3EMHA

Structural basis of wdr5-mll interaction
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
300
structure length
300
Chain Sequence
PNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Gene regulation
molecule keywords WD repeat-containing protein 5
publication title WDR5 Interacts with Mixed Lineage Leukemia (MLL) Protein via the Histone H3-binding Pocket.
pubmed doi rcsb
source organism Homo sapiens
total genus 100
structure length 300
sequence length 300
ec nomenclature
pdb deposition date 2008-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3emhA00
4A2LA 2P9KC 3SBRA 4Y7RA 4KFMB 2BCJB 4QL1A 4JSPC 2HJ4A 3EI4B 2H13A 1NR0A 4EWRA 5TDHB 3FRXA 5AMSA 4CC9A 5JWZA 1N6DA 3UVLA 1XHMA 2I3SA 5HE1B 1U4CA 3I8EA 5CXCB 1N6EA 1GG2B 4FHLA 4L3GD 5TEEA 4OWRA 3SHFA 5EAMA 2P9SC 2HKMA 5IJ8E 3K26A 1JOFA 2PM9B 3F3FA 2B4EA 4PNKB 3SWSD 1JMZB 3IIYA 4CY1A 4J84A 5H17A 4JSXC 4CY2A 2OVQB 3MXXA 3EU7A 5IGOA 3RMZD 2IUPA 2AGYA 5AJAA 2P9UC 5FKRA 2QXVA 3N0DA 5CXBA 2AGWA 4D0KA 4LGNA 3SBQA 2H9LA 1FWXA 1GXRA 1XIPA 2HKRA 3MMYA 4GM3A 4BL0A 2CN3A 2GC7A 4IA9A 4XYIA 3W15A 1SQJA 4AOWA 4CZXA 4FA1D 4AEZA 2IWKA 4CI8A 3GREA 4J8GA 3SBPA 2PBIB 4H5IA 5EALA 5IGQA 2HJBA 1PI6A 3OKWA 3SCYA 3K27A 1P22A 2TRCB 4PBZA 2I0TA 2Z2PA 3DXMC 4GZ8A 4ERYA 4MK0B 1N6FA 5EMMB 2P9LC 3V7DB 4CZVA 3U4YA 1A0RB 3OW8A 3PE7A 1B9YA 2UZXB 5FLXg 3OTTA 2QC5A 4G56B 4J82A 4L1QD 3V9FA 4GGAA 2H47A 4A08B 3EG6A 5GMKn 4X60B 2W18A 3RLMD 4GM8A 3JZNA 5A2Qg 3PXSD 4R7AB 2H6QA 4K3JB 4E5ZA 4XEIC 4JSNC 3CIKB 3RFHA 4A0AA 4ERZA 2XU7A 3DM0A 4GGCA 2XYIA 4QQEA 5HYNB 5GXIA 3EI1A 4X63B 3L4OD 4ZOZA 3I7LA 1MDAH 4GQ1A 5EMKB 4J0WA 4GM9A 2Q7QA 1SHYB 3E0CA 3JPXA 1L0QA 5FA5B 2CE9A 2EBSA 4QT8A 2J55H 4PC0A 5FKQA 4FAVD 1VYHC 5FKSA 4E54A 4FA5D 4PXWA 1ERJA 5I5MA 5TEFA 3PVWB 1MG3A 1GP2B 3IIWA 4LG8A 3MZLA 2AGXA 5HE3B 4OZUA 2HESX 4A08A 5SXMA 4U1EI 4IMMA 3SN6B 2YNNA 2J56H 5CYKB 3ZWLB 3IJ1A 3JZHA 4A09A 3I7NA 4E5ZB 1OLZA 3VH0A 3ULEC 3BG1A 1SQ9A 4J8BA 5IC7A 1NEXB 2CE8A 5THAA 4A0AB 3BG0A 3NVNA 3NVQA 4FAND 2IWFA 1PBYB 4QRJA 4NSXA 3EI1B 2IUQA 3AL8A 3OL2A 4O3TB 1XKSA 3AL9A 2H6NA 3RN1D 2I3TA 1JMXB 5TF2A 3ORVD 4O3UB 2H3XA 3SFZA 4A11A 2OK4A 2GC4A 4FA9D 3I7HA 3PSLA 3VGZA 4GMBA 4E54B 5I5IA 3P4FA 4ZN4A 4CI1A 3RRMC 3I7KA 2O9KA 4K3ID 4TZ4A 3JROA 4UI9R 4FA4D 3AFCA 3PVUB 3JB9L 3IJCA 3UVNA 2HYEA 2B5LA 5C2VB 3CFSB 3SLED 2CN2A 2XL2A 1K32A 5CYKA 5I5JA 4A09B 3FM0A 3EI3A 3I7OA 3OKTA 5H14A 4BUJC 4J87A 2G99A 3KRWB 3B7FA 3DSMA 4ERQA 4ESGA 2Z2NA 3SJLD 2H9PA 3I7PA 3SVWD 4CZYA 3I2NA 2OVRB 4J0XA 2PM7B 2G9AA 2GNQA 3CFVA 5FKTA 2YMUA 4O9DA 3IKOA 3AL8B 4J77A 3OL2B 4FWWA 4GQ2P 2Z2OA 3EI2A 4YVDA 3UVMA 1TYQC 4X3EA 2AH1A 4ZOYA 1TBGA 3BWSA 4A11B 3RSEC 3UVOA 5EMJB 1S4UX 3UKUC 2B5NA 4A0BA 3NVXA 2H9MA 4H5JA 4L3HD 2AQ5A 3OKYA 4PSWB 2CO0C 3JAMg 1YFQA 2AH0A 4ES0A 4Z8LA 3MZKA 4BH6A 3DWLC 3F3PA 5GXHA 3C99A 2H9NA 1JJUB 4XYHA 1MG2A 4J73A 2IUVA 5EARA 3MKQA 5EMLB 2AGZA 3RFGA 4X61B 4JT5C 3C5MA 2H6KA 3DXKC 5IT9g 1PEVA 1PGUA 3EMHA 3JZGA 4O1QD 2OJYA 3EI3B 3AH8B 3IJ0A 2BBKH 4JXMA 2YBAA 2P9IC 3FGBA 4CI3A 4ZOVA 2HXCA 4L9OA 4Y5RD 3VA6A 4A2MA 2P9NC 4CY5A 5H1MA 4J86A 5EM2B 5IJ7E 3C9CA 3EWEA 3UKRC 4PSXB 3RN0D 2XL3A 3J80g 2CO0A 5GSAA 3EI2B 4JD2C 5HQGA 4I79A 1Q47A 5C2WB 4A7JA 1R5MA 5HE0B 2I0RA 5FQDA 5B4WA 4A0BB 2CNXA 4HDJA 2H68A 4GGDA 3OKYB 2MTAH 4O45A 4CI2A 5KDOB 5AFU3 2YNOA 4FB1D 2B5MA 4JSVC 3EI4A 3UR4A 1QNIA 4JT6C 3I8CA 3KRXB 2PM6B 5EAPA 3F3GA 3I89A 4U7AA 3ODTA 5CXCA 5HE2B 3C75H 5FXYA 1U2VC 2IURA 4ZOXA 1B9XA 3SXTD 4LG9A 3A0FA 3HFQA 5K1CC 4GQBB 2PM9A 2OK6A 2OIZA 2YB8B 2P9PC 2J57G 3PXWD 3PXTD 3GFCA 5C9ZB 1K8KC 1RI6A 4J81A 2H14A 3SMRA 4CY3A 4J78A 3MKSB 3L4MD 3UVKA 4J79A 3PSCB 3N0EA 1OMWB 1GOTB 2UZYB 5EM2A 5CXBB 3V5WB 2AGLA 3JRPA 2IAAA 4PBYA 4D6VA 2OVPB 2I0SA 4N14A 5K19A 3J81g 2YNPA
chains in the Genus database with same CATH superfamily
4A2LA 5M5RA 2P9KC 3SBRA 4Y7RA 4KFMB 2BCJB 4QL1A 4JSPC 2HJ4A 3EI4B 4G1MA 2H13A 1NR0A 4EWRA 5TDHB 3FRXA 5AMSA 4CC9A 1YR2A 4NENA 5JWZA 1N6DA 4DNVA 4L1MA 3UVLA 1XHMA 2I3SA 5HE1B 1U4CA 3V4PA 3DDUA 4AN1A 2VZ3A 3I8EA 5CXCB 1N6EA 4AMYA 1GG2B 4FHLA 4L3GD 3ZDXA 3IUQA 3V4VA 5TEEA 4OWRA 3SHFA 5EAMA 2P9SC 2HKMA 5IJ8E 3K26A 1JOFA 2PM9B 3F3FA 2B4EA 1K3IA 5FFOA 4PNKB 3SWSD 1JMZB 3IIYA 4CY1A 4J84A 5H17A 4JSXC 4CY2A 1UOQA 3IURA 2OVQB 3MXXA 3EU7A 5IGOA 3RMZD 2IUPA 2AGYA 1UTCA 2VDMA 5AJAA 5M5UA 2P9UC 5FKRA 2QXVA 3N0DA 5CXBA 4DNUA 2AGWA 4D0KA 4LGNA 3SBQA 2H9LA 1FWXA 1GXRA 1XIPA 3MMYA 2HKRA 4GM3A 4IRZA 4BL0A 2CN3A 2GC7A 4IA9A 4XYIA 3W15A 1SQJA 4Z7OA 4AOWA 2XE4A 3ZE0A 4CZXA 4FA1D 4AEZA 4AN0A 2IWKA 1VZ2A 4CI8A 3GREA 4J8GA 3IUJA 4WK4A 2PBIB 4H5IA 3SBPA 3IUMA 2EIDA 5EALA 5IGQA 2HJBA 1PI6A 3OKWA 3SCYA 4JHNA 3K27A 1P22A 2TRCB 4PBZA 2I0TA 3K71A 2Z2PA 3DXMC 4GZ8A 4DNWA 4ERYA 4MK0B 2HU8A 1N6FA 2VZ1A 4BCCA 5EMMB 2P9LC 3V7DB 4CZVA 2VDOA 4BP8A 3U4YA 1A0RB 3OW8A 3PE7A 1B9YA 2UZXB 3GC3B 1M1XA 5FLXg 3OTTA 2QC5A 2XZGA 1QFSA 4G56B 4BP9A 4J82A 4L1QD 3V9FA 4GGAA 2H47A 4A08B 3EG6A 5GMKn 4X60B 2W18A 3RLMD 4GM8A 3JZNA 5A2Qg 3PXSD 4R7AB 2H6QA 1L5GA 1O6FA 4K3JB 4E5ZA 4XEIC 4JSNC 3CIKB 4O02A 1JV2A 3IULA 3RFHA 3VI3A 4D9SA 4A0AA 4ERZA 2XU7A 3DM0A 4GGCA 2XYIA 1I2MB 2WQ8A 3ZDZA 4QQEA 1T2XA 5HYNB 5GXIA 3EI1A 4X63B 4QAMA 3L4OD 4ZOZA 3I7LA 1MDAH 4GQ1A 2QZPA 5EMKB 1U8CA 4J0WA 1QFMA 4GM9A 2Q7QA 1SHYB 3JPXA 3E0CA 1L0QA 5FA5B 2CE9A 2EBSA 4QT8A 2J55H 3O4IA 4PC0A 1GOGA 5FKQA 4WK2A 3ZE2A 4FAVD 1VYHC 5FKSA 4E54A 4FA5D 4PXWA 1ERJA 5I5MA 5TEFA 3PVWB 1MG3A 1GP2B 3IIWA 4LG8A 3MZLA 2AGXA 5HE3B 2EIEA 4OZUA 2HESX 3IVMA 4A08A 5SXMA 1E8NA 4IMMA 4U1EI 3O4GA 3SN6B 2YNNA 2J56H 1VE7A 3VI4A 5CYKB 3ZWLB 3IJ1A 3JZHA 4A09A 3I7NA 4E5ZB 2VDNA 1OLZA 3VH0A 1BPOA 3ULEC 3BG1A 1SQ9A 2VDKA 4J8BA 1O6GA 5IC7A 3GD1I 3MVDK 1NEXB 2CE8A 3T3MA 4G55A 5THAA 4A0AB 3BG0A 3NVNA 3NVQA 4FAND 2IWFA 1PBYB 4QRJA 4NSXA 3EI1B 2IUQA 2HU5A 3AL8A 3OL2A 1E5TA 4O3TB 1XKSA 3AL9A 2H6NA 3RN1D 2BKLA 2I3TA 1JMXB 5C86A 5TF2A 3ORVD 4O3UB 2H3XA 3SFZA 4A11A 2OK4A 2GC4A 4FA9D 3I7HA 3PSLA 3VGZA 4NAAA 4GMBA 4E54B 5I5IA 3P4FA 4ZN4A 4CI1A 3RRMC 3I7KA 1UOOA 2O9KA 4K3ID 4WJKA 4TZ4A 3JROA 4UI9R 4FA4D 3AFCA 3PVUB 3JB9L 3IJCA 3UVNA 4AMZA 2HYEA 4NC4A 2B5LA 5C2VB 3CFSB 5M5SA 2HU7A 3SLED 1H2ZA 2CN2A 1C9IA 2XL2A 1K32A 5CYKA 5I5JA 4A09B 3FM0A 3EQ9A 3EI3A 3I7OA 5M5VA 3OKTA 5H14A 4BUJC 4J87A 2G99A 3KRWB 3B7FA 1A12A 3DSMA 1GOHA 3ZE1A 4ERQA 2EIBA 2VDQA 1H2YA 4ESGA 2Z2NA 3KCIA 3SJLD 3I7PA 2H9PA 3SVWD 1H2WA 4CZYA 3I2NA 2OVRB 4J0XA 2PM7B 2G9AA 2GNQA 3CFVA 2VDPA 3O4JA 5FKTA 2YMUA 3IKOA 3AL8B 4J77A 3OL2B 4FWWA 4JHPC 4O9DA 4GQ2P 1C9LA 2Z2OA 3EI2A 4YVDA 3UVMA 1TYQC 4X3EA 2AH1A 4ZOYA 3QHYB 2XDWA 1TBGA 3BWSA 4A11B 3RSEC 3UVOA 5EMJB 1S4UX 5HDBA 3UKUC 2B5NA 4A0BA 3NVXA 2H9MA 4UM9A 4H5JA 4G1EA 2AQ5A 3OKYA 4L3HD 1GOFA 2CO0C 4PSWB 3JAMg 1YFQA 2AH0A 4ES0A 4Z8LA 3MZKA 4BH6A 3DWLC 3F3PA 5GXHA 3C99A 2H9NA 1JJUB 5M5TA 4XYHA 1MG2A 5E6RA 4J73A 2IUVA 5EARA 1H2XA 3MKQA 4MMZA 5EMLB 2AGZA 3RFGA 3T3PA 4WK0A 4X61B 4JT5C 3C5MA 2H6KA 5E6UA 3DXKC 5IT9g 3K6SA 1PEVA 1PGUA 3EMHA 3JZGA 4O1QD 4BCBA 2OJYA 3EI3B 3AH8B 3IJ0A 2BBKH 4JXMA 2YBAA 2P9IC 1E8MA 3FGBA 4CI3A 4ZOVA 2HXCA 4RE6A 4MMXA 5E6SA 4L9OA 4Y5RD 3VA6A 4A2MA 2P9NC 4CY5A 5H1MA 4J86A 5EM2B 5IJ7E 3C9CA 5M61A 3EWEA 2VDLA 3UKRC 4PSXB 4BCDA 3RN0D 2JKXA 2XL3A 3J80g 2CO0A 4AX4A 5GSAA 3EI2B 4JD2C 5HQGA 4I79A 3MUNA 2EICA 1Q47A 5C2WB 3ZDYA 4A7JA 1R5MA 5HE0B 3NIDA 2I0RA 5FQDA 2VC2A 3OF7A 5B4WA 4A0BB 2CNXA 2VDRA 4HDJA 2H68A 4GGDA 3OKYB 2MTAH 4O45A 4CI2A 5KDOB 4MMYA 5AFU3 2YNOA 3MUOA 4FB1D 2B5MA 4JSVC 3EI4A 3UR4A 1QNIA 4JT6C 5C92A 3QI0A 3I8CA 3KRXB 2PM6B 3O4HA 5EAPA 4Z7QA 1VE6A 3F3GA 3I89A 1JTDB 4U7AA 3ODTA 5CXCA 1UOPA 3EQ7A 5HE2B 3C75H 5FXYA 1U2VC 2IURA 1TYEA 2QR5A 4ZOXA 1B9XA 4NBMA 3SXTD 4LG9A 3A0FA 3HFQA 5K1CC 4GQBB 3EQ8A 2PM9A 2OK6A 2OIZA 2YB8B 4RE5A 2P9PC 2J57G 3PXWD 3PXTD 3GFCA 4Z7NA 5C9ZB 1K8KC 1RI6A 3NIGA 4J81A 2H14A 3SMRA 4CY3A 3IJEA 3K72A 4J78A 3MKSB 3L4MD 5FFGA 4J79A 3UVKA 3PSCB 4UM8A 3FCUA 3N0EA 1OMWB 1GOTB 2UZYB 5EM2A 5CXBB 3V5WB 2AGLA 3JRPA 2IAAA 4PBYA 4D6VA 1VZ3A 3IUNA 4O2WA 2OVPB 2I0SA 4N14A 3NIFA 5K19A 3J81g 3FCSA 2YNPA
chains in the Genus database with same CATH topology
4A2LA 2P9KC 3SBRA 4Y7RA 4KFMB 2BCJB 4QL1A 4JSPC 2HJ4A 3EI4B 2H13A 1NR0A 4EWRA 5TDHB 3FRXA 5AMSA 4CC9A 5JWZA 1N6DA 3UVLA 1XHMA 2I3SA 5HE1B 1U4CA 3I8EA 5CXCB 1N6EA 1GG2B 4FHLA 4L3GD 5TEEA 4OWRA 3SHFA 5EAMA 2P9SC 2HKMA 5IJ8E 3K26A 1JOFA 2PM9B 3F3FA 2B4EA 4PNKB 3SWSD 1JMZB 3IIYA 4CY1A 4J84A 5H17A 4JSXC 4CY2A 2OVQB 3MXXA 3EU7A 5IGOA 3RMZD 2IUPA 2AGYA 5AJAA 2P9UC 5FKRA 2QXVA 3N0DA 5CXBA 2AGWA 4D0KA 4LGNA 3SBQA 2H9LA 1FWXA 1GXRA 1XIPA 2HKRA 3MMYA 4GM3A 4BL0A 2CN3A 2GC7A 4IA9A 4XYIA 3W15A 1SQJA 4AOWA 4CZXA 4FA1D 4AEZA 2IWKA 4CI8A 3GREA 4J8GA 3SBPA 2PBIB 4H5IA 5EALA 5IGQA 2HJBA 1PI6A 3OKWA 3SCYA 3K27A 1P22A 2TRCB 4PBZA 2I0TA 2Z2PA 3DXMC 4GZ8A 4ERYA 4MK0B 1N6FA 5EMMB 2P9LC 3V7DB 4CZVA 3U4YA 1A0RB 3OW8A 3PE7A 1B9YA 2UZXB 5FLXg 3OTTA 2QC5A 4G56B 4J82A 4L1QD 3V9FA 4GGAA 2H47A 4A08B 3EG6A 5GMKn 4X60B 2W18A 3RLMD 4GM8A 3JZNA 5A2Qg 3PXSD 4R7AB 2H6QA 4K3JB 4E5ZA 4XEIC 4JSNC 3CIKB 3RFHA 4A0AA 4ERZA 2XU7A 3DM0A 4GGCA 2XYIA 4QQEA 5HYNB 5GXIA 3EI1A 4X63B 3L4OD 4ZOZA 3I7LA 1MDAH 4GQ1A 5EMKB 4J0WA 4GM9A 2Q7QA 1SHYB 3E0CA 3JPXA 1L0QA 5FA5B 2CE9A 2EBSA 4QT8A 2J55H 4PC0A 5FKQA 4FAVD 1VYHC 5FKSA 4E54A 4FA5D 4PXWA 1ERJA 5I5MA 5TEFA 3PVWB 1MG3A 1GP2B 3IIWA 4LG8A 3MZLA 2AGXA 5HE3B 4OZUA 2HESX 4A08A 5SXMA 4U1EI 4IMMA 3SN6B 2YNNA 2J56H 5CYKB 3ZWLB 3IJ1A 3JZHA 4A09A 3I7NA 4E5ZB 1OLZA 3VH0A 3ULEC 3BG1A 1SQ9A 4J8BA 5IC7A 1NEXB 2CE8A 5THAA 4A0AB 3BG0A 3NVNA 3NVQA 4FAND 2IWFA 1PBYB 4QRJA 4NSXA 3EI1B 2IUQA 3AL8A 3OL2A 4O3TB 1XKSA 3AL9A 2H6NA 3RN1D 2I3TA 1JMXB 5TF2A 3ORVD 4O3UB 2H3XA 3SFZA 4A11A 2OK4A 2GC4A 4FA9D 3I7HA 3PSLA 3VGZA 4GMBA 4E54B 5I5IA 3P4FA 4ZN4A 4CI1A 3RRMC 3I7KA 2O9KA 4K3ID 4TZ4A 3JROA 4UI9R 4FA4D 3AFCA 3PVUB 3JB9L 3IJCA 3UVNA 2HYEA 2B5LA 5C2VB 3CFSB 3SLED 2CN2A 2XL2A 1K32A 5CYKA 5I5JA 4A09B 3FM0A 3EI3A 3I7OA 3OKTA 5H14A 4BUJC 4J87A 2G99A 3KRWB 3B7FA 3DSMA 4ERQA 4ESGA 2Z2NA 3SJLD 2H9PA 3I7PA 3SVWD 4CZYA 3I2NA 2OVRB 4J0XA 2PM7B 2G9AA 2GNQA 3CFVA 5FKTA 2YMUA 4O9DA 3IKOA 3AL8B 4J77A 3OL2B 4FWWA 4GQ2P 2Z2OA 3EI2A 4YVDA 3UVMA 1TYQC 4X3EA 2AH1A 4ZOYA 1TBGA 3BWSA 4A11B 3RSEC 3UVOA 5EMJB 1S4UX 3UKUC 2B5NA 4A0BA 3NVXA 2H9MA 4H5JA 4L3HD 2AQ5A 3OKYA 4PSWB 2CO0C 3JAMg 1YFQA 2AH0A 4ES0A 4Z8LA 3MZKA 4BH6A 3DWLC 3F3PA 5GXHA 3C99A 2H9NA 1JJUB 4XYHA 1MG2A 4J73A 2IUVA 5EARA 3MKQA 5EMLB 2AGZA 3RFGA 4X61B 4JT5C 3C5MA 2H6KA 3DXKC 5IT9g 1PEVA 1PGUA 3EMHA 3JZGA 4O1QD 2OJYA 3EI3B 3AH8B 3IJ0A 2BBKH 4JXMA 2YBAA 2P9IC 3FGBA 4CI3A 4ZOVA 2HXCA 4L9OA 4Y5RD 3VA6A 4A2MA 2P9NC 4CY5A 5H1MA 4J86A 5EM2B 5IJ7E 3C9CA 3EWEA 3UKRC 4PSXB 3RN0D 2XL3A 3J80g 2CO0A 5GSAA 3EI2B 4JD2C 5HQGA 4I79A 1Q47A 5C2WB 4A7JA 1R5MA 5HE0B 2I0RA 5FQDA 5B4WA 4A0BB 2CNXA 4HDJA 2H68A 4GGDA 3OKYB 2MTAH 4O45A 4CI2A 5KDOB 5AFU3 2YNOA 4FB1D 2B5MA 4JSVC 3EI4A 3UR4A 1QNIA 4JT6C 3I8CA 3KRXB 2PM6B 5EAPA 3F3GA 3I89A 4U7AA 3ODTA 5CXCA 5HE2B 3C75H 5FXYA 1U2VC 2IURA 4ZOXA 1B9XA 3SXTD 4LG9A 3A0FA 3HFQA 5K1CC 4GQBB 2PM9A 2OK6A 2OIZA 2YB8B 2P9PC 2J57G 3PXWD 3PXTD 3GFCA 5C9ZB 1K8KC 1RI6A 4J81A 2H14A 3SMRA 4CY3A 4J78A 3MKSB 3L4MD 3UVKA 4J79A 3PSCB 3N0EA 1OMWB 1GOTB 2UZYB 5EM2A 5CXBB 3V5WB 2AGLA 3JRPA 2IAAA 4PBYA 4D6VA 2OVPB 2I0SA 4N14A 5K19A 3J81g 2YNPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A2L A;  2P9K C;  3SBR A;  4Y7R A;  4KFM B;  2BCJ B;  4QL1 A;  4JSP C;  2HJ4 A;  3EI4 B;  2H13 A;  1NR0 A;  4EWR A;  5TDH B;  3FRX A;  5AMS A;  4CC9 A;  5JWZ A;  1N6D A;  3UVL A;  1XHM A;  2I3S A;  5HE1 B;  1U4C A;  3I8E A;  5CXC B;  1N6E A;  1GG2 B;  4FHL A;  4L3G D;  5TEE A;  4OWR A;  3SHF A;  5EAM A;  2P9S C;  2HKM A;  5IJ8 E;  3K26 A;  1JOF A;  2PM9 B;  3F3F A;  2B4E A;  4PNK B;  3SWS D;  1JMZ B;  3IIY A;  4CY1 A;  4J84 A;  5H17 A;  4JSX C;  4CY2 A;  2OVQ B;  3MXX A;  3EU7 A;  5IGO A;  3RMZ D;  2IUP A;  2AGY A;  5AJA A;  2P9U C;  5FKR A;  2QXV A;  3N0D A;  5CXB A;  2AGW A;  4D0K A;  4LGN A;  3SBQ A;  2H9L A;  1FWX A;  1GXR A;  1XIP A;  2HKR A;  3MMY A;  4GM3 A;  4BL0 A;  2CN3 A;  2GC7 A;  4IA9 A;  4XYI A;  3W15 A;  1SQJ A;  4AOW A;  4CZX A;  4FA1 D;  4AEZ A;  2IWK A;  4CI8 A;  3GRE A;  4J8G A;  3SBP A;  2PBI B;  4H5I A;  5EAL A;  5IGQ A;  2HJB A;  1PI6 A;  3OKW A;  3SCY A;  3K27 A;  1P22 A;  2TRC B;  4PBZ A;  2I0T A;  2Z2P A;  3DXM C;  4GZ8 A;  4ERY A;  4MK0 B;  1N6F A;  5EMM B;  2P9L C;  3V7D B;  4CZV A;  3U4Y A;  1A0R B;  3OW8 A;  3PE7 A;  1B9Y A;  2UZX B;  5FLX g;  3OTT A;  2QC5 A;  4G56 B;  4J82 A;  4L1Q D;  3V9F A;  4GGA A;  2H47 A;  4A08 B;  3EG6 A;  5GMK n;  4X60 B;  2W18 A;  3RLM D;  4GM8 A;  3JZN A;  5A2Q g;  3PXS D;  4R7A B;  2H6Q A;  4K3J B;  4E5Z A;  4XEI C;  4JSN C;  3CIK B;  3RFH A;  4A0A A;  4ERZ A;  2XU7 A;  3DM0 A;  4GGC A;  2XYI A;  4QQE A;  5HYN B;  5GXI A;  3EI1 A;  4X63 B;  3L4O D;  4ZOZ A;  3I7L A;  1MDA H;  4GQ1 A;  5EMK B;  4J0W A;  4GM9 A;  2Q7Q A;  1SHY B;  3E0C A;  3JPX A;  1L0Q A;  5FA5 B;  2CE9 A;  2EBS A;  4QT8 A;  2J55 H;  4PC0 A;  5FKQ A;  4FAV D;  1VYH C;  5FKS A;  4E54 A;  4FA5 D;  4PXW A;  1ERJ A;  5I5M A;  5TEF A;  3PVW B;  1MG3 A;  1GP2 B;  3IIW A;  4LG8 A;  3MZL A;  2AGX A;  5HE3 B;  4OZU A;  2HES X;  4A08 A;  5SXM A;  4U1E I;  4IMM A;  3SN6 B;  2YNN A;  2J56 H;  5CYK B;  3ZWL B;  3IJ1 A;  3JZH A;  4A09 A;  3I7N A;  4E5Z B;  1OLZ A;  3VH0 A;  3ULE C;  3BG1 A;  1SQ9 A;  4J8B A;  5IC7 A;  1NEX B;  2CE8 A;  5THA A;  4A0A B;  3BG0 A;  3NVN A;  3NVQ A;  4FAN D;  2IWF A;  1PBY B;  4QRJ A;  4NSX A;  3EI1 B;  2IUQ A;  3AL8 A;  3OL2 A;  4O3T B;  1XKS A;  3AL9 A;  2H6N A;  3RN1 D;  2I3T A;  1JMX B;  5TF2 A;  3ORV D;  4O3U B;  2H3X A;  3SFZ A;  4A11 A;  2OK4 A;  2GC4 A;  4FA9 D;  3I7H A;  3PSL A;  3VGZ A;  4GMB A;  4E54 B;  5I5I A;  3P4F A;  4ZN4 A;  4CI1 A;  3RRM C;  3I7K A;  2O9K A;  4K3I D;  4TZ4 A;  3JRO A;  4UI9 R;  4FA4 D;  3AFC A;  3PVU B;  3JB9 L;  3IJC A;  3UVN A;  2HYE A;  2B5L A;  5C2V B;  3CFS B;  3SLE D;  2CN2 A;  2XL2 A;  1K32 A;  5CYK A;  5I5J A;  4A09 B;  3FM0 A;  3EI3 A;  3I7O A;  3OKT A;  5H14 A;  4BUJ C;  4J87 A;  2G99 A;  3KRW B;  3B7F A;  3DSM A;  4ERQ A;  4ESG A;  2Z2N A;  3SJL D;  2H9P A;  3I7P A;  3SVW D;  4CZY A;  3I2N A;  2OVR B;  4J0X A;  2PM7 B;  2G9A A;  2GNQ A;  3CFV A;  5FKT A;  2YMU A;  4O9D A;  3IKO A;  3AL8 B;  4J77 A;  3OL2 B;  4FWW A;  4GQ2 P;  2Z2O A;  3EI2 A;  4YVD A;  3UVM A;  1TYQ C;  4X3E A;  2AH1 A;  4ZOY A;  1TBG A;  3BWS A;  4A11 B;  3RSE C;  3UVO A;  5EMJ B;  1S4U X;  3UKU C;  2B5N A;  4A0B A;  3NVX A;  2H9M A;  4H5J A;  4L3H D;  2AQ5 A;  3OKY A;  4PSW B;  2CO0 C;  3JAM g;  1YFQ A;  2AH0 A;  4ES0 A;  4Z8L A;  3MZK A;  4BH6 A;  3DWL C;  3F3P A;  5GXH A;  3C99 A;  2H9N A;  1JJU B;  4XYH A;  1MG2 A;  4J73 A;  2IUV A;  5EAR A;  3MKQ A;  5EML B;  2AGZ A;  3RFG A;  4X61 B;  4JT5 C;  3C5M A;  2H6K A;  3DXK C;  5IT9 g;  1PEV A;  1PGU A;  3EMH A;  3JZG A;  4O1Q D;  2OJY A;  3EI3 B;  3AH8 B;  3IJ0 A;  2BBK H;  4JXM A;  2YBA A;  2P9I C;  3FGB A;  4CI3 A;  4ZOV A;  2HXC A;  4L9O A;  4Y5R D;  3VA6 A;  4A2M A;  2P9N C;  4CY5 A;  5H1M A;  4J86 A;  5EM2 B;  5IJ7 E;  3C9C A;  3EWE A;  3UKR C;  4PSX B;  3RN0 D;  2XL3 A;  3J80 g;  2CO0 A;  5GSA A;  3EI2 B;  4JD2 C;  5HQG A;  4I79 A;  1Q47 A;  5C2W B;  4A7J A;  1R5M A;  5HE0 B;  2I0R A;  5FQD A;  5B4W A;  4A0B B;  2CNX A;  4HDJ A;  2H68 A;  4GGD A;  3OKY B;  2MTA H;  4O45 A;  4CI2 A;  5KDO B;  5AFU 3;  2YNO A;  4FB1 D;  2B5M A;  4JSV C;  3EI4 A;  3UR4 A;  1QNI A;  4JT6 C;  3I8C A;  3KRX B;  2PM6 B;  5EAP A;  3F3G A;  3I89 A;  4U7A A;  3ODT A;  5CXC A;  5HE2 B;  3C75 H;  5FXY A;  1U2V C;  2IUR A;  4ZOX A;  1B9X A;  3SXT D;  4LG9 A;  3A0F A;  3HFQ A;  5K1C C;  4GQB B;  2PM9 A;  2OK6 A;  2OIZ A;  2YB8 B;  2P9P C;  2J57 G;  3PXW D;  3PXT D;  3GFC A;  5C9Z B;  1K8K C;  1RI6 A;  4J81 A;  2H14 A;  3SMR A;  4CY3 A;  4J78 A;  3MKS B;  3L4M D;  3UVK A;  4J79 A;  3PSC B;  3N0E A;  1OMW B;  1GOT B;  2UZY B;  5EM2 A;  5CXB B;  3V5W B;  2AGL A;  3JRP A;  2IAA A;  4PBY A;  4D6V A;  2OVP B;  2I0S A;  4N14 A;  5K19 A;  3J81 g;  2YNP A; 
#chains in the Genus database with same CATH topology
 4A2L A;  5M5R A;  2P9K C;  3SBR A;  4Y7R A;  4KFM B;  2BCJ B;  4QL1 A;  4JSP C;  2HJ4 A;  3EI4 B;  4G1M A;  2H13 A;  1NR0 A;  4EWR A;  5TDH B;  3FRX A;  5AMS A;  4CC9 A;  1YR2 A;  4NEN A;  5JWZ A;  1N6D A;  4DNV A;  4L1M A;  3UVL A;  1XHM A;  2I3S A;  5HE1 B;  1U4C A;  3V4P A;  3DDU A;  4AN1 A;  2VZ3 A;  3I8E A;  5CXC B;  1N6E A;  4AMY A;  1GG2 B;  4FHL A;  4L3G D;  3ZDX A;  3IUQ A;  3V4V A;  5TEE A;  4OWR A;  3SHF A;  5EAM A;  2P9S C;  2HKM A;  5IJ8 E;  3K26 A;  1JOF A;  2PM9 B;  3F3F A;  2B4E A;  1K3I A;  5FFO A;  4PNK B;  3SWS D;  1JMZ B;  3IIY A;  4CY1 A;  4J84 A;  5H17 A;  4JSX C;  4CY2 A;  1UOQ A;  3IUR A;  2OVQ B;  3MXX A;  3EU7 A;  5IGO A;  3RMZ D;  2IUP A;  2AGY A;  1UTC A;  2VDM A;  5AJA A;  5M5U A;  2P9U C;  5FKR A;  2QXV A;  3N0D A;  5CXB A;  4DNU A;  2AGW A;  4D0K A;  4LGN A;  3SBQ A;  2H9L A;  1FWX A;  1GXR A;  1XIP A;  3MMY A;  2HKR A;  4GM3 A;  4IRZ A;  4BL0 A;  2CN3 A;  2GC7 A;  4IA9 A;  4XYI A;  3W15 A;  1SQJ A;  4Z7O A;  4AOW A;  2XE4 A;  3ZE0 A;  4CZX A;  4FA1 D;  4AEZ A;  4AN0 A;  2IWK A;  1VZ2 A;  4CI8 A;  3GRE A;  4J8G A;  3IUJ A;  4WK4 A;  2PBI B;  4H5I A;  3SBP A;  3IUM A;  2EID A;  5EAL A;  5IGQ A;  2HJB A;  1PI6 A;  3OKW A;  3SCY A;  4JHN A;  3K27 A;  1P22 A;  2TRC B;  4PBZ A;  2I0T A;  3K71 A;  2Z2P A;  3DXM C;  4GZ8 A;  4DNW A;  4ERY A;  4MK0 B;  2HU8 A;  1N6F A;  2VZ1 A;  4BCC A;  5EMM B;  2P9L C;  3V7D B;  4CZV A;  2VDO A;  4BP8 A;  3U4Y A;  1A0R B;  3OW8 A;  3PE7 A;  1B9Y A;  2UZX B;  3GC3 B;  1M1X A;  5FLX g;  3OTT A;  2QC5 A;  2XZG A;  1QFS A;  4G56 B;  4BP9 A;  4J82 A;  4L1Q D;  3V9F A;  4GGA A;  2H47 A;  4A08 B;  3EG6 A;  5GMK n;  4X60 B;  2W18 A;  3RLM D;  4GM8 A;  3JZN A;  5A2Q g;  3PXS D;  4R7A B;  2H6Q A;  1L5G A;  1O6F A;  4K3J B;  4E5Z A;  4XEI C;  4JSN C;  3CIK B;  4O02 A;  1JV2 A;  3IUL A;  3RFH A;  3VI3 A;  4D9S A;  4A0A A;  4ERZ A;  2XU7 A;  3DM0 A;  4GGC A;  2XYI A;  1I2M B;  2WQ8 A;  3ZDZ A;  4QQE A;  1T2X A;  5HYN B;  5GXI A;  3EI1 A;  4X63 B;  4QAM A;  3L4O D;  4ZOZ A;  3I7L A;  1MDA H;  4GQ1 A;  2QZP A;  5EMK B;  1U8C A;  4J0W A;  1QFM A;  4GM9 A;  2Q7Q A;  1SHY B;  3JPX A;  3E0C A;  1L0Q A;  5FA5 B;  2CE9 A;  2EBS A;  4QT8 A;  2J55 H;  3O4I A;  4PC0 A;  1GOG A;  5FKQ A;  4WK2 A;  3ZE2 A;  4FAV D;  1VYH C;  5FKS A;  4E54 A;  4FA5 D;  4PXW A;  1ERJ A;  5I5M A;  5TEF A;  3PVW B;  1MG3 A;  1GP2 B;  3IIW A;  4LG8 A;  3MZL A;  2AGX A;  5HE3 B;  2EIE A;  4OZU A;  2HES X;  3IVM A;  4A08 A;  5SXM A;  1E8N A;  4IMM A;  4U1E I;  3O4G A;  3SN6 B;  2YNN A;  2J56 H;  1VE7 A;  3VI4 A;  5CYK B;  3ZWL B;  3IJ1 A;  3JZH A;  4A09 A;  3I7N A;  4E5Z B;  2VDN A;  1OLZ A;  3VH0 A;  1BPO A;  3ULE C;  3BG1 A;  1SQ9 A;  2VDK A;  4J8B A;  1O6G A;  5IC7 A;  3GD1 I;  3MVD K;  1NEX B;  2CE8 A;  3T3M A;  4G55 A;  5THA A;  4A0A B;  3BG0 A;  3NVN A;  3NVQ A;  4FAN D;  2IWF A;  1PBY B;  4QRJ A;  4NSX A;  3EI1 B;  2IUQ A;  2HU5 A;  3AL8 A;  3OL2 A;  1E5T A;  4O3T B;  1XKS A;  3AL9 A;  2H6N A;  3RN1 D;  2BKL A;  2I3T A;  1JMX B;  5C86 A;  5TF2 A;  3ORV D;  4O3U B;  2H3X A;  3SFZ A;  4A11 A;  2OK4 A;  2GC4 A;  4FA9 D;  3I7H A;  3PSL A;  3VGZ A;  4NAA A;  4GMB A;  4E54 B;  5I5I A;  3P4F A;  4ZN4 A;  4CI1 A;  3RRM C;  3I7K A;  1UOO A;  2O9K A;  4K3I D;  4WJK A;  4TZ4 A;  3JRO A;  4UI9 R;  4FA4 D;  3AFC A;  3PVU B;  3JB9 L;  3IJC A;  3UVN A;  4AMZ A;  2HYE A;  4NC4 A;  2B5L A;  5C2V B;  3CFS B;  5M5S A;  2HU7 A;  3SLE D;  1H2Z A;  2CN2 A;  1C9I A;  2XL2 A;  1K32 A;  5CYK A;  5I5J A;  4A09 B;  3FM0 A;  3EQ9 A;  3EI3 A;  3I7O A;  5M5V A;  3OKT A;  5H14 A;  4BUJ C;  4J87 A;  2G99 A;  3KRW B;  3B7F A;  1A12 A;  3DSM A;  1GOH A;  3ZE1 A;  4ERQ A;  2EIB A;  2VDQ A;  1H2Y A;  4ESG A;  2Z2N A;  3KCI A;  3SJL D;  3I7P A;  2H9P A;  3SVW D;  1H2W A;  4CZY A;  3I2N A;  2OVR B;  4J0X A;  2PM7 B;  2G9A A;  2GNQ A;  3CFV A;  2VDP A;  3O4J A;  5FKT A;  2YMU A;  3IKO A;  3AL8 B;  4J77 A;  3OL2 B;  4FWW A;  4JHP C;  4O9D A;  4GQ2 P;  1C9L A;  2Z2O A;  3EI2 A;  4YVD A;  3UVM A;  1TYQ C;  4X3E A;  2AH1 A;  4ZOY A;  3QHY B;  2XDW A;  1TBG A;  3BWS A;  4A11 B;  3RSE C;  3UVO A;  5EMJ B;  1S4U X;  5HDB A;  3UKU C;  2B5N A;  4A0B A;  3NVX A;  2H9M A;  4UM9 A;  4H5J A;  4G1E A;  2AQ5 A;  3OKY A;  4L3H D;  1GOF A;  2CO0 C;  4PSW B;  3JAM g;  1YFQ A;  2AH0 A;  4ES0 A;  4Z8L A;  3MZK A;  4BH6 A;  3DWL C;  3F3P A;  5GXH A;  3C99 A;  2H9N A;  1JJU B;  5M5T A;  4XYH A;  1MG2 A;  5E6R A;  4J73 A;  2IUV A;  5EAR A;  1H2X A;  3MKQ A;  4MMZ A;  5EML B;  2AGZ A;  3RFG A;  3T3P A;  4WK0 A;  4X61 B;  4JT5 C;  3C5M A;  2H6K A;  5E6U A;  3DXK C;  5IT9 g;  3K6S A;  1PEV A;  1PGU A;  3EMH A;  3JZG A;  4O1Q D;  4BCB A;  2OJY A;  3EI3 B;  3AH8 B;  3IJ0 A;  2BBK H;  4JXM A;  2YBA A;  2P9I C;  1E8M A;  3FGB A;  4CI3 A;  4ZOV A;  2HXC A;  4RE6 A;  4MMX A;  5E6S A;  4L9O A;  4Y5R D;  3VA6 A;  4A2M A;  2P9N C;  4CY5 A;  5H1M A;  4J86 A;  5EM2 B;  5IJ7 E;  3C9C A;  5M61 A;  3EWE A;  2VDL A;  3UKR C;  4PSX B;  4BCD A;  3RN0 D;  2JKX A;  2XL3 A;  3J80 g;  2CO0 A;  4AX4 A;  5GSA A;  3EI2 B;  4JD2 C;  5HQG A;  4I79 A;  3MUN A;  2EIC A;  1Q47 A;  5C2W B;  3ZDY A;  4A7J A;  1R5M A;  5HE0 B;  3NID A;  2I0R A;  5FQD A;  2VC2 A;  3OF7 A;  5B4W A;  4A0B B;  2CNX A;  2VDR A;  4HDJ A;  2H68 A;  4GGD A;  3OKY B;  2MTA H;  4O45 A;  4CI2 A;  5KDO B;  4MMY A;  5AFU 3;  2YNO A;  3MUO A;  4FB1 D;  2B5M A;  4JSV C;  3EI4 A;  3UR4 A;  1QNI A;  4JT6 C;  5C92 A;  3QI0 A;  3I8C A;  3KRX B;  2PM6 B;  3O4H A;  5EAP A;  4Z7Q A;  1VE6 A;  3F3G A;  3I89 A;  1JTD B;  4U7A A;  3ODT A;  5CXC A;  1UOP A;  3EQ7 A;  5HE2 B;  3C75 H;  5FXY A;  1U2V C;  2IUR A;  1TYE A;  2QR5 A;  4ZOX A;  1B9X A;  4NBM A;  3SXT D;  4LG9 A;  3A0F A;  3HFQ A;  5K1C C;  4GQB B;  3EQ8 A;  2PM9 A;  2OK6 A;  2OIZ A;  2YB8 B;  4RE5 A;  2P9P C;  2J57 G;  3PXW D;  3PXT D;  3GFC A;  4Z7N A;  5C9Z B;  1K8K C;  1RI6 A;  3NIG A;  4J81 A;  2H14 A;  3SMR A;  4CY3 A;  3IJE A;  3K72 A;  4J78 A;  3MKS B;  3L4M D;  5FFG A;  4J79 A;  3UVK A;  3PSC B;  4UM8 A;  3FCU A;  3N0E A;  1OMW B;  1GOT B;  2UZY B;  5EM2 A;  5CXB B;  3V5W B;  2AGL A;  3JRP A;  2IAA A;  4PBY A;  4D6V A;  1VZ3 A;  3IUN A;  4O2W A;  2OVP B;  2I0S A;  4N14 A;  3NIF A;  5K19 A;  3J81 g;  3FCS A;  2YNP A; 
#chains in the Genus database with same CATH homology
 4A2L A;  2P9K C;  3SBR A;  4Y7R A;  4KFM B;  2BCJ B;  4QL1 A;  4JSP C;  2HJ4 A;  3EI4 B;  2H13 A;  1NR0 A;  4EWR A;  5TDH B;  3FRX A;  5AMS A;  4CC9 A;  5JWZ A;  1N6D A;  3UVL A;  1XHM A;  2I3S A;  5HE1 B;  1U4C A;  3I8E A;  5CXC B;  1N6E A;  1GG2 B;  4FHL A;  4L3G D;  5TEE A;  4OWR A;  3SHF A;  5EAM A;  2P9S C;  2HKM A;  5IJ8 E;  3K26 A;  1JOF A;  2PM9 B;  3F3F A;  2B4E A;  4PNK B;  3SWS D;  1JMZ B;  3IIY A;  4CY1 A;  4J84 A;  5H17 A;  4JSX C;  4CY2 A;  2OVQ B;  3MXX A;  3EU7 A;  5IGO A;  3RMZ D;  2IUP A;  2AGY A;  5AJA A;  2P9U C;  5FKR A;  2QXV A;  3N0D A;  5CXB A;  2AGW A;  4D0K A;  4LGN A;  3SBQ A;  2H9L A;  1FWX A;  1GXR A;  1XIP A;  2HKR A;  3MMY A;  4GM3 A;  4BL0 A;  2CN3 A;  2GC7 A;  4IA9 A;  4XYI A;  3W15 A;  1SQJ A;  4AOW A;  4CZX A;  4FA1 D;  4AEZ A;  2IWK A;  4CI8 A;  3GRE A;  4J8G A;  3SBP A;  2PBI B;  4H5I A;  5EAL A;  5IGQ A;  2HJB A;  1PI6 A;  3OKW A;  3SCY A;  3K27 A;  1P22 A;  2TRC B;  4PBZ A;  2I0T A;  2Z2P A;  3DXM C;  4GZ8 A;  4ERY A;  4MK0 B;  1N6F A;  5EMM B;  2P9L C;  3V7D B;  4CZV A;  3U4Y A;  1A0R B;  3OW8 A;  3PE7 A;  1B9Y A;  2UZX B;  5FLX g;  3OTT A;  2QC5 A;  4G56 B;  4J82 A;  4L1Q D;  3V9F A;  4GGA A;  2H47 A;  4A08 B;  3EG6 A;  5GMK n;  4X60 B;  2W18 A;  3RLM D;  4GM8 A;  3JZN A;  5A2Q g;  3PXS D;  4R7A B;  2H6Q A;  4K3J B;  4E5Z A;  4XEI C;  4JSN C;  3CIK B;  3RFH A;  4A0A A;  4ERZ A;  2XU7 A;  3DM0 A;  4GGC A;  2XYI A;  4QQE A;  5HYN B;  5GXI A;  3EI1 A;  4X63 B;  3L4O D;  4ZOZ A;  3I7L A;  1MDA H;  4GQ1 A;  5EMK B;  4J0W A;  4GM9 A;  2Q7Q A;  1SHY B;  3E0C A;  3JPX A;  1L0Q A;  5FA5 B;  2CE9 A;  2EBS A;  4QT8 A;  2J55 H;  4PC0 A;  5FKQ A;  4FAV D;  1VYH C;  5FKS A;  4E54 A;  4FA5 D;  4PXW A;  1ERJ A;  5I5M A;  5TEF A;  3PVW B;  1MG3 A;  1GP2 B;  3IIW A;  4LG8 A;  3MZL A;  2AGX A;  5HE3 B;  4OZU A;  2HES X;  4A08 A;  5SXM A;  4U1E I;  4IMM A;  3SN6 B;  2YNN A;  2J56 H;  5CYK B;  3ZWL B;  3IJ1 A;  3JZH A;  4A09 A;  3I7N A;  4E5Z B;  1OLZ A;  3VH0 A;  3ULE C;  3BG1 A;  1SQ9 A;  4J8B A;  5IC7 A;  1NEX B;  2CE8 A;  5THA A;  4A0A B;  3BG0 A;  3NVN A;  3NVQ A;  4FAN D;  2IWF A;  1PBY B;  4QRJ A;  4NSX A;  3EI1 B;  2IUQ A;  3AL8 A;  3OL2 A;  4O3T B;  1XKS A;  3AL9 A;  2H6N A;  3RN1 D;  2I3T A;  1JMX B;  5TF2 A;  3ORV D;  4O3U B;  2H3X A;  3SFZ A;  4A11 A;  2OK4 A;  2GC4 A;  4FA9 D;  3I7H A;  3PSL A;  3VGZ A;  4GMB A;  4E54 B;  5I5I A;  3P4F A;  4ZN4 A;  4CI1 A;  3RRM C;  3I7K A;  2O9K A;  4K3I D;  4TZ4 A;  3JRO A;  4UI9 R;  4FA4 D;  3AFC A;  3PVU B;  3JB9 L;  3IJC A;  3UVN A;  2HYE A;  2B5L A;  5C2V B;  3CFS B;  3SLE D;  2CN2 A;  2XL2 A;  1K32 A;  5CYK A;  5I5J A;  4A09 B;  3FM0 A;  3EI3 A;  3I7O A;  3OKT A;  5H14 A;  4BUJ C;  4J87 A;  2G99 A;  3KRW B;  3B7F A;  3DSM A;  4ERQ A;  4ESG A;  2Z2N A;  3SJL D;  2H9P A;  3I7P A;  3SVW D;  4CZY A;  3I2N A;  2OVR B;  4J0X A;  2PM7 B;  2G9A A;  2GNQ A;  3CFV A;  5FKT A;  2YMU A;  4O9D A;  3IKO A;  3AL8 B;  4J77 A;  3OL2 B;  4FWW A;  4GQ2 P;  2Z2O A;  3EI2 A;  4YVD A;  3UVM A;  1TYQ C;  4X3E A;  2AH1 A;  4ZOY A;  1TBG A;  3BWS A;  4A11 B;  3RSE C;  3UVO A;  5EMJ B;  1S4U X;  3UKU C;  2B5N A;  4A0B A;  3NVX A;  2H9M A;  4H5J A;  4L3H D;  2AQ5 A;  3OKY A;  4PSW B;  2CO0 C;  3JAM g;  1YFQ A;  2AH0 A;  4ES0 A;  4Z8L A;  3MZK A;  4BH6 A;  3DWL C;  3F3P A;  5GXH A;  3C99 A;  2H9N A;  1JJU B;  4XYH A;  1MG2 A;  4J73 A;  2IUV A;  5EAR A;  3MKQ A;  5EML B;  2AGZ A;  3RFG A;  4X61 B;  4JT5 C;  3C5M A;  2H6K A;  3DXK C;  5IT9 g;  1PEV A;  1PGU A;  3EMH A;  3JZG A;  4O1Q D;  2OJY A;  3EI3 B;  3AH8 B;  3IJ0 A;  2BBK H;  4JXM A;  2YBA A;  2P9I C;  3FGB A;  4CI3 A;  4ZOV A;  2HXC A;  4L9O A;  4Y5R D;  3VA6 A;  4A2M A;  2P9N C;  4CY5 A;  5H1M A;  4J86 A;  5EM2 B;  5IJ7 E;  3C9C A;  3EWE A;  3UKR C;  4PSX B;  3RN0 D;  2XL3 A;  3J80 g;  2CO0 A;  5GSA A;  3EI2 B;  4JD2 C;  5HQG A;  4I79 A;  1Q47 A;  5C2W B;  4A7J A;  1R5M A;  5HE0 B;  2I0R A;  5FQD A;  5B4W A;  4A0B B;  2CNX A;  4HDJ A;  2H68 A;  4GGD A;  3OKY B;  2MTA H;  4O45 A;  4CI2 A;  5KDO B;  5AFU 3;  2YNO A;  4FB1 D;  2B5M A;  4JSV C;  3EI4 A;  3UR4 A;  1QNI A;  4JT6 C;  3I8C A;  3KRX B;  2PM6 B;  5EAP A;  3F3G A;  3I89 A;  4U7A A;  3ODT A;  5CXC A;  5HE2 B;  3C75 H;  5FXY A;  1U2V C;  2IUR A;  4ZOX A;  1B9X A;  3SXT D;  4LG9 A;  3A0F A;  3HFQ A;  5K1C C;  4GQB B;  2PM9 A;  2OK6 A;  2OIZ A;  2YB8 B;  2P9P C;  2J57 G;  3PXW D;  3PXT D;  3GFC A;  5C9Z B;  1K8K C;  1RI6 A;  4J81 A;  2H14 A;  3SMR A;  4CY3 A;  4J78 A;  3MKS B;  3L4M D;  3UVK A;  4J79 A;  3PSC B;  3N0E A;  1OMW B;  1GOT B;  2UZY B;  5EM2 A;  5CXB B;  3V5W B;  2AGL A;  3JRP A;  2IAA A;  4PBY A;  4D6V A;  2OVP B;  2I0S A;  4N14 A;  5K19 A;  3J81 g;  2YNP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...