3OKWA 1OLZA 3MUNA 4A0BA 5E6RA 4BCCA 3IUQA 4CC9A 2HU8A
chains in the Genus database with same CATH topology
5GMKn 2PM6B 2IUQA 2CO0C 3OL2A 2H3XA 3EI1A 1NEXB 5EALA 4U7AA 4A08A 3AH8B 4PNKB 3RFGA 4J86A 5IGOA 4J77A 5FKRA 3KRXB 3DM0A 4Y5RD 2CE9A 4K3ID 3F3PA 3W15A 4EWRA 2P9PC 5I5IA 4PSXB 3MZKA 5AMSA 2AH1A 2B4EA 1GXRA 1MDAH 3SWSD 3I89A 3PSCB 3SJLD 3F3GA 5IGQA 1ERJA 4J8BA 2GNQA 2OJYA 2PM9A 1TBGA 1N6FA 3IKOA 3EG6A 3JZNA 4JD2C 3SLED 2H9PA 1B9YA 4A0AB 5HE0B 3EU7A 3K27A 4G56B 2B5MA 3KRWB 4O3UB 1PI6A 4AOWA 4L1QD 4ZN4A 4I79A 4J87A 3U4YA 3NVNA 5H14A 2YNPA 5EMMB 4XYIA 1OMWB 2P9SC 4Y7RA 1XIPA 4HDJA 2BCJB 2AGXA 4O3TB 4ERZA 1K8KC 2H9LA 2HJ4A 4GM9A 4FA9D 2IWKA 2PM7B 4A2LA 3UR4A 5FQDA 2OVRB 2YMUA 4JSPC 4E54B 5CXCA 3JPXA 1QNIA 2CN3A 4ZOXA 5EMLB 4QL1A 5GSAA 3E0CA 3PVUB 3N0EA 3DXMC 1PBYB 3OKYB 5HQGA 2HKMA 2I3SA 4GQ2P 5CXBA 3HFQA 5IJ8E 2HJBA 3V9FA 2J57G 4A2MA 2Z2PA 4X60B 3ODTA 1NR0A 3OW8A 5HE3B 4ZOVA 2XL2A 4GMBA 3I7NA 3SBQA 4PC0A 2H6QA 3AL8B 3GFCA 4QQEA 3PXWD 4O9DA 4FHLA 3I2NA 3EMHA 3UVKA 4CY5A 2I0TA 4ES0A 1RI6A 2H68A 4E5ZA 5IT9g 4PXWA 1SQ9A 4QT8A 3CFVA 4JSVC 3JROA 3AFCA 3RFHA 4L3HD 5FKTA 4TZ4A 5EMJB 4D6VA 1B9XA 2H9NA 3MKSB 5KDOB 3DWLC 3MZLA 3CFSB 3PXSD 4JSNC 3B7FA 3UKRC 1MG2A 4J8GA 4E54A 5TF2A 3SCYA 2H6KA 2XYIA 1N6EA 3BG0A 2BBKH 3A0FA 5TDHB 5AJAA 4J79A 3C9CA 4LG9A 3SHFA 1JOFA 4N14A 2XU7A 2EBSA 5CYKA 3VA6A 4L9OA 3C75H 3SBRA 2I0RA 4YVDA 1A0RB 4FWWA 4J0XA 2OVPB 4CY1A 5FA5B 4U1EI 5AFU3 3EI2A 2P9IC 1MG3A 4XYHA 3N0DA 2OVQB 3UVNA 2H13A 2P9LC 4L3GD 5EM2A 1Q47A 1U2VC 5THAA 3V7DB 2J55H 4GGAA 4O45A 4O1QD 2AGYA 2H14A 5C2WB 2IURA 4KFMB 3BWSA 5HE1B 3JRPA 3SXTD 4JT5C 5FKSA 5K19A 5IC7A 2HESX 2QXVA 5C2VB 3J81g 4FB1D 3AL9A 2O9KA 3EI2B 5EMKB 2QC5A 4J82A 1R5MA 3EWEA 3C99A 3I7PA 5FKQA 4ZOZA 3SFZA 3I7HA 3NVQA 1FWXA 5CXBB 3SBPA 2B5LA 5HYNB 3I7KA 1SHYB 3VGZA 5CYKB 3MKQA 5SXMA 2G99A 5H1MA 5K1CC 1S4UX 4A7JA 5H17A 4X63B 1VYHC 3I8EA 4A08B 5EM2B 1PGUA 1JMZB 4QRJA 4A0AA 3UVLA 1N6DA 5HE2B 3RRMC 2AGZA 3IJ1A 2AH0A 2G9AA 5B4WA 4CI1A 3RMZD 4D0KA 2OIZA 4JT6C 3EI4B 4A09A 1L0QA 2TRCB 3CIKB 4FAND 4E5ZB 3I7OA 3BG1A 3OKYA 3J80g 2W18A 1XHMA 4JSXC 4JXMA 4FAVD 3AL8A 2HXCA 2CN2A 3SVWD 4CI3A 2I3TA 1TYQC 3DSMA 2GC7A 3GREA 4BUJC 2IAAA 3K26A 4H5JA 4J0WA 3ZWLB 2CNXA 2J56H 2YNNA 4MK0B 4H5IA 4NSXA 4BH6A 2AGLA 4GZ8A 3UVOA 4ESGA 3RN1D 4UI9R 4BL0A 2CO0A 5FLXg 5CXCB 1GP2B 3IJ0A 4A11B 3EI1B 4J84A 3JAMg 4J73A 4CY3A 1U4CA 3FGBA 3JZGA 3L4MD 1P22A 4X61B 2H6NA 2XL3A 1K32A 4FA1D 4GGDA 3MMYA 4AEZA 4ZOYA 4OZUA 3RN0D 2Z2NA 2P9KC 4GQBB 2OK6A 3EI3A 3JB9L 3RLMD 3L4OD 3IIWA 2YBAA 1JJUB 3OTTA 3PXTD 3IIYA 4X3EA 2OK4A 2IUVA 5I5MA 4J81A 2PM9B 2IUPA 4K3JB 2AQ5A 5FXYA 3OL2B 4GQ1A 2IWFA 1GG2B 4A11A 4CI8A 5JWZA 4PBYA 4A0BB 5EAPA 3EI3B 4GM8A 2P9UC 3SMRA 5A2Qg 4CZXA 3V5WB 5TEEA 3I7LA 3FM0A 2UZXB 3SN6B 4CZVA 3PVWB 3P4FA 4CY2A 4GGCA 3OKTA 4FA5D 2PBIB 4GM3A 5IJ7E 3UKUC 3NVXA 4PBZA 5C9ZB 3MXXA 4J78A 5GXHA 4LGNA 5I5JA 3PE7A 3ORVD 2H9MA 2YNOA 1PEVA 1YFQA 2UZYB 4ERQA 2HYEA 3I8CA 4R7AB 3EI4A 4A09B 2Q7QA 3ULEC 4ERYA 2Z2OA 4IA9A 2GC4A 2MTAH 5TEFA 3C5MA 2P9NC 4CZYA 5EARA 2YB8B 3RSEC 3VH0A 3FRXA 1JMXB 3IJCA 4CI2A 5GXIA 2H47A 1GOTB 3PSLA 4IMMA 2I0SA 1SQJA 2CE8A 3UVMA 2AGWA 5EAMA 4PSWB 1XKSA 3F3FA 3JZHA 4XEIC 4LG8A 4OWRA 2B5NA 3DXKC 4FA4D 2HKRA 4Z8LA 1OLZA 3OKWA 4A0BA 4CC9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GMK n;  2PM6 B;  2IUQ A;  2CO0 C;  3OL2 A;  2H3X A;  3EI1 A;  1NEX B;  5EAL A;  4U7A A;  4A08 A;  3AH8 B;  4PNK B;  3RFG A;  4J86 A;  5IGO A;  4J77 A;  5FKR A;  3KRX B;  3DM0 A;  4Y5R D;  2CE9 A;  4K3I D;  3F3P A;  3W15 A;  4EWR A;  2P9P C;  5I5I A;  4PSX B;  3MZK A;  5AMS A;  2AH1 A;  2B4E A;  1GXR A;  1MDA H;  3SWS D;  3I89 A;  3PSC B;  3SJL D;  3F3G A;  5IGQ A;  1ERJ A;  4J8B A;  2GNQ A;  2OJY A;  2PM9 A;  1TBG A;  1N6F A;  3IKO A;  3EG6 A;  3JZN A;  4JD2 C;  3SLE D;  2H9P A;  1B9Y A;  4A0A B;  5HE0 B;  3EU7 A;  3K27 A;  4G56 B;  2B5M A;  3KRW B;  4O3U B;  1PI6 A;  4AOW A;  4L1Q D;  4ZN4 A;  4I79 A;  4J87 A;  3U4Y A;  3NVN A;  5H14 A;  2YNP A;  5EMM B;  4XYI A;  1OMW B;  2P9S C;  4Y7R A;  1XIP A;  4HDJ A;  2BCJ B;  2AGX A;  4O3T B;  4ERZ A;  1K8K C;  2H9L A;  2HJ4 A;  4GM9 A;  4FA9 D;  2IWK A;  2PM7 B;  4A2L A;  3UR4 A;  5FQD A;  2OVR B;  2YMU A;  4JSP C;  4E54 B;  5CXC A;  3JPX A;  1QNI A;  2CN3 A;  4ZOX A;  5EML B;  4QL1 A;  5GSA A;  3E0C A;  3PVU B;  3N0E A;  3DXM C;  1PBY B;  3OKY B;  5HQG A;  2HKM A;  2I3S A;  4GQ2 P;  5CXB A;  3HFQ A;  5IJ8 E;  2HJB A;  3V9F A;  2J57 G;  4A2M A;  2Z2P A;  4X60 B;  3ODT A;  1NR0 A;  3OW8 A;  5HE3 B;  4ZOV A;  2XL2 A;  4GMB A;  3I7N A;  3SBQ A;  4PC0 A;  2H6Q A;  3AL8 B;  3GFC A;  4QQE A;  3PXW D;  4O9D A;  4FHL A;  3I2N A;  3EMH A;  3UVK A;  4CY5 A;  2I0T A;  4ES0 A;  1RI6 A;  2H68 A;  4E5Z A;  5IT9 g;  4PXW A;  1SQ9 A;  4QT8 A;  3CFV A;  4JSV C;  3JRO A;  3AFC A;  3RFH A;  4L3H D;  5FKT A;  4TZ4 A;  5EMJ B;  4D6V A;  1B9X A;  2H9N A;  3MKS B;  5KDO B;  3DWL C;  3MZL A;  3CFS B;  3PXS D;  4JSN C;  3B7F A;  3UKR C;  1MG2 A;  4J8G A;  4E54 A;  5TF2 A;  3SCY A;  2H6K A;  2XYI A;  1N6E A;  3BG0 A;  2BBK H;  3A0F A;  5TDH B;  5AJA A;  4J79 A;  3C9C A;  4LG9 A;  3SHF A;  1JOF A;  4N14 A;  2XU7 A;  2EBS A;  5CYK A;  3VA6 A;  4L9O A;  3C75 H;  3SBR A;  2I0R A;  4YVD A;  1A0R B;  4FWW A;  4J0X A;  2OVP B;  4CY1 A;  5FA5 B;  4U1E I;  5AFU 3;  3EI2 A;  2P9I C;  1MG3 A;  4XYH A;  3N0D A;  2OVQ B;  3UVN A;  2H13 A;  2P9L C;  4L3G D;  5EM2 A;  1Q47 A;  1U2V C;  5THA A;  3V7D B;  2J55 H;  4GGA A;  4O45 A;  4O1Q D;  2AGY A;  2H14 A;  5C2W B;  2IUR A;  4KFM B;  3BWS A;  5HE1 B;  3JRP A;  3SXT D;  4JT5 C;  5FKS A;  5K19 A;  5IC7 A;  2HES X;  2QXV A;  5C2V B;  3J81 g;  4FB1 D;  3AL9 A;  2O9K A;  3EI2 B;  5EMK B;  2QC5 A;  4J82 A;  1R5M A;  3EWE A;  3C99 A;  3I7P A;  5FKQ A;  4ZOZ A;  3SFZ A;  3I7H A;  3NVQ A;  1FWX A;  5CXB B;  3SBP A;  2B5L A;  5HYN B;  3I7K A;  1SHY B;  3VGZ A;  5CYK B;  3MKQ A;  5SXM A;  2G99 A;  5H1M A;  5K1C C;  1S4U X;  4A7J A;  5H17 A;  4X63 B;  1VYH C;  3I8E A;  4A08 B;  5EM2 B;  1PGU A;  1JMZ B;  4QRJ A;  4A0A A;  3UVL A;  1N6D A;  5HE2 B;  3RRM C;  2AGZ A;  3IJ1 A;  2AH0 A;  2G9A A;  5B4W A;  4CI1 A;  3RMZ D;  4D0K A;  2OIZ A;  4JT6 C;  3EI4 B;  4A09 A;  1L0Q A;  2TRC B;  3CIK B;  4FAN D;  4E5Z B;  3I7O A;  3BG1 A;  3OKY A;  3J80 g;  2W18 A;  1XHM A;  4JSX C;  4JXM A;  4FAV D;  3AL8 A;  2HXC A;  2CN2 A;  3SVW D;  4CI3 A;  2I3T A;  1TYQ C;  3DSM A;  2GC7 A;  3GRE A;  4BUJ C;  2IAA A;  3K26 A;  4H5J A;  4J0W A;  3ZWL B;  2CNX A;  2J56 H;  2YNN A;  4MK0 B;  4H5I A;  4NSX A;  4BH6 A;  2AGL A;  4GZ8 A;  3UVO A;  4ESG A;  3RN1 D;  4UI9 R;  4BL0 A;  2CO0 A;  5FLX g;  5CXC B;  1GP2 B;  3IJ0 A;  4A11 B;  3EI1 B;  4J84 A;  3JAM g;  4J73 A;  4CY3 A;  1U4C A;  3FGB A;  3JZG A;  3L4M D;  1P22 A;  4X61 B;  2H6N A;  2XL3 A;  1K32 A;  4FA1 D;  4GGD A;  3MMY A;  4AEZ A;  4ZOY A;  4OZU A;  3RN0 D;  2Z2N A;  2P9K C;  4GQB B;  2OK6 A;  3EI3 A;  3JB9 L;  3RLM D;  3L4O D;  3IIW A;  2YBA A;  1JJU B;  3OTT A;  3PXT D;  3IIY A;  4X3E A;  2OK4 A;  2IUV A;  5I5M A;  4J81 A;  2PM9 B;  2IUP A;  4K3J B;  2AQ5 A;  5FXY A;  3OL2 B;  4GQ1 A;  2IWF A;  1GG2 B;  4A11 A;  4CI8 A;  5JWZ A;  4PBY A;  4A0B B;  5EAP A;  3EI3 B;  4GM8 A;  2P9U C;  3SMR A;  5A2Q g;  4CZX A;  3V5W B;  5TEE A;  3I7L A;  3FM0 A;  2UZX B;  3SN6 B;  4CZV A;  3PVW B;  3P4F A;  4CY2 A;  4GGC A;  3OKT A;  4FA5 D;  2PBI B;  4GM3 A;  5IJ7 E;  3UKU C;  3NVX A;  4PBZ A;  5C9Z B;  3MXX A;  4J78 A;  5GXH A;  4LGN A;  5I5J A;  3PE7 A;  3ORV D;  2H9M A;  2YNO A;  1PEV A;  1YFQ A;  2UZY B;  4ERQ A;  2HYE A;  3I8C A;  4R7A B;  3EI4 A;  4A09 B;  2Q7Q A;  3ULE C;  4ERY A;  2Z2O A;  4IA9 A;  2GC4 A;  2MTA H;  5TEF A;  3C5M A;  2P9N C;  4CZY A;  5EAR A;  2YB8 B;  3RSE C;  3VH0 A;  3FRX A;  1JMX B;  3IJC A;  4CI2 A;  5GXI A;  2H47 A;  1GOT B;  3PSL A;  4IMM A;  2I0S A;  1SQJ A;  2CE8 A;  3UVM A;  2AGW A;  5EAM A;  4PSW B;  1XKS A;  3F3F A;  3JZH A;  4XEI C;  4LG8 A;  4OWR A;  2B5N A;  3DXK C;  4FA4 D;  2HKR A;  4Z8L A;  1OLZ A;  3OKW A;  4A0B A;  4CC9 A; 
#chains in the Genus database with same CATH topology
 5GMK n;  4AN1 A;  2PM6 B;  2IUQ A;  2CO0 C;  3OL2 A;  4AMZ A;  2H3X A;  3EI1 A;  1NEX B;  5EAL A;  1H2X A;  4IRZ A;  4U7A A;  4A08 A;  3AH8 B;  4PNK B;  3RFG A;  4J86 A;  5IGO A;  4J77 A;  4G1E A;  5FKR A;  3T3M A;  3KRX B;  3DM0 A;  4Y5R D;  2CE9 A;  4K3I D;  3F3P A;  3W15 A;  4EWR A;  2P9P C;  5I5I A;  4PSX B;  3MZK A;  5AMS A;  2AH1 A;  2HU5 A;  3K71 A;  2B4E A;  1GXR A;  1MDA H;  3SWS D;  3I89 A;  3PSC B;  2BKL A;  3SJL D;  3F3G A;  5IGQ A;  1ERJ A;  4J8B A;  2GNQ A;  2OJY A;  2PM9 A;  1TBG A;  1N6F A;  3IKO A;  3EG6 A;  3JZN A;  4JD2 C;  3SLE D;  2H9P A;  1B9Y A;  4BP9 A;  5HE0 B;  3EU7 A;  4A0A B;  3K27 A;  4G56 B;  2B5M A;  4JHP C;  3KRW B;  4O3U B;  1PI6 A;  4AOW A;  4L1Q D;  4ZN4 A;  4I79 A;  4NC4 A;  2EID A;  1H2Y A;  4J87 A;  3U4Y A;  3NVN A;  5H14 A;  2YNP A;  3K72 A;  5EMM B;  5E6S A;  4XYI A;  1OMW B;  2P9S C;  4Y7R A;  1XIP A;  4HDJ A;  2BCJ B;  1VE6 A;  2AGX A;  4O3T B;  4ERZ A;  1K8K C;  2H9L A;  2HJ4 A;  4GM9 A;  4FA9 D;  4DNW A;  2IWK A;  2PM7 B;  4A2L A;  3ZDZ A;  5M5S A;  1C9I A;  3UR4 A;  5FQD A;  2OVR B;  2YMU A;  4JSP C;  4E54 B;  5CXC A;  3JPX A;  1QNI A;  1T2X A;  2CN3 A;  4ZOX A;  5EML B;  4QL1 A;  5GSA A;  4WK2 A;  3E0C A;  3PVU B;  4Z7N A;  3N0E A;  3DXM C;  4G1M A;  1PBY B;  3OKY B;  3NIF A;  5HQG A;  2HKM A;  3EQ7 A;  2I3S A;  4GQ2 P;  4NEN A;  5CXB A;  3HFQ A;  5IJ8 E;  4QAM A;  2HJB A;  3V9F A;  2J57 G;  4A2M A;  2Z2P A;  4X60 B;  3ODT A;  1NR0 A;  3OW8 A;  4WJK A;  5HE3 B;  4ZOV A;  2XL2 A;  3FCS A;  1JV2 A;  4GMB A;  3I7N A;  3SBQ A;  1I2M B;  4PC0 A;  2H6Q A;  3AL8 B;  1UOP A;  3GFC A;  4QQE A;  1E8N A;  3PXW D;  4O9D A;  4FHL A;  3K6S A;  3I2N A;  2VDR A;  3EMH A;  3UVK A;  4CY5 A;  2I0T A;  4ES0 A;  1RI6 A;  2H68 A;  4E5Z A;  1QFM A;  5IT9 g;  4PXW A;  1SQ9 A;  4QT8 A;  1H2W A;  3CFV A;  4MMX A;  4JSV C;  3JRO A;  3AFC A;  3RFH A;  4L3H D;  5FKT A;  4TZ4 A;  1E5T A;  5FFO A;  3ZDY A;  5EMJ B;  4AMY A;  4D6V A;  1B9X A;  2H9N A;  3MKS B;  5KDO B;  3DWL C;  3MZL A;  3PXS D;  1M1X A;  3CFS B;  3OF7 A;  4JSN C;  3B7F A;  3UKR C;  1MG2 A;  4J8G A;  2VDK A;  4E54 A;  5TF2 A;  5M61 A;  4DNV A;  2XZG A;  3SCY A;  2H6K A;  2XYI A;  1VE7 A;  2VZ3 A;  3ZE0 A;  4AX4 A;  2JKX A;  1N6E A;  3BG0 A;  2BBK H;  3A0F A;  5TDH B;  5AJA A;  4DNU A;  3EQ8 A;  4J79 A;  3C9C A;  3EQ9 A;  4LG9 A;  3SHF A;  1JOF A;  4N14 A;  2XU7 A;  2EBS A;  5CYK A;  3VA6 A;  4L9O A;  1H2Z A;  3C75 H;  3SBR A;  2I0R A;  4YVD A;  1A0R B;  4FWW A;  1C9L A;  4J0X A;  2OVP B;  4CY1 A;  5M5U A;  5FA5 B;  4U1E I;  5AFU 3;  3EI2 A;  2P9I C;  1MG3 A;  4XYH A;  3N0D A;  2OVQ B;  3T3P A;  3UVN A;  2H13 A;  5C92 A;  2P9L C;  4L3G D;  1L5G A;  1BPO A;  5EM2 A;  1Q47 A;  2VDL A;  1U2V C;  5THA A;  3V7D B;  2J55 H;  4GGA A;  4O45 A;  4O1Q D;  2AGY A;  2H14 A;  3IJE A;  5C2W B;  2IUR A;  4KFM B;  3DDU A;  3BWS A;  5HE1 B;  3MVD K;  3JRP A;  2EIC A;  3SXT D;  4JT5 C;  5FKS A;  5K19 A;  5IC7 A;  3IUM A;  2HES X;  2QXV A;  3V4P A;  3O4G A;  5C2V B;  2VDP A;  3J81 g;  4FB1 D;  3AL9 A;  2O9K A;  3EI2 B;  5EMK B;  2QC5 A;  4J82 A;  1R5M A;  3EWE A;  3C99 A;  3I7P A;  1UOO A;  5FKQ A;  4ZOZ A;  1VZ2 A;  3I7H A;  3NVQ A;  3SFZ A;  1FWX A;  3IUJ A;  5CXB B;  3SBP A;  2B5L A;  5HYN B;  3I7K A;  1SHY B;  3VGZ A;  4O02 A;  5CYK B;  3MKQ A;  5SXM A;  2G99 A;  3ZDX A;  2XDW A;  5H1M A;  5K1C C;  1S4U X;  4UM9 A;  2EIE A;  5H17 A;  4X63 B;  4A7J A;  1VYH C;  2WQ8 A;  3I8E A;  4A08 B;  1E8M A;  5EM2 B;  1PGU A;  1YR2 A;  4RE5 A;  1JMZ B;  4QRJ A;  2XE4 A;  4AN0 A;  4A0A A;  3UVL A;  3O4I A;  1N6D A;  5HE2 B;  3RRM C;  2AGZ A;  3IJ1 A;  2AH0 A;  3FCU A;  2G9A A;  5B4W A;  4CI1 A;  3RMZ D;  4JHN A;  4D0K A;  2OIZ A;  4JT6 C;  3EI4 B;  4A09 A;  1L0Q A;  2TRC B;  3CIK B;  3O4H A;  4FAN D;  4E5Z B;  3I7O A;  3BG1 A;  1GOH A;  3OKY A;  3J80 g;  2W18 A;  1XHM A;  2QR5 A;  5M5V A;  3GD1 I;  4JSX C;  4JXM A;  4FAV D;  3AL8 A;  2HXC A;  2CN2 A;  5M5R A;  3NID A;  3SVW D;  4CI3 A;  2I3T A;  1K3I A;  1TYQ C;  2VDM A;  3DSM A;  2GC7 A;  3GRE A;  4BUJ C;  2IAA A;  3K26 A;  4H5J A;  1U8C A;  4J0W A;  3ZWL B;  2CNX A;  2J56 H;  2YNN A;  4MK0 B;  4H5I A;  3IUL A;  4NSX A;  4BH6 A;  2AGL A;  4GZ8 A;  3UVO A;  4BCB A;  4ESG A;  3MUO A;  3RN1 D;  1O6F A;  4UI9 R;  4BL0 A;  2CO0 A;  5FLX g;  5CXC B;  1GP2 B;  3IJ0 A;  5M5T A;  5E6U A;  4G55 A;  4A11 B;  4Z7O A;  3EI1 B;  4MMZ A;  4O2W A;  4J84 A;  3JAM g;  4J73 A;  4CY3 A;  1O6G A;  1U4C A;  3FGB A;  3JZG A;  3L4M D;  1P22 A;  3ZE2 A;  4NAA A;  4X61 B;  2H6N A;  2XL3 A;  1K32 A;  4WK0 A;  4FA1 D;  4GGD A;  2VDO A;  3MMY A;  4AEZ A;  4ZOY A;  2EIB A;  4OZU A;  3RN0 D;  2Z2N A;  2P9K C;  1TYE A;  4GQB B;  2OK6 A;  3EI3 A;  3JB9 L;  3RLM D;  3L4O D;  3IIW A;  2YBA A;  4NBM A;  1JJU B;  1QFS A;  3OTT A;  3V4V A;  3PXT D;  3IIY A;  3NIG A;  4X3E A;  2OK4 A;  5FFG A;  2IUV A;  5I5M A;  4J81 A;  2PM9 B;  2IUP A;  4K3J B;  2AQ5 A;  5C86 A;  3VI3 A;  1A12 A;  5FXY A;  3OL2 B;  3IUN A;  1UOQ A;  4GQ1 A;  2IWF A;  1GG2 B;  4A11 A;  4CI8 A;  5JWZ A;  4PBY A;  4A0B B;  5EAP A;  3EI3 B;  4GM8 A;  2P9U C;  3SMR A;  5A2Q g;  4CZX A;  3V5W B;  5TEE A;  3ZE1 A;  3I7L A;  3FM0 A;  3O4J A;  2UZX B;  3SN6 B;  4CZV A;  3PVW B;  4WK4 A;  3VI4 A;  3P4F A;  4CY2 A;  4GGC A;  4UM8 A;  3QHY B;  2VDQ A;  3OKT A;  4FA5 D;  2PBI B;  3IVM A;  4Z7Q A;  4GM3 A;  3IUR A;  1JTD B;  4BCD A;  5IJ7 E;  3UKU C;  3NVX A;  3QI0 A;  4RE6 A;  4PBZ A;  5C9Z B;  3MXX A;  4J78 A;  5GXH A;  4LGN A;  4MMY A;  2VC2 A;  5I5J A;  3PE7 A;  1UTC A;  3ORV D;  2H9M A;  2VZ1 A;  2YNO A;  1PEV A;  1YFQ A;  2UZY B;  4ERQ A;  2HYE A;  3KCI A;  3I8C A;  4R7A B;  4D9S A;  3EI4 A;  4BP8 A;  4A09 B;  2VDN A;  2Q7Q A;  3ULE C;  4ERY A;  2Z2O A;  4IA9 A;  2GC4 A;  3GC3 B;  2MTA H;  5TEF A;  1VZ3 A;  3C5M A;  2P9N C;  4CZY A;  5EAR A;  2YB8 B;  3RSE C;  3VH0 A;  3FRX A;  1JMX B;  3IJC A;  4CI2 A;  5GXI A;  2H47 A;  1GOT B;  3PSL A;  5HDB A;  4IMM A;  2I0S A;  1SQJ A;  2CE8 A;  3UVM A;  1GOF A;  2HU7 A;  2AGW A;  5EAM A;  4PSW B;  1XKS A;  1GOG A;  3F3F A;  3JZH A;  4LG8 A;  4XEI C;  4L1M A;  4OWR A;  2B5N A;  3DXK C;  2QZP A;  4FA4 D;  2HKR A;  4Z8L A;  3OKW A;  1OLZ A;  3MUN A;  4A0B A;  5E6R A;  4BCC A;  3IUQ A;  4CC9 A;  2HU8 A; 
#chains in the Genus database with same CATH homology
 5GMK n;  2PM6 B;  2IUQ A;  2CO0 C;  3OL2 A;  2H3X A;  3EI1 A;  1NEX B;  5EAL A;  4U7A A;  4A08 A;  3AH8 B;  4PNK B;  3RFG A;  4J86 A;  5IGO A;  4J77 A;  5FKR A;  3KRX B;  3DM0 A;  4Y5R D;  2CE9 A;  4K3I D;  3F3P A;  3W15 A;  4EWR A;  2P9P C;  5I5I A;  4PSX B;  3MZK A;  5AMS A;  2AH1 A;  2B4E A;  1GXR A;  1MDA H;  3SWS D;  3I89 A;  3PSC B;  3SJL D;  3F3G A;  5IGQ A;  1ERJ A;  4J8B A;  2GNQ A;  2OJY A;  2PM9 A;  1TBG A;  1N6F A;  3IKO A;  3EG6 A;  3JZN A;  4JD2 C;  3SLE D;  2H9P A;  1B9Y A;  4A0A B;  5HE0 B;  3EU7 A;  3K27 A;  4G56 B;  2B5M A;  3KRW B;  4O3U B;  1PI6 A;  4AOW A;  4L1Q D;  4ZN4 A;  4I79 A;  4J87 A;  3U4Y A;  3NVN A;  5H14 A;  2YNP A;  5EMM B;  4XYI A;  1OMW B;  2P9S C;  4Y7R A;  1XIP A;  4HDJ A;  2BCJ B;  2AGX A;  4O3T B;  4ERZ A;  1K8K C;  2H9L A;  2HJ4 A;  4GM9 A;  4FA9 D;  2IWK A;  2PM7 B;  4A2L A;  3UR4 A;  5FQD A;  2OVR B;  2YMU A;  4JSP C;  4E54 B;  5CXC A;  3JPX A;  1QNI A;  2CN3 A;  4ZOX A;  5EML B;  4QL1 A;  5GSA A;  3E0C A;  3PVU B;  3N0E A;  3DXM C;  1PBY B;  3OKY B;  5HQG A;  2HKM A;  2I3S A;  4GQ2 P;  5CXB A;  3HFQ A;  5IJ8 E;  2HJB A;  3V9F A;  2J57 G;  4A2M A;  2Z2P A;  4X60 B;  3ODT A;  1NR0 A;  3OW8 A;  5HE3 B;  4ZOV A;  2XL2 A;  4GMB A;  3I7N A;  3SBQ A;  4PC0 A;  2H6Q A;  3AL8 B;  3GFC A;  4QQE A;  3PXW D;  4O9D A;  4FHL A;  3I2N A;  3EMH A;  3UVK A;  4CY5 A;  2I0T A;  4ES0 A;  1RI6 A;  2H68 A;  4E5Z A;  5IT9 g;  4PXW A;  1SQ9 A;  4QT8 A;  3CFV A;  4JSV C;  3JRO A;  3AFC A;  3RFH A;  4L3H D;  5FKT A;  4TZ4 A;  5EMJ B;  4D6V A;  1B9X A;  2H9N A;  3MKS B;  5KDO B;  3DWL C;  3MZL A;  3CFS B;  3PXS D;  4JSN C;  3B7F A;  3UKR C;  1MG2 A;  4J8G A;  4E54 A;  5TF2 A;  3SCY A;  2H6K A;  2XYI A;  1N6E A;  3BG0 A;  2BBK H;  3A0F A;  5TDH B;  5AJA A;  4J79 A;  3C9C A;  4LG9 A;  3SHF A;  1JOF A;  4N14 A;  2XU7 A;  2EBS A;  5CYK A;  3VA6 A;  4L9O A;  3C75 H;  3SBR A;  2I0R A;  4YVD A;  1A0R B;  4FWW A;  4J0X A;  2OVP B;  4CY1 A;  5FA5 B;  4U1E I;  5AFU 3;  3EI2 A;  2P9I C;  1MG3 A;  4XYH A;  3N0D A;  2OVQ B;  3UVN A;  2H13 A;  2P9L C;  4L3G D;  5EM2 A;  1Q47 A;  1U2V C;  5THA A;  3V7D B;  2J55 H;  4GGA A;  4O45 A;  4O1Q D;  2AGY A;  2H14 A;  5C2W B;  2IUR A;  4KFM B;  3BWS A;  5HE1 B;  3JRP A;  3SXT D;  4JT5 C;  5FKS A;  5K19 A;  5IC7 A;  2HES X;  2QXV A;  5C2V B;  3J81 g;  4FB1 D;  3AL9 A;  2O9K A;  3EI2 B;  5EMK B;  2QC5 A;  4J82 A;  1R5M A;  3EWE A;  3C99 A;  3I7P A;  5FKQ A;  4ZOZ A;  3SFZ A;  3I7H A;  3NVQ A;  1FWX A;  5CXB B;  3SBP A;  2B5L A;  5HYN B;  3I7K A;  1SHY B;  3VGZ A;  5CYK B;  3MKQ A;  5SXM A;  2G99 A;  5H1M A;  5K1C C;  1S4U X;  4A7J A;  5H17 A;  4X63 B;  1VYH C;  3I8E A;  4A08 B;  5EM2 B;  1PGU A;  1JMZ B;  4QRJ A;  4A0A A;  3UVL A;  1N6D A;  5HE2 B;  3RRM C;  2AGZ A;  3IJ1 A;  2AH0 A;  2G9A A;  5B4W A;  4CI1 A;  3RMZ D;  4D0K A;  2OIZ A;  4JT6 C;  3EI4 B;  4A09 A;  1L0Q A;  2TRC B;  3CIK B;  4FAN D;  4E5Z B;  3I7O A;  3BG1 A;  3OKY A;  3J80 g;  2W18 A;  1XHM A;  4JSX C;  4JXM A;  4FAV D;  3AL8 A;  2HXC A;  2CN2 A;  3SVW D;  4CI3 A;  2I3T A;  1TYQ C;  3DSM A;  2GC7 A;  3GRE A;  4BUJ C;  2IAA A;  3K26 A;  4H5J A;  4J0W A;  3ZWL B;  2CNX A;  2J56 H;  2YNN A;  4MK0 B;  4H5I A;  4NSX A;  4BH6 A;  2AGL A;  4GZ8 A;  3UVO A;  4ESG A;  3RN1 D;  4UI9 R;  4BL0 A;  2CO0 A;  5FLX g;  5CXC B;  1GP2 B;  3IJ0 A;  4A11 B;  3EI1 B;  4J84 A;  3JAM g;  4J73 A;  4CY3 A;  1U4C A;  3FGB A;  3JZG A;  3L4M D;  1P22 A;  4X61 B;  2H6N A;  2XL3 A;  1K32 A;  4FA1 D;  4GGD A;  3MMY A;  4AEZ A;  4ZOY A;  4OZU A;  3RN0 D;  2Z2N A;  2P9K C;  4GQB B;  2OK6 A;  3EI3 A;  3JB9 L;  3RLM D;  3L4O D;  3IIW A;  2YBA A;  1JJU B;  3OTT A;  3PXT D;  3IIY A;  4X3E A;  2OK4 A;  2IUV A;  5I5M A;  4J81 A;  2PM9 B;  2IUP A;  4K3J B;  2AQ5 A;  5FXY A;  3OL2 B;  4GQ1 A;  2IWF A;  1GG2 B;  4A11 A;  4CI8 A;  5JWZ A;  4PBY A;  4A0B B;  5EAP A;  3EI3 B;  4GM8 A;  2P9U C;  3SMR A;  5A2Q g;  4CZX A;  3V5W B;  5TEE A;  3I7L A;  3FM0 A;  2UZX B;  3SN6 B;  4CZV A;  3PVW B;  3P4F A;  4CY2 A;  4GGC A;  3OKT A;  4FA5 D;  2PBI B;  4GM3 A;  5IJ7 E;  3UKU C;  3NVX A;  4PBZ A;  5C9Z B;  3MXX A;  4J78 A;  5GXH A;  4LGN A;  5I5J A;  3PE7 A;  3ORV D;  2H9M A;  2YNO A;  1PEV A;  1YFQ A;  2UZY B;  4ERQ A;  2HYE A;  3I8C A;  4R7A B;  3EI4 A;  4A09 B;  2Q7Q A;  3ULE C;  4ERY A;  2Z2O A;  4IA9 A;  2GC4 A;  2MTA H;  5TEF A;  3C5M A;  2P9N C;  4CZY A;  5EAR A;  2YB8 B;  3RSE C;  3VH0 A;  3FRX A;  1JMX B;  3IJC A;  4CI2 A;  5GXI A;  2H47 A;  1GOT B;  3PSL A;  4IMM A;  2I0S A;  1SQJ A;  2CE8 A;  3UVM A;  2AGW A;  5EAM A;  4PSW B;  1XKS A;  3F3F A;  3JZH A;  4XEI C;  4LG8 A;  4OWR A;  2B5N A;  3DXK C;  4FA4 D;  2HKR A;  4Z8L A;  1OLZ A;  3OKW A;  4A0B A;  4CC9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...