3EMHA

Structural basis of wdr5-mll interaction
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
300
structure length
300
Chain Sequence
PNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title WDR5 Interacts with Mixed Lineage Leukemia (MLL) Protein via the Histone H3-binding Pocket.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
molecule keywords WD repeat-containing protein 5
total genus 100
structure length 300
sequence length 300
ec nomenclature
pdb deposition date 2008-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3emhA00
2YNOA 3AL8B 4PSWB 3ZWLB 5IC7A 2H6KA 3UVLA 1S4UX 2PM7B 1TYQC 4E5ZA 4GM8A 2J56H 3B7FA 4J79A 4PBZA 3A0FA 1FWXA 5FXYA 2H3XA 1N6DA 3VH0A 4K3JB 4L3GD 3AL8A 2UZXB 4X63B 5IT9g 4J84A 4O1QD 1PEVA 4FA5D 4CI2A 1MG3A 1OLZA 2G99A 5CXBA 1NR0A 1B9YA 3MXXA 3I8EA 5FKQA 3V9FA 4Y5RD 3OKTA 2OVRB 4J73A 4FA4D 2W18A 1GP2B 5HE0B 3RLMD 2I3TA 3EI4B 2YMUA 3I7HA 4J0XA 5EMJB 2B4EA 2AH1A 3UVOA 2CO0C 5CYKB 1GOTB 5B4WA 3DWLC 3BG0A 1JMZB 3MKSB 3PSCB 2QXVA 2P9IC 5H17A 3MZKA 4J77A 4E54A 3BG1A 3OL2A 4A09A 5K1CC 3BWSA 3GREA 3UVKA 3JAMg 3AL9A 5HE1B 3NVQA 4U7AA 2H6QA 4FHLA 4CC9A 3U4YA 1JJUB 5H1MA 3SMRA 2P9SC 4LG9A 4BH6A 5EM2B 4XEIC 4E54B 2BCJB 3W15A 4XYHA 4A0AB 2H13A 3V5WB 4Y7RA 1L0QA 4GQBB 3NVXA 2XL2A 4ERYA 3JPXA 3KRXB 4ZOXA 1QNIA 4A11B 4ZOVA 4JSPC 3OKWA 3KRWB 4FAVD 2CO0A 2YB8B 3CFVA 3P4FA 4J87A 3SJLD 4H5IA 3E0CA 3MZLA 3OKYB 5FLXg 3ULEC 3PVWB 3SHFA 3EI2A 3SWSD 1SQ9A 4O9DA 4X61B 1JMXB 1U4CA 4FA9D 3JB9L 3SBPA 2H68A 3UVNA 3J81g 1JOFA 1Q47A 4QL1A 2H14A 3I8CA 5C2VB 4J8BA 3MMYA 2H9NA 2IWKA 4KFMB 5I5JA 1OMWB 1XIPA 5H14A 4GM9A 5C9ZB 3I7OA 4A7JA 4PXWA 4BL0A 5GXHA 3EI2B 3SVWD 3OW8A 2HKRA 4JT6C 3OTTA 2I0SA 5FKTA 2P9PC 3IJCA 2B5MA 4O45A 3JZNA 2P9LC 4J0WA 4PSXB 3JZGA 4ERZA 1N6EA 4A08A 2H9LA 4JSVC 4ES0A 4D0KA 3DM0A 2GNQA 4GQ1A 3V7DB 3JZHA 4AEZA 4CZYA 4H5JA 2IUPA 4TZ4A 5EALA 4Z8LA 4A08B 2AGWA 2HKMA 2PM9A 3MKQA 2XU7A 3I7PA 4XYIA 4LGNA 4CY2A 5HE2B 1MDAH 4PBYA 1K8KC 3CFSB 4A0BB 5K19A 2O9KA 5FA5B 3N0EA 3SBRA 4JSNC 2UZYB 1A0RB 1PGUA 2AGYA 3ORVD 2PM9B 4GQ2P 2I0TA 2P9UC 4A2MA 5GXIA 3EWEA 3K26A 4EWRA 3C99A 3CIKB 4FAND 5KDOB 3PXWD 1SQJA 3L4OD 3AH8B 4PNKB 2HXCA 2G9AA 2CNXA 4YVDA 2HJ4A 4FWWA 3J80g 4CY5A 2AQ5A 2H9MA 4GZ8A 3DXKC 4JSXC 3I7KA 3I7LA 5EMKB 4U1EI 3UKUC 4L3HD 3FRXA 4G56B 5AMSA 3FGBA 4ZOZA 1N6FA 4O3TB 2H6NA 5FKSA 1YFQA 4ZOYA 3PVUB 5FKRA 2CN2A 4J81A 1VYHC 4A11A 5IGQA 3N0DA 3RFHA 2IWFA 4JT5C 3SXTD 5TF2A 3IJ1A 2TRCB 4O3UB 3RMZD 1B9XA 5CXBB 3C9CA 5HQGA 5I5MA 4L9OA 4GGAA 1PI6A 4N14A 3I7NA 4IA9A 3F3PA 5A2Qg 5CYKA 5EAPA 3GFCA 4K3ID 3EI4A 3PXTD 2Q7QA 2YNPA 3I2NA 4BUJC 5CXCA 3C5MA 1GG2B 2AH0A 3DSMA 1XKSA 3NVNA 2P9KC 2H47A 2OIZA 4CI8A 2IUVA 2XYIA 5CXCB 1SHYB 2MTAH 3VA6A 3PE7A 1U2VC 2AGXA 5EAMA 4R7AB 3FM0A 3JROA 4FB1D 2GC7A 4A0AA 1PBYB 3EI3B 4GGDA 1MG2A 5TDHB 3IJ0A 3OL2B 4A09B 3EI1B 2HJBA 2OK6A 2OVQB 3RFGA 2IUQA 3K27A 3SFZA 3C75H 2P9NC 3SN6B 2BBKH 4NSXA 5FQDA 2OVPB 4L1QD 3F3GA 4J86A 2B5LA 3EI1A 2GC4A 3EG6A 4CZVA 2B5NA 3I89A 4MK0B 5EM2A 3HFQA 2YBAA 3VGZA 5EARA 3L4MD 3IKOA 2Z2OA 2PBIB 2AGZA 3RN1D 2I0RA 3RSEC 4X60B 1ERJA 4GGCA 5I5IA 3RN0D 4FA1D 3EMHA 5IGOA 2IURA 2CN3A 4J8GA 4JXMA 4LG8A 2CE9A 3EI3A 2Z2PA 5EMLB 3ODTA 4UI9R 2EBSA 3UVMA 4J82A 4IMMA 5C2WB 3EU7A 3UKRC 4GMBA 4D6VA 3SBQA 5EMMB 4ESGA 5AJAA 3PXSD 4HDJA 1P22A 3AFCA 5SXMA 5IJ8E 3JRPA 4QRJA 1GXRA 1NEXB 4J78A 4CZXA 2QC5A 4CY1A 5IJ7E 3SLED 2I3SA 4QQEA 5TEFA 5HYNB 1K32A 4JD2C 5GMKn 2OK4A 3UR4A 2Z2NA 4ZN4A 4GM3A 4A2LA 2OJYA 1XHMA 3SCYA 3OKYA 4CI1A 5TEEA 4CI3A 2HESX 2IAAA 3PSLA 4I79A 4A0BA 5GSAA 4PC0A 4ERQA 4AOWA 2CE8A 3F3FA 5AFU3 2YNNA 2J55H 1R5MA 4QT8A 4OZUA 4E5ZB 2PM6B 3DXMC 5HE3B 5JWZA 1TBGA 2J57G 3IIWA 2H9PA 4CY3A 3IIYA 2AGLA 4X3EA 3RRMC 2XL3A 2HYEA 1RI6A 4OWRA 5THAA
chains in the Genus database with same CATH superfamily
2YNOA 1UOPA 3AL8B 4PSWB 3ZWLB 5IC7A 1H2WA 4Z7QA 3QI0A 2H6KA 3UVLA 1S4UX 2PM7B 1TYQC 5E6UA 4E5ZA 4GM8A 2J56H 3B7FA 4J79A 4UM8A 4PBZA 4UM9A 3A0FA 1FWXA 5FXYA 3K72A 2H3XA 1N6DA 3VH0A 4K3JB 4L3GD 1H2ZA 3AL8A 2UZXB 3DDUA 4X63B 1GOHA 5IT9g 4J84A 4O1QD 4AX4A 1PEVA 4FA5D 4CI2A 1MG3A 1OLZA 1TYEA 1L5GA 3ZDZA 2G99A 5CXBA 1NR0A 1B9YA 1C9LA 3MXXA 3I8EA 4G1EA 3FCUA 5FKQA 4Z7OA 2WQ8A 3V9FA 4Y5RD 3OKTA 2OVRB 4J73A 2VDRA 4FA4D 2W18A 2VDMA 1GP2B 5HE0B 4JHNA 3RLMD 2I3TA 3EI4B 2YMUA 3I7HA 5E6RA 4J0XA 5EMJB 2B4EA 2AH1A 3UVOA 4MMYA 2CO0C 3MUNA 2VDOA 5CYKB 1GOTB 5B4WA 3DWLC 3BG0A 1JMZB 3MKSB 3PSCB 1GOGA 2QXVA 2P9IC 5H17A 3MZKA 4J77A 4E54A 4WK4A 1C9IA 3BG1A 3OL2A 4A09A 4RE6A 5K1CC 3BWSA 3GREA 3UVKA 3JAMg 1UOOA 2EIDA 3AL9A 5HE1B 3NVQA 3V4PA 4U7AA 2H6QA 4FHLA 4CC9A 3U4YA 1JJUB 5FFGA 5H1MA 3SMRA 2P9SC 4LG9A 4BH6A 5EM2B 4XEIC 4E54B 2BCJB 3W15A 4XYHA 4A0AB 2QR5A 2H13A 3V5WB 4Y7RA 3OF7A 1L0QA 4GQBB 3NVXA 2XL2A 4ERYA 3JPXA 3KRXB 4ZOXA 1QNIA 4A11B 4ZOVA 4JSPC 3OKWA 3KRWB 4FAVD 3FCSA 2CO0A 3NIGA 2YB8B 3CFVA 3GC3B 3P4FA 3NIFA 4NENA 4J87A 3SJLD 4H5IA 4Z7NA 3E0CA 2VDPA 3MZLA 3OKYB 5FLXg 3ULEC 3PVWB 3SHFA 3EI2A 3SWSD 1SQ9A 4O9DA 3O4HA 4X61B 1JMXB 1U4CA 4FA9D 4NBMA 3JB9L 3SBPA 2H68A 3UVNA 3J81g 1JOFA 1Q47A 4QL1A 2H14A 3I8CA 5C2VB 4J8BA 3MMYA 2H9NA 2IWKA 4KFMB 5I5JA 1UTCA 1XIPA 1OMWB 5H14A 4AN0A 5C92A 4GM9A 2VDNA 5C9ZB 3I7OA 3V4VA 4A7JA 4RE5A 4PXWA 4BL0A 4BCBA 5GXHA 3EI2B 4NAAA 3IUMA 3SVWD 3OW8A 2HKRA 4JT6C 4AMZA 3OTTA 2I0SA 5FKTA 2P9PC 3IJCA 2JKXA 2B5MA 4O45A 1UOQA 3JZNA 2VC2A 3GD1I 2P9LC 2VDKA 4J0WA 4PSXB 3JZGA 3T3MA 1GOFA 4ERZA 2VZ3A 1N6EA 4A08A 2H9LA 4NC4A 4JSVC 3NIDA 3IUJA 4ES0A 4D0KA 3MVDK 3DM0A 2GNQA 4GQ1A 3V7DB 3JZHA 4DNWA 4AEZA 4CZYA 4H5JA 2IUPA 4TZ4A 5EALA 4Z8LA 4A08B 2AGWA 2HKMA 2PM9A 3MKQA 5M61A 2XU7A 3I7PA 2XDWA 4XYIA 4LGNA 5E6SA 4CY2A 5HE2B 1MDAH 4PBYA 1H2XA 1K8KC 3CFSB 4A0BB 5K19A 2O9KA 3O4IA 2HU5A 4IRZA 5FA5B 3N0EA 3SBRA 4JSNC 2UZYB 1A0RB 1PGUA 2AGYA 3ORVD 3VI4A 2PM9B 4GQ2P 2I0TA 2P9UC 4A2MA 5GXIA 1I2MB 3EWEA 3K26A 4EWRA 3C99A 3CIKB 4FAND 5KDOB 3PXWD 1SQJA 3L4OD 3IVMA 3AH8B 4PNKB 2HXCA 2G9AA 2CNXA 4YVDA 2HJ4A 4FWWA 5HDBA 3J80g 1A12A 4CY5A 2AQ5A 2H9MA 4GZ8A 3DXKC 4JSXC 3I7KA 3I7LA 5EMKB 4U1EI 3UKUC 2VDQA 4L3HD 3FRXA 4G56B 5AMSA 3FGBA 4ZOZA 1N6FA 4O3TB 2H6NA 5FKSA 1YFQA 4ZOYA 3PVUB 4G1MA 5FKRA 1E5TA 2CN2A 4J81A 1VYHC 4BP8A 4A11A 5IGQA 3N0DA 3RFHA 4AN1A 2IWFA 4JT5C 3SXTD 5TF2A 3IJ1A 2TRCB 4O3UB 3RMZD 4WJKA 1B9XA 5CXBB 3C9CA 3K71A 5HQGA 5I5MA 1U8CA 1VZ3A 4L9OA 4GGAA 3EQ7A 4DNVA 1PI6A 4N14A 3I7NA 4IA9A 3F3PA 4MMZA 5A2Qg 5CYKA 4D9SA 3EQ8A 5EAPA 3GFCA 4K3ID 3EI4A 4MMXA 3PXTD 2Q7QA 2YNPA 3I2NA 4BUJC 5CXCA 1E8MA 3C5MA 3O4JA 1GG2B 5M5RA 3ZE1A 2AH0A 2QZPA 3DSMA 1XKSA 3IUQA 3VI3A 4AMYA 3NVNA 2P9KC 5M5SA 1VE6A 2H47A 2OIZA 1YR2A 4CI8A 2IUVA 2XYIA 5CXCB 1SHYB 2MTAH 4BCCA 3VA6A 3PE7A 1U2VC 2AGXA 5EAMA 4R7AB 3FM0A 3JROA 1JTDB 4FB1D 4QAMA 2GC7A 4A0AA 1PBYB 2HU7A 5M5VA 3EI3B 4GGDA 1MG2A 5TDHB 1T2XA 3IJ0A 3OL2B 4A09B 3EI1B 2HJBA 2OK6A 3IUNA 2OVQB 3RFGA 2VDLA 1O6FA 2IUQA 3K27A 3IULA 3SFZA 3C75H 3ZDYA 2P9NC 3ZDXA 3SN6B 2BBKH 4NSXA 5FQDA 2OVPB 4L1QD 3F3GA 4J86A 2B5LA 3EI1A 3T3PA 5FFOA 2GC4A 3EG6A 4CZVA 1VE7A 1QFSA 1O6GA 4L1MA 2B5NA 3I89A 4MK0B 5EM2A 3HFQA 3ZE2A 2YBAA 3VGZA 5EARA 3L4MD 1QFMA 3IKOA 3K6SA 4WK0A 2EIEA 2Z2OA 2PBIB 2AGZA 1BPOA 3EQ9A 2I0RA 3RN1D 3RSEC 4X60B 1ERJA 4GGCA 5I5IA 3RN0D 4FA1D 3EMHA 5IGOA 2IURA 4BCDA 2CN3A 4J8GA 4JXMA 2XE4A 4LG8A 2CE9A 3EI3A 2Z2PA 4O2WA 5EMLB 3ODTA 2EBSA 2HU8A 4UI9R 3QHYB 3UVMA 4J82A 1H2YA 1JV2A 4IMMA 3KCIA 5C2WB 3EU7A 3O4GA 3UKRC 4GMBA 4O02A 3SBQA 4D6VA 4ESGA 5EMMB 5AJAA 3PXSD 1E8NA 4HDJA 1P22A 5M5TA 3AFCA 5SXMA 5IJ8E 3JRPA 4QRJA 1GXRA 5C86A 1NEXB 4J78A 4CZXA 2QC5A 4CY1A 5IJ7E 4BP9A 3SLED 2I3SA 4QQEA 5TEFA 5HYNB 1VZ2A 1K32A 3MUOA 3IJEA 4JD2C 2BKLA 5GMKn 2OK4A 4JHPC 3UR4A 2Z2NA 4ZN4A 4GM3A 4A2LA 2OJYA 1XHMA 3SCYA 1K3IA 3ZE0A 3OKYA 4CI1A 5TEEA 1M1XA 4CI3A 2HESX 2IAAA 3PSLA 4I79A 4A0BA 2VZ1A 5GSAA 4PC0A 4ERQA 4AOWA 2CE8A 3F3FA 4DNUA 4G55A 5AFU3 2YNNA 2J55H 1R5MA 2EIBA 4QT8A 4OZUA 4E5ZB 2PM6B 3DXMC 5HE3B 2EICA 5JWZA 1TBGA 2J57G 3IURA 3IIWA 2H9PA 4CY3A 3IIYA 2AGLA 4X3EA 3RRMC 5M5UA 2XL3A 2HYEA 1RI6A 2XZGA 4OWRA 5THAA 4WK2A
chains in the Genus database with same CATH topology
2YNOA 3AL8B 4PSWB 3ZWLB 5IC7A 2H6KA 3UVLA 1S4UX 2PM7B 1TYQC 4E5ZA 4GM8A 2J56H 3B7FA 4J79A 4PBZA 3A0FA 1FWXA 5FXYA 2H3XA 1N6DA 3VH0A 4K3JB 4L3GD 3AL8A 2UZXB 4X63B 5IT9g 4J84A 4O1QD 1PEVA 4FA5D 4CI2A 1MG3A 1OLZA 2G99A 5CXBA 1NR0A 1B9YA 3MXXA 3I8EA 5FKQA 3V9FA 4Y5RD 3OKTA 2OVRB 4J73A 4FA4D 2W18A 1GP2B 5HE0B 3RLMD 2I3TA 3EI4B 2YMUA 3I7HA 4J0XA 5EMJB 2B4EA 2AH1A 3UVOA 2CO0C 5CYKB 1GOTB 5B4WA 3DWLC 3BG0A 1JMZB 3MKSB 3PSCB 2QXVA 2P9IC 5H17A 3MZKA 4J77A 4E54A 3BG1A 3OL2A 4A09A 5K1CC 3BWSA 3GREA 3UVKA 3JAMg 3AL9A 5HE1B 3NVQA 4U7AA 2H6QA 4FHLA 4CC9A 3U4YA 1JJUB 5H1MA 3SMRA 2P9SC 4LG9A 4BH6A 5EM2B 4XEIC 4E54B 2BCJB 3W15A 4XYHA 4A0AB 2H13A 3V5WB 4Y7RA 1L0QA 4GQBB 3NVXA 2XL2A 4ERYA 3JPXA 3KRXB 4ZOXA 1QNIA 4A11B 4ZOVA 4JSPC 3OKWA 3KRWB 4FAVD 2CO0A 2YB8B 3CFVA 3P4FA 4J87A 3SJLD 4H5IA 3E0CA 3MZLA 3OKYB 5FLXg 3ULEC 3PVWB 3SHFA 3EI2A 3SWSD 1SQ9A 4O9DA 4X61B 1JMXB 1U4CA 4FA9D 3JB9L 3SBPA 2H68A 3UVNA 3J81g 1JOFA 1Q47A 4QL1A 2H14A 3I8CA 5C2VB 4J8BA 3MMYA 2H9NA 2IWKA 4KFMB 5I5JA 1OMWB 1XIPA 5H14A 4GM9A 5C9ZB 3I7OA 4A7JA 4PXWA 4BL0A 5GXHA 3EI2B 3SVWD 3OW8A 2HKRA 4JT6C 3OTTA 2I0SA 5FKTA 2P9PC 3IJCA 2B5MA 4O45A 3JZNA 2P9LC 4J0WA 4PSXB 3JZGA 4ERZA 1N6EA 4A08A 2H9LA 4JSVC 4ES0A 4D0KA 3DM0A 2GNQA 4GQ1A 3V7DB 3JZHA 4AEZA 4CZYA 4H5JA 2IUPA 4TZ4A 5EALA 4Z8LA 4A08B 2AGWA 2HKMA 2PM9A 3MKQA 2XU7A 3I7PA 4XYIA 4LGNA 4CY2A 5HE2B 1MDAH 4PBYA 1K8KC 3CFSB 4A0BB 5K19A 2O9KA 5FA5B 3N0EA 3SBRA 4JSNC 2UZYB 1A0RB 1PGUA 2AGYA 3ORVD 2PM9B 4GQ2P 2I0TA 2P9UC 4A2MA 5GXIA 3EWEA 3K26A 4EWRA 3C99A 3CIKB 4FAND 5KDOB 3PXWD 1SQJA 3L4OD 3AH8B 4PNKB 2HXCA 2G9AA 2CNXA 4YVDA 2HJ4A 4FWWA 3J80g 4CY5A 2AQ5A 2H9MA 4GZ8A 3DXKC 4JSXC 3I7KA 3I7LA 5EMKB 4U1EI 3UKUC 4L3HD 3FRXA 4G56B 5AMSA 3FGBA 4ZOZA 1N6FA 4O3TB 2H6NA 5FKSA 1YFQA 4ZOYA 3PVUB 5FKRA 2CN2A 4J81A 1VYHC 4A11A 5IGQA 3N0DA 3RFHA 2IWFA 4JT5C 3SXTD 5TF2A 3IJ1A 2TRCB 4O3UB 3RMZD 1B9XA 5CXBB 3C9CA 5HQGA 5I5MA 4L9OA 4GGAA 1PI6A 4N14A 3I7NA 4IA9A 3F3PA 5A2Qg 5CYKA 5EAPA 3GFCA 4K3ID 3EI4A 3PXTD 2Q7QA 2YNPA 3I2NA 4BUJC 5CXCA 3C5MA 1GG2B 2AH0A 3DSMA 1XKSA 3NVNA 2P9KC 2H47A 2OIZA 4CI8A 2IUVA 2XYIA 5CXCB 1SHYB 2MTAH 3VA6A 3PE7A 1U2VC 2AGXA 5EAMA 4R7AB 3FM0A 3JROA 4FB1D 2GC7A 4A0AA 1PBYB 3EI3B 4GGDA 1MG2A 5TDHB 3IJ0A 3OL2B 4A09B 3EI1B 2HJBA 2OK6A 2OVQB 3RFGA 2IUQA 3K27A 3SFZA 3C75H 2P9NC 3SN6B 2BBKH 4NSXA 5FQDA 2OVPB 4L1QD 3F3GA 4J86A 2B5LA 3EI1A 2GC4A 3EG6A 4CZVA 2B5NA 3I89A 4MK0B 5EM2A 3HFQA 2YBAA 3VGZA 5EARA 3L4MD 3IKOA 2Z2OA 2PBIB 2AGZA 3RN1D 2I0RA 3RSEC 4X60B 1ERJA 4GGCA 5I5IA 3RN0D 4FA1D 3EMHA 5IGOA 2IURA 2CN3A 4J8GA 4JXMA 4LG8A 2CE9A 3EI3A 2Z2PA 5EMLB 3ODTA 4UI9R 2EBSA 3UVMA 4J82A 4IMMA 5C2WB 3EU7A 3UKRC 4GMBA 4D6VA 3SBQA 5EMMB 4ESGA 5AJAA 3PXSD 4HDJA 1P22A 3AFCA 5SXMA 5IJ8E 3JRPA 4QRJA 1GXRA 1NEXB 4J78A 4CZXA 2QC5A 4CY1A 5IJ7E 3SLED 2I3SA 4QQEA 5TEFA 5HYNB 1K32A 4JD2C 5GMKn 2OK4A 3UR4A 2Z2NA 4ZN4A 4GM3A 4A2LA 2OJYA 1XHMA 3SCYA 3OKYA 4CI1A 5TEEA 4CI3A 2HESX 2IAAA 3PSLA 4I79A 4A0BA 5GSAA 4PC0A 4ERQA 4AOWA 2CE8A 3F3FA 5AFU3 2YNNA 2J55H 1R5MA 4QT8A 4OZUA 4E5ZB 2PM6B 3DXMC 5HE3B 5JWZA 1TBGA 2J57G 3IIWA 2H9PA 4CY3A 3IIYA 2AGLA 4X3EA 3RRMC 2XL3A 2HYEA 1RI6A 4OWRA 5THAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YNO A;  3AL8 B;  4PSW B;  3ZWL B;  5IC7 A;  2H6K A;  3UVL A;  1S4U X;  2PM7 B;  1TYQ C;  4E5Z A;  4GM8 A;  2J56 H;  3B7F A;  4J79 A;  4PBZ A;  3A0F A;  1FWX A;  5FXY A;  2H3X A;  1N6D A;  3VH0 A;  4K3J B;  4L3G D;  3AL8 A;  2UZX B;  4X63 B;  5IT9 g;  4J84 A;  4O1Q D;  1PEV A;  4FA5 D;  4CI2 A;  1MG3 A;  1OLZ A;  2G99 A;  5CXB A;  1NR0 A;  1B9Y A;  3MXX A;  3I8E A;  5FKQ A;  3V9F A;  4Y5R D;  3OKT A;  2OVR B;  4J73 A;  4FA4 D;  2W18 A;  1GP2 B;  5HE0 B;  3RLM D;  2I3T A;  3EI4 B;  2YMU A;  3I7H A;  4J0X A;  5EMJ B;  2B4E A;  2AH1 A;  3UVO A;  2CO0 C;  5CYK B;  1GOT B;  5B4W A;  3DWL C;  3BG0 A;  1JMZ B;  3MKS B;  3PSC B;  2QXV A;  2P9I C;  5H17 A;  3MZK A;  4J77 A;  4E54 A;  3BG1 A;  3OL2 A;  4A09 A;  5K1C C;  3BWS A;  3GRE A;  3UVK A;  3JAM g;  3AL9 A;  5HE1 B;  3NVQ A;  4U7A A;  2H6Q A;  4FHL A;  4CC9 A;  3U4Y A;  1JJU B;  5H1M A;  3SMR A;  2P9S C;  4LG9 A;  4BH6 A;  5EM2 B;  4XEI C;  4E54 B;  2BCJ B;  3W15 A;  4XYH A;  4A0A B;  2H13 A;  3V5W B;  4Y7R A;  1L0Q A;  4GQB B;  3NVX A;  2XL2 A;  4ERY A;  3JPX A;  3KRX B;  4ZOX A;  1QNI A;  4A11 B;  4ZOV A;  4JSP C;  3OKW A;  3KRW B;  4FAV D;  2CO0 A;  2YB8 B;  3CFV A;  3P4F A;  4J87 A;  3SJL D;  4H5I A;  3E0C A;  3MZL A;  3OKY B;  5FLX g;  3ULE C;  3PVW B;  3SHF A;  3EI2 A;  3SWS D;  1SQ9 A;  4O9D A;  4X61 B;  1JMX B;  1U4C A;  4FA9 D;  3JB9 L;  3SBP A;  2H68 A;  3UVN A;  3J81 g;  1JOF A;  1Q47 A;  4QL1 A;  2H14 A;  3I8C A;  5C2V B;  4J8B A;  3MMY A;  2H9N A;  2IWK A;  4KFM B;  5I5J A;  1OMW B;  1XIP A;  5H14 A;  4GM9 A;  5C9Z B;  3I7O A;  4A7J A;  4PXW A;  4BL0 A;  5GXH A;  3EI2 B;  3SVW D;  3OW8 A;  2HKR A;  4JT6 C;  3OTT A;  2I0S A;  5FKT A;  2P9P C;  3IJC A;  2B5M A;  4O45 A;  3JZN A;  2P9L C;  4J0W A;  4PSX B;  3JZG A;  4ERZ A;  1N6E A;  4A08 A;  2H9L A;  4JSV C;  4ES0 A;  4D0K A;  3DM0 A;  2GNQ A;  4GQ1 A;  3V7D B;  3JZH A;  4AEZ A;  4CZY A;  4H5J A;  2IUP A;  4TZ4 A;  5EAL A;  4Z8L A;  4A08 B;  2AGW A;  2HKM A;  2PM9 A;  3MKQ A;  2XU7 A;  3I7P A;  4XYI A;  4LGN A;  4CY2 A;  5HE2 B;  1MDA H;  4PBY A;  1K8K C;  3CFS B;  4A0B B;  5K19 A;  2O9K A;  5FA5 B;  3N0E A;  3SBR A;  4JSN C;  2UZY B;  1A0R B;  1PGU A;  2AGY A;  3ORV D;  2PM9 B;  4GQ2 P;  2I0T A;  2P9U C;  4A2M A;  5GXI A;  3EWE A;  3K26 A;  4EWR A;  3C99 A;  3CIK B;  4FAN D;  5KDO B;  3PXW D;  1SQJ A;  3L4O D;  3AH8 B;  4PNK B;  2HXC A;  2G9A A;  2CNX A;  4YVD A;  2HJ4 A;  4FWW A;  3J80 g;  4CY5 A;  2AQ5 A;  2H9M A;  4GZ8 A;  3DXK C;  4JSX C;  3I7K A;  3I7L A;  5EMK B;  4U1E I;  3UKU C;  4L3H D;  3FRX A;  4G56 B;  5AMS A;  3FGB A;  4ZOZ A;  1N6F A;  4O3T B;  2H6N A;  5FKS A;  1YFQ A;  4ZOY A;  3PVU B;  5FKR A;  2CN2 A;  4J81 A;  1VYH C;  4A11 A;  5IGQ A;  3N0D A;  3RFH A;  2IWF A;  4JT5 C;  3SXT D;  5TF2 A;  3IJ1 A;  2TRC B;  4O3U B;  3RMZ D;  1B9X A;  5CXB B;  3C9C A;  5HQG A;  5I5M A;  4L9O A;  4GGA A;  1PI6 A;  4N14 A;  3I7N A;  4IA9 A;  3F3P A;  5A2Q g;  5CYK A;  5EAP A;  3GFC A;  4K3I D;  3EI4 A;  3PXT D;  2Q7Q A;  2YNP A;  3I2N A;  4BUJ C;  5CXC A;  3C5M A;  1GG2 B;  2AH0 A;  3DSM A;  1XKS A;  3NVN A;  2P9K C;  2H47 A;  2OIZ A;  4CI8 A;  2IUV A;  2XYI A;  5CXC B;  1SHY B;  2MTA H;  3VA6 A;  3PE7 A;  1U2V C;  2AGX A;  5EAM A;  4R7A B;  3FM0 A;  3JRO A;  4FB1 D;  2GC7 A;  4A0A A;  1PBY B;  3EI3 B;  4GGD A;  1MG2 A;  5TDH B;  3IJ0 A;  3OL2 B;  4A09 B;  3EI1 B;  2HJB A;  2OK6 A;  2OVQ B;  3RFG A;  2IUQ A;  3K27 A;  3SFZ A;  3C75 H;  2P9N C;  3SN6 B;  2BBK H;  4NSX A;  5FQD A;  2OVP B;  4L1Q D;  3F3G A;  4J86 A;  2B5L A;  3EI1 A;  2GC4 A;  3EG6 A;  4CZV A;  2B5N A;  3I89 A;  4MK0 B;  5EM2 A;  3HFQ A;  2YBA A;  3VGZ A;  5EAR A;  3L4M D;  3IKO A;  2Z2O A;  2PBI B;  2AGZ A;  3RN1 D;  2I0R A;  3RSE C;  4X60 B;  1ERJ A;  4GGC A;  5I5I A;  3RN0 D;  4FA1 D;  3EMH A;  5IGO A;  2IUR A;  2CN3 A;  4J8G A;  4JXM A;  4LG8 A;  2CE9 A;  3EI3 A;  2Z2P A;  5EML B;  3ODT A;  4UI9 R;  2EBS A;  3UVM A;  4J82 A;  4IMM A;  5C2W B;  3EU7 A;  3UKR C;  4GMB A;  4D6V A;  3SBQ A;  5EMM B;  4ESG A;  5AJA A;  3PXS D;  4HDJ A;  1P22 A;  3AFC A;  5SXM A;  5IJ8 E;  3JRP A;  4QRJ A;  1GXR A;  1NEX B;  4J78 A;  4CZX A;  2QC5 A;  4CY1 A;  5IJ7 E;  3SLE D;  2I3S A;  4QQE A;  5TEF A;  5HYN B;  1K32 A;  4JD2 C;  5GMK n;  2OK4 A;  3UR4 A;  2Z2N A;  4ZN4 A;  4GM3 A;  4A2L A;  2OJY A;  1XHM A;  3SCY A;  3OKY A;  4CI1 A;  5TEE A;  4CI3 A;  2HES X;  2IAA A;  3PSL A;  4I79 A;  4A0B A;  5GSA A;  4PC0 A;  4ERQ A;  4AOW A;  2CE8 A;  3F3F A;  5AFU 3;  2YNN A;  2J55 H;  1R5M A;  4QT8 A;  4OZU A;  4E5Z B;  2PM6 B;  3DXM C;  5HE3 B;  5JWZ A;  1TBG A;  2J57 G;  3IIW A;  2H9P A;  4CY3 A;  3IIY A;  2AGL A;  4X3E A;  3RRM C;  2XL3 A;  2HYE A;  1RI6 A;  4OWR A;  5THA A; 
#chains in the Genus database with same CATH topology
 2YNO A;  1UOP A;  3AL8 B;  4PSW B;  3ZWL B;  5IC7 A;  1H2W A;  4Z7Q A;  3QI0 A;  2H6K A;  3UVL A;  1S4U X;  2PM7 B;  1TYQ C;  5E6U A;  4E5Z A;  4GM8 A;  2J56 H;  3B7F A;  4J79 A;  4UM8 A;  4PBZ A;  4UM9 A;  3A0F A;  1FWX A;  5FXY A;  3K72 A;  2H3X A;  1N6D A;  3VH0 A;  4K3J B;  4L3G D;  1H2Z A;  3AL8 A;  2UZX B;  3DDU A;  4X63 B;  1GOH A;  5IT9 g;  4J84 A;  4O1Q D;  4AX4 A;  1PEV A;  4FA5 D;  4CI2 A;  1MG3 A;  1OLZ A;  1TYE A;  1L5G A;  3ZDZ A;  2G99 A;  5CXB A;  1NR0 A;  1B9Y A;  1C9L A;  3MXX A;  3I8E A;  4G1E A;  3FCU A;  5FKQ A;  4Z7O A;  2WQ8 A;  3V9F A;  4Y5R D;  3OKT A;  2OVR B;  4J73 A;  2VDR A;  4FA4 D;  2W18 A;  2VDM A;  1GP2 B;  5HE0 B;  4JHN A;  3RLM D;  2I3T A;  3EI4 B;  2YMU A;  3I7H A;  5E6R A;  4J0X A;  5EMJ B;  2B4E A;  2AH1 A;  3UVO A;  4MMY A;  2CO0 C;  3MUN A;  2VDO A;  5CYK B;  1GOT B;  5B4W A;  3DWL C;  3BG0 A;  1JMZ B;  3MKS B;  3PSC B;  1GOG A;  2QXV A;  2P9I C;  5H17 A;  3MZK A;  4J77 A;  4E54 A;  4WK4 A;  1C9I A;  3BG1 A;  3OL2 A;  4A09 A;  4RE6 A;  5K1C C;  3BWS A;  3GRE A;  3UVK A;  3JAM g;  1UOO A;  2EID A;  3AL9 A;  5HE1 B;  3NVQ A;  3V4P A;  4U7A A;  2H6Q A;  4FHL A;  4CC9 A;  3U4Y A;  1JJU B;  5FFG A;  5H1M A;  3SMR A;  2P9S C;  4LG9 A;  4BH6 A;  5EM2 B;  4XEI C;  4E54 B;  2BCJ B;  3W15 A;  4XYH A;  4A0A B;  2QR5 A;  2H13 A;  3V5W B;  4Y7R A;  3OF7 A;  1L0Q A;  4GQB B;  3NVX A;  2XL2 A;  4ERY A;  3JPX A;  3KRX B;  4ZOX A;  1QNI A;  4A11 B;  4ZOV A;  4JSP C;  3OKW A;  3KRW B;  4FAV D;  3FCS A;  2CO0 A;  3NIG A;  2YB8 B;  3CFV A;  3GC3 B;  3P4F A;  3NIF A;  4NEN A;  4J87 A;  3SJL D;  4H5I A;  4Z7N A;  3E0C A;  2VDP A;  3MZL A;  3OKY B;  5FLX g;  3ULE C;  3PVW B;  3SHF A;  3EI2 A;  3SWS D;  1SQ9 A;  4O9D A;  3O4H A;  4X61 B;  1JMX B;  1U4C A;  4FA9 D;  4NBM A;  3JB9 L;  3SBP A;  2H68 A;  3UVN A;  3J81 g;  1JOF A;  1Q47 A;  4QL1 A;  2H14 A;  3I8C A;  5C2V B;  4J8B A;  3MMY A;  2H9N A;  2IWK A;  4KFM B;  5I5J A;  1UTC A;  1XIP A;  1OMW B;  5H14 A;  4AN0 A;  5C92 A;  4GM9 A;  2VDN A;  5C9Z B;  3I7O A;  3V4V A;  4A7J A;  4RE5 A;  4PXW A;  4BL0 A;  4BCB A;  5GXH A;  3EI2 B;  4NAA A;  3IUM A;  3SVW D;  3OW8 A;  2HKR A;  4JT6 C;  4AMZ A;  3OTT A;  2I0S A;  5FKT A;  2P9P C;  3IJC A;  2JKX A;  2B5M A;  4O45 A;  1UOQ A;  3JZN A;  2VC2 A;  3GD1 I;  2P9L C;  2VDK A;  4J0W A;  4PSX B;  3JZG A;  3T3M A;  1GOF A;  4ERZ A;  2VZ3 A;  1N6E A;  4A08 A;  2H9L A;  4NC4 A;  4JSV C;  3NID A;  3IUJ A;  4ES0 A;  4D0K A;  3MVD K;  3DM0 A;  2GNQ A;  4GQ1 A;  3V7D B;  3JZH A;  4DNW A;  4AEZ A;  4CZY A;  4H5J A;  2IUP A;  4TZ4 A;  5EAL A;  4Z8L A;  4A08 B;  2AGW A;  2HKM A;  2PM9 A;  3MKQ A;  5M61 A;  2XU7 A;  3I7P A;  2XDW A;  4XYI A;  4LGN A;  5E6S A;  4CY2 A;  5HE2 B;  1MDA H;  4PBY A;  1H2X A;  1K8K C;  3CFS B;  4A0B B;  5K19 A;  2O9K A;  3O4I A;  2HU5 A;  4IRZ A;  5FA5 B;  3N0E A;  3SBR A;  4JSN C;  2UZY B;  1A0R B;  1PGU A;  2AGY A;  3ORV D;  3VI4 A;  2PM9 B;  4GQ2 P;  2I0T A;  2P9U C;  4A2M A;  5GXI A;  1I2M B;  3EWE A;  3K26 A;  4EWR A;  3C99 A;  3CIK B;  4FAN D;  5KDO B;  3PXW D;  1SQJ A;  3L4O D;  3IVM A;  3AH8 B;  4PNK B;  2HXC A;  2G9A A;  2CNX A;  4YVD A;  2HJ4 A;  4FWW A;  5HDB A;  3J80 g;  1A12 A;  4CY5 A;  2AQ5 A;  2H9M A;  4GZ8 A;  3DXK C;  4JSX C;  3I7K A;  3I7L A;  5EMK B;  4U1E I;  3UKU C;  2VDQ A;  4L3H D;  3FRX A;  4G56 B;  5AMS A;  3FGB A;  4ZOZ A;  1N6F A;  4O3T B;  2H6N A;  5FKS A;  1YFQ A;  4ZOY A;  3PVU B;  4G1M A;  5FKR A;  1E5T A;  2CN2 A;  4J81 A;  1VYH C;  4BP8 A;  4A11 A;  5IGQ A;  3N0D A;  3RFH A;  4AN1 A;  2IWF A;  4JT5 C;  3SXT D;  5TF2 A;  3IJ1 A;  2TRC B;  4O3U B;  3RMZ D;  4WJK A;  1B9X A;  5CXB B;  3C9C A;  3K71 A;  5HQG A;  5I5M A;  1U8C A;  1VZ3 A;  4L9O A;  4GGA A;  3EQ7 A;  4DNV A;  1PI6 A;  4N14 A;  3I7N A;  4IA9 A;  3F3P A;  4MMZ A;  5A2Q g;  5CYK A;  4D9S A;  3EQ8 A;  5EAP A;  3GFC A;  4K3I D;  3EI4 A;  4MMX A;  3PXT D;  2Q7Q A;  2YNP A;  3I2N A;  4BUJ C;  5CXC A;  1E8M A;  3C5M A;  3O4J A;  1GG2 B;  5M5R A;  3ZE1 A;  2AH0 A;  2QZP A;  3DSM A;  1XKS A;  3IUQ A;  3VI3 A;  4AMY A;  3NVN A;  2P9K C;  5M5S A;  1VE6 A;  2H47 A;  2OIZ A;  1YR2 A;  4CI8 A;  2IUV A;  2XYI A;  5CXC B;  1SHY B;  2MTA H;  4BCC A;  3VA6 A;  3PE7 A;  1U2V C;  2AGX A;  5EAM A;  4R7A B;  3FM0 A;  3JRO A;  1JTD B;  4FB1 D;  4QAM A;  2GC7 A;  4A0A A;  1PBY B;  2HU7 A;  5M5V A;  3EI3 B;  4GGD A;  1MG2 A;  5TDH B;  1T2X A;  3IJ0 A;  3OL2 B;  4A09 B;  3EI1 B;  2HJB A;  2OK6 A;  3IUN A;  2OVQ B;  3RFG A;  2VDL A;  1O6F A;  2IUQ A;  3K27 A;  3IUL A;  3SFZ A;  3C75 H;  3ZDY A;  2P9N C;  3ZDX A;  3SN6 B;  2BBK H;  4NSX A;  5FQD A;  2OVP B;  4L1Q D;  3F3G A;  4J86 A;  2B5L A;  3EI1 A;  3T3P A;  5FFO A;  2GC4 A;  3EG6 A;  4CZV A;  1VE7 A;  1QFS A;  1O6G A;  4L1M A;  2B5N A;  3I89 A;  4MK0 B;  5EM2 A;  3HFQ A;  3ZE2 A;  2YBA A;  3VGZ A;  5EAR A;  3L4M D;  1QFM A;  3IKO A;  3K6S A;  4WK0 A;  2EIE A;  2Z2O A;  2PBI B;  2AGZ A;  1BPO A;  3EQ9 A;  2I0R A;  3RN1 D;  3RSE C;  4X60 B;  1ERJ A;  4GGC A;  5I5I A;  3RN0 D;  4FA1 D;  3EMH A;  5IGO A;  2IUR A;  4BCD A;  2CN3 A;  4J8G A;  4JXM A;  2XE4 A;  4LG8 A;  2CE9 A;  3EI3 A;  2Z2P A;  4O2W A;  5EML B;  3ODT A;  2EBS A;  2HU8 A;  4UI9 R;  3QHY B;  3UVM A;  4J82 A;  1H2Y A;  1JV2 A;  4IMM A;  3KCI A;  5C2W B;  3EU7 A;  3O4G A;  3UKR C;  4GMB A;  4O02 A;  3SBQ A;  4D6V A;  4ESG A;  5EMM B;  5AJA A;  3PXS D;  1E8N A;  4HDJ A;  1P22 A;  5M5T A;  3AFC A;  5SXM A;  5IJ8 E;  3JRP A;  4QRJ A;  1GXR A;  5C86 A;  1NEX B;  4J78 A;  4CZX A;  2QC5 A;  4CY1 A;  5IJ7 E;  4BP9 A;  3SLE D;  2I3S A;  4QQE A;  5TEF A;  5HYN B;  1VZ2 A;  1K32 A;  3MUO A;  3IJE A;  4JD2 C;  2BKL A;  5GMK n;  2OK4 A;  4JHP C;  3UR4 A;  2Z2N A;  4ZN4 A;  4GM3 A;  4A2L A;  2OJY A;  1XHM A;  3SCY A;  1K3I A;  3ZE0 A;  3OKY A;  4CI1 A;  5TEE A;  1M1X A;  4CI3 A;  2HES X;  2IAA A;  3PSL A;  4I79 A;  4A0B A;  2VZ1 A;  5GSA A;  4PC0 A;  4ERQ A;  4AOW A;  2CE8 A;  3F3F A;  4DNU A;  4G55 A;  5AFU 3;  2YNN A;  2J55 H;  1R5M A;  2EIB A;  4QT8 A;  4OZU A;  4E5Z B;  2PM6 B;  3DXM C;  5HE3 B;  2EIC A;  5JWZ A;  1TBG A;  2J57 G;  3IUR A;  3IIW A;  2H9P A;  4CY3 A;  3IIY A;  2AGL A;  4X3E A;  3RRM C;  5M5U A;  2XL3 A;  2HYE A;  1RI6 A;  2XZG A;  4OWR A;  5THA A;  4WK2 A; 
#chains in the Genus database with same CATH homology
 2YNO A;  3AL8 B;  4PSW B;  3ZWL B;  5IC7 A;  2H6K A;  3UVL A;  1S4U X;  2PM7 B;  1TYQ C;  4E5Z A;  4GM8 A;  2J56 H;  3B7F A;  4J79 A;  4PBZ A;  3A0F A;  1FWX A;  5FXY A;  2H3X A;  1N6D A;  3VH0 A;  4K3J B;  4L3G D;  3AL8 A;  2UZX B;  4X63 B;  5IT9 g;  4J84 A;  4O1Q D;  1PEV A;  4FA5 D;  4CI2 A;  1MG3 A;  1OLZ A;  2G99 A;  5CXB A;  1NR0 A;  1B9Y A;  3MXX A;  3I8E A;  5FKQ A;  3V9F A;  4Y5R D;  3OKT A;  2OVR B;  4J73 A;  4FA4 D;  2W18 A;  1GP2 B;  5HE0 B;  3RLM D;  2I3T A;  3EI4 B;  2YMU A;  3I7H A;  4J0X A;  5EMJ B;  2B4E A;  2AH1 A;  3UVO A;  2CO0 C;  5CYK B;  1GOT B;  5B4W A;  3DWL C;  3BG0 A;  1JMZ B;  3MKS B;  3PSC B;  2QXV A;  2P9I C;  5H17 A;  3MZK A;  4J77 A;  4E54 A;  3BG1 A;  3OL2 A;  4A09 A;  5K1C C;  3BWS A;  3GRE A;  3UVK A;  3JAM g;  3AL9 A;  5HE1 B;  3NVQ A;  4U7A A;  2H6Q A;  4FHL A;  4CC9 A;  3U4Y A;  1JJU B;  5H1M A;  3SMR A;  2P9S C;  4LG9 A;  4BH6 A;  5EM2 B;  4XEI C;  4E54 B;  2BCJ B;  3W15 A;  4XYH A;  4A0A B;  2H13 A;  3V5W B;  4Y7R A;  1L0Q A;  4GQB B;  3NVX A;  2XL2 A;  4ERY A;  3JPX A;  3KRX B;  4ZOX A;  1QNI A;  4A11 B;  4ZOV A;  4JSP C;  3OKW A;  3KRW B;  4FAV D;  2CO0 A;  2YB8 B;  3CFV A;  3P4F A;  4J87 A;  3SJL D;  4H5I A;  3E0C A;  3MZL A;  3OKY B;  5FLX g;  3ULE C;  3PVW B;  3SHF A;  3EI2 A;  3SWS D;  1SQ9 A;  4O9D A;  4X61 B;  1JMX B;  1U4C A;  4FA9 D;  3JB9 L;  3SBP A;  2H68 A;  3UVN A;  3J81 g;  1JOF A;  1Q47 A;  4QL1 A;  2H14 A;  3I8C A;  5C2V B;  4J8B A;  3MMY A;  2H9N A;  2IWK A;  4KFM B;  5I5J A;  1OMW B;  1XIP A;  5H14 A;  4GM9 A;  5C9Z B;  3I7O A;  4A7J A;  4PXW A;  4BL0 A;  5GXH A;  3EI2 B;  3SVW D;  3OW8 A;  2HKR A;  4JT6 C;  3OTT A;  2I0S A;  5FKT A;  2P9P C;  3IJC A;  2B5M A;  4O45 A;  3JZN A;  2P9L C;  4J0W A;  4PSX B;  3JZG A;  4ERZ A;  1N6E A;  4A08 A;  2H9L A;  4JSV C;  4ES0 A;  4D0K A;  3DM0 A;  2GNQ A;  4GQ1 A;  3V7D B;  3JZH A;  4AEZ A;  4CZY A;  4H5J A;  2IUP A;  4TZ4 A;  5EAL A;  4Z8L A;  4A08 B;  2AGW A;  2HKM A;  2PM9 A;  3MKQ A;  2XU7 A;  3I7P A;  4XYI A;  4LGN A;  4CY2 A;  5HE2 B;  1MDA H;  4PBY A;  1K8K C;  3CFS B;  4A0B B;  5K19 A;  2O9K A;  5FA5 B;  3N0E A;  3SBR A;  4JSN C;  2UZY B;  1A0R B;  1PGU A;  2AGY A;  3ORV D;  2PM9 B;  4GQ2 P;  2I0T A;  2P9U C;  4A2M A;  5GXI A;  3EWE A;  3K26 A;  4EWR A;  3C99 A;  3CIK B;  4FAN D;  5KDO B;  3PXW D;  1SQJ A;  3L4O D;  3AH8 B;  4PNK B;  2HXC A;  2G9A A;  2CNX A;  4YVD A;  2HJ4 A;  4FWW A;  3J80 g;  4CY5 A;  2AQ5 A;  2H9M A;  4GZ8 A;  3DXK C;  4JSX C;  3I7K A;  3I7L A;  5EMK B;  4U1E I;  3UKU C;  4L3H D;  3FRX A;  4G56 B;  5AMS A;  3FGB A;  4ZOZ A;  1N6F A;  4O3T B;  2H6N A;  5FKS A;  1YFQ A;  4ZOY A;  3PVU B;  5FKR A;  2CN2 A;  4J81 A;  1VYH C;  4A11 A;  5IGQ A;  3N0D A;  3RFH A;  2IWF A;  4JT5 C;  3SXT D;  5TF2 A;  3IJ1 A;  2TRC B;  4O3U B;  3RMZ D;  1B9X A;  5CXB B;  3C9C A;  5HQG A;  5I5M A;  4L9O A;  4GGA A;  1PI6 A;  4N14 A;  3I7N A;  4IA9 A;  3F3P A;  5A2Q g;  5CYK A;  5EAP A;  3GFC A;  4K3I D;  3EI4 A;  3PXT D;  2Q7Q A;  2YNP A;  3I2N A;  4BUJ C;  5CXC A;  3C5M A;  1GG2 B;  2AH0 A;  3DSM A;  1XKS A;  3NVN A;  2P9K C;  2H47 A;  2OIZ A;  4CI8 A;  2IUV A;  2XYI A;  5CXC B;  1SHY B;  2MTA H;  3VA6 A;  3PE7 A;  1U2V C;  2AGX A;  5EAM A;  4R7A B;  3FM0 A;  3JRO A;  4FB1 D;  2GC7 A;  4A0A A;  1PBY B;  3EI3 B;  4GGD A;  1MG2 A;  5TDH B;  3IJ0 A;  3OL2 B;  4A09 B;  3EI1 B;  2HJB A;  2OK6 A;  2OVQ B;  3RFG A;  2IUQ A;  3K27 A;  3SFZ A;  3C75 H;  2P9N C;  3SN6 B;  2BBK H;  4NSX A;  5FQD A;  2OVP B;  4L1Q D;  3F3G A;  4J86 A;  2B5L A;  3EI1 A;  2GC4 A;  3EG6 A;  4CZV A;  2B5N A;  3I89 A;  4MK0 B;  5EM2 A;  3HFQ A;  2YBA A;  3VGZ A;  5EAR A;  3L4M D;  3IKO A;  2Z2O A;  2PBI B;  2AGZ A;  3RN1 D;  2I0R A;  3RSE C;  4X60 B;  1ERJ A;  4GGC A;  5I5I A;  3RN0 D;  4FA1 D;  3EMH A;  5IGO A;  2IUR A;  2CN3 A;  4J8G A;  4JXM A;  4LG8 A;  2CE9 A;  3EI3 A;  2Z2P A;  5EML B;  3ODT A;  4UI9 R;  2EBS A;  3UVM A;  4J82 A;  4IMM A;  5C2W B;  3EU7 A;  3UKR C;  4GMB A;  4D6V A;  3SBQ A;  5EMM B;  4ESG A;  5AJA A;  3PXS D;  4HDJ A;  1P22 A;  3AFC A;  5SXM A;  5IJ8 E;  3JRP A;  4QRJ A;  1GXR A;  1NEX B;  4J78 A;  4CZX A;  2QC5 A;  4CY1 A;  5IJ7 E;  3SLE D;  2I3S A;  4QQE A;  5TEF A;  5HYN B;  1K32 A;  4JD2 C;  5GMK n;  2OK4 A;  3UR4 A;  2Z2N A;  4ZN4 A;  4GM3 A;  4A2L A;  2OJY A;  1XHM A;  3SCY A;  3OKY A;  4CI1 A;  5TEE A;  4CI3 A;  2HES X;  2IAA A;  3PSL A;  4I79 A;  4A0B A;  5GSA A;  4PC0 A;  4ERQ A;  4AOW A;  2CE8 A;  3F3F A;  5AFU 3;  2YNN A;  2J55 H;  1R5M A;  4QT8 A;  4OZU A;  4E5Z B;  2PM6 B;  3DXM C;  5HE3 B;  5JWZ A;  1TBG A;  2J57 G;  3IIW A;  2H9P A;  4CY3 A;  3IIY A;  2AGL A;  4X3E A;  3RRM C;  2XL3 A;  2HYE A;  1RI6 A;  4OWR A;  5THA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...