5M5TA

Clathrin heavy chain n-terminal domain bound to a non-natural clathrin-box motif peptide (amph4t1)
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
360
structure length
360
Chain Sequence
ILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMNDPSNPIRRPISADSAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMTDDVTFWKWISLNTVALVTDNAVYHWSMEGESQPVKMFDRHSSLAGCQIINYRTDAKQKWLLLTGISAQQNRVVGAMQLYSVDRKVSQPIEGHAASFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTGNQPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISGETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITNVLQNPDLALRMAVRNNLAGAEEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Clathrin heavy chain 1
publication title Cellular and viral peptides bind multiple sites on the N-terminal domain of clathrin.
pubmed doi rcsb
source organism Bos taurus
molecule tags Endocytosis
total genus 84
structure length 360
sequence length 360
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01394 Clathrin_propel Clathrin propeller repeat
A PF09268 Clathrin-link Clathrin, heavy-chain linker
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.110 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Clathrin heavy-chain terminal domain 5m5tA00
3GD1I 1C9IA 4G55A 1C9LA 1BPOA 1UTCA 2XZGA 5M5SA 5M5UA 5M5TA 5M5RA 5M61A 3GC3B 5M5VA
chains in the Genus database with same CATH superfamily
5EMJB 2VDPA 4QAMA 4G1MA 3K6SA 1H2ZA 3C75H 4GQ2P 3ZE0A 3JROA 1JOFA 4U7AA 4ZN4A 4X60B 4CY5A 2Z2NA 4ERZA 2WQ8A 5FKRA 1TYEA 1H2XA 2G9AA 1NEXB 3AH8B 4CI2A 5K19A 4GMBA 3IUJA 3MUOA 2EIEA 4FAVD 3MVDK 3VH0A 3V4PA 2J56H 1JTDB 3ZE1A 2GC7A 1QFSA 4A2MA 4GM9A 1O6FA 5HE2B 4J82A 1E5TA 3T3MA 4X61B 2H9LA 4BCCA 3EU7A 2H14A 1U8CA 4L1QD 4FA4D 4XEIC 3DXKC 4GQ1A 3ZDZA 3BWSA 3RN1D 5M5UA 4AEZA 3IJEA 3GC3B 4NBMA 4JHNA 1H2YA 1SQJA 4A0BB 2PBIB 3CIKB 3QI0A 5C92A 4A0BA 5K1CC 3L4MD 5EMMB 3KRXB 3DDUA 1NR0A 1PI6A 4K3ID 5AJAA 1UOOA 4JSPC 3K26A 2XL3A 3JZNA 4BP9A 3MMYA 3PE7A 4WK4A 2IWKA 4BUJC 5IGQA 3IJCA 3SWSD 4PC0A 3PVUB 5M5TA 1PBYB 2IAAA 3PXTD 2IWFA 5H1MA 5IJ7E 3CFVA 1PEVA 1R5MA 4L1MA 1RI6A 3KRWB 2YNOA 1B9XA 3ZWLB 1S4UX 5FFGA 3V4VA 4BP8A 4FA1D 4FAND 1TBGA 5IC7A 2YBAA 3SJLD 2H9PA 5FKQA 3NVQA 4WJKA 3E0CA 4JXMA 4TZ4A 3W15A 1GXRA 3EI1B 2VZ1A 3PXWD 5I5JA 5IJ8E 2GC4A 5FFOA 3EI1A 2CE9A 4ES0A 2QZPA 4QRJA 1GP2B 4O02A 5E6RA 4CZVA 2CNXA 2B5MA 4PBYA 4L3GD 3K27A 4MMZA 3DXMC 2B5NA 2VDKA 3NIFA 3NVNA 2EIBA 4XYHA 2H9NA 1SHYB 1MDAH 2VDNA 3OKWA 4A09B 4E54B 1T2XA 4HDJA 3OKYB 4A09A 4AOWA 3T3PA 4E54A 3MZKA 2IUQA 3OKYA 4JSVC 4X3EA 2VZ3A 4G55A 2TRCB 2HU5A 5TEEA 2IUVA 3CFSB 3ZDXA 5C9ZB 3OKTA 3SXTD 4LGNA 3V7DB 3AL9A 4WK0A 3VA6A 4X63B 1YFQA 5C2VB 5M5SA 5EARA 4O3TB 3SVWD 5FXYA 4JT6C 3C99A 1VE7A 4ZOXA 4A08B 3FCSA 3I7LA 3MKQA 4ZOZA 5HDBA 5KDOB 1FWXA 4AX4A 2HJ4A 4A08A 1JMXB 3NIGA 4JD2C 5CXCB 2H6QA 2P9PC 5EM2B 5CXCA 3UVMA 2PM9B 5EM2A 4A11B 2CN2A 5AFU3 4IA9A 2PM9A 5THAA 3B7FA 4A11A 2OK6A 4J84A 5FKSA 2MTAH 4CI1A 1VZ3A 3MZLA 3ZE2A 4D0KA 3K71A 2I3SA 3V5WB 3IIYA 3JZHA 5TDHB 4I79A 2I0RA 1U4CA 4PSWB 3IJ0A 3QHYB 2EBSA 1VE6A 4MK0B 3SHFA 4ESGA 3F3PA 1E8MA 3RFGA 2YB8B 4L9OA 3I7NA 4ERYA 1K3IA 4PXWA 4U1EI 4RE6A 2QC5A 5HE0B 4CY1A 1PGUA 2Z2PA 4Y7RA 1XHMA 3VI3A 1XIPA 3F3GA 2P9UC 2HXCA 1MG2A 2P9LC 3PSCB 5EALA 3BG0A 2IUPA 4AN1A 3VI4A 2G99A 3PVWB 3EWEA 4NSXA 4LG9A 2IURA 2VDLA 4DNUA 5GSAA 1I2MB 5TEFA 3IULA 3EI2B 4FA9D 3HFQA 2B4EA 4PSXB 5AMSA 3EMHA 4CZYA 3FGBA 3JB9L 3EI2A 4Z8LA 4BCBA 3I89A 1M1XA 1GOFA 4CY2A 2J55H 4DNWA 5H14A 4J0XA 3ODTA 4K3JB 4QQEA 2OVRB 2OVPB 4J8BA 2JKXA 4PNKB 3O4GA 4H5IA 3OTTA 2BCJB 4N14A 2HU7A 2HU8A 3JZGA 4IMMA 4O1QD 4QT8A 2AQ5A 2P9IC 3P4FA 2Q7QA 4JSXC 3SBRA 3JRPA 2I3TA 3UVLA 5M5VA 4FA5D 4GGAA 1L5GA 4H5JA 4XYIA 1A12A 4A0AB 2XE4A 3NVXA 3L4OD 1JMZB 3ORVD 4L3HD 3RRMC 4A0AA 4YVDA 1BPOA 4RE5A 4KFMB 1JJUB 4AMZA 4IRZA 3A0FA 1VZ2A 5IGOA 3ZDYA 1YR2A 5E6SA 2EICA 3MUNA 2W18A 3SBPA 4QL1A 3J81g 2BKLA 2XL2A 3AL8B 3I7KA 1QFMA 5CXBB 3N0EA 3VGZA 3AL8A 4UM9A 1SQ9A 5CYKB 2H68A 5EMLB 5CXBA 2I0TA 3SCYA 4ERQA 3IJ1A 5IT9g 3DSMA 5TF2A 5I5MA 1A0RB 2HKMA 5H17A 2XYIA 3N0DA 1Q47A 5CYKA 2H9MA 4UI9R 1JV2A 4BCDA 4MMXA 4AN0A 3UVNA 4FWWA 4J77A 1ERJA 2H6KA 3KCIA 5JWZA 1UOQA 2AGYA 3ULEC 5GXHA 5HQGA 2CO0A 4A2LA 3DWLC 5FLXg 4J73A 3FCUA 3OL2B 4J0WA 4JT5C 5FA5B 4CI8A 3OL2A 5FKTA 3I7OA 3UKUC 3JAMg 5HE3B 1H2WA 2H13A 3IUMA 2HJBA 2VDOA 4JSNC 4ZOVA 2YMUA 4O45A 5M61A 1VYHC 3GD1I 3I8CA 4O9DA 2P9KC 2PM6B 2H6NA 2OK4A 1GOTB 3OW8A 5EAPA 2CO0C 4PBZA 2Z2OA 2BBKH 5E6UA 2VC2A 3RFHA 3C5MA 3I7PA 4CY3A 1U2VC 1N6FA 2B5LA 4E5ZB 3O4IA 3V9FA 2O9KA 1UOPA 4Y5RD 1QNIA 5C86A 4E5ZA 3UVOA 4DNVA 4GM3A 4GQBB 3SFZA 3BG1A 3FRXA 3I8EA 4FB1D 4GGDA 3IUQA 4AMYA 4GZ8A 4J86A 2AH0A 5HYNB 2HKRA 5A2Qg 1B9YA 4G56B 3DM0A 5HE1B 3IUNA 4LG8A 2VDRA 2AGZA 3PXSD 5M5RA 1GOGA 1MG3A 1P22A 1C9LA 3EI3B 4MMYA 3RMZD 1UTCA 2XDWA 4J81A 2QXVA 3EI3A 5B4WA 3FM0A 2UZXB 2GNQA 3IVMA 2OJYA 4Z7OA 4FHLA 4R7AB 3O4HA 2P9NC 4OWRA 1GG2B 4NC4A 5EMKB 2CN3A 4J8GA 3EQ7A 1L0QA 4UM8A 4D9SA 3SBQA 4A7JA 1N6EA 3C9CA 2P9SC 5SXMA 3AFCA 2AH1A 4J87A 3UVKA 3K72A 2YNPA 3IIWA 3F3FA 5I5IA 3NIDA 2H47A 3IURA 3MXXA 2AGWA 2AGXA 4NAAA 4O2WA 3JPXA 4G1EA 3SLED 1XKSA 3EI4B 4CZXA 2QR5A 3EI4A 2I0SA 3GFCA 2YNNA 3RSEC 5C2WB 2CE8A 5EAMA 3O4JA 2J57G 4CI3A 2UZYB 3PSLA 2AGLA 4Z7NA 1OMWB 3IKOA 4O3UB 3RLMD 5GXIA 4BH6A 4J79A 3U4YA 1GOHA 2OVQB 2PM7B 4Z7QA 4ZOYA 3UKRC 4BL0A 4OZUA 3EQ8A 1OLZA 3I2NA 2VDQA 3UR4A 1O6GA 2HESX 3SMRA 2H3XA 4WK2A 2VDMA 1N6DA 4CC9A 1TYQC 2OIZA 1K32A 3OF7A 4NENA 2XU7A 2XZGA 2EIDA 3RN0D 3J80g 5GMKn 2HYEA 3GREA 4GGCA 4GM8A 4JHPC 3EG6A 3EQ9A 3SN6B 3MKSB 3I7HA 1C9IA 4D6VA 4EWRA 4J78A 1E8NA 5FQDA 1K8KC
chains in the Genus database with same CATH topology
3GD1I 1C9IA 4G55A 1C9LA 1BPOA 1UTCA 2XZGA 5M5SA 5M5UA 5M5TA 5M5RA 5M61A 3GC3B 5M5VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GD1 I;  1C9I A;  4G55 A;  1C9L A;  1BPO A;  1UTC A;  2XZG A;  5M5S A;  5M5U A;  5M5T A;  5M5R A;  5M61 A;  3GC3 B;  5M5V A; 
#chains in the Genus database with same CATH topology
 5EMJ B;  2VDP A;  4QAM A;  4G1M A;  3K6S A;  1H2Z A;  3C75 H;  4GQ2 P;  3ZE0 A;  3JRO A;  1JOF A;  4U7A A;  4ZN4 A;  4X60 B;  4CY5 A;  2Z2N A;  4ERZ A;  2WQ8 A;  5FKR A;  1TYE A;  1H2X A;  2G9A A;  1NEX B;  3AH8 B;  4CI2 A;  5K19 A;  4GMB A;  3IUJ A;  3MUO A;  2EIE A;  4FAV D;  3MVD K;  3VH0 A;  3V4P A;  2J56 H;  1JTD B;  3ZE1 A;  2GC7 A;  1QFS A;  4A2M A;  4GM9 A;  1O6F A;  5HE2 B;  4J82 A;  1E5T A;  3T3M A;  4X61 B;  2H9L A;  4BCC A;  3EU7 A;  2H14 A;  1U8C A;  4L1Q D;  4FA4 D;  4XEI C;  3DXK C;  4GQ1 A;  3ZDZ A;  3BWS A;  3RN1 D;  5M5U A;  4AEZ A;  3IJE A;  3GC3 B;  4NBM A;  4JHN A;  1H2Y A;  1SQJ A;  4A0B B;  2PBI B;  3CIK B;  3QI0 A;  5C92 A;  4A0B A;  5K1C C;  3L4M D;  5EMM B;  3KRX B;  3DDU A;  1NR0 A;  1PI6 A;  4K3I D;  5AJA A;  1UOO A;  4JSP C;  3K26 A;  2XL3 A;  3JZN A;  4BP9 A;  3MMY A;  3PE7 A;  4WK4 A;  2IWK A;  4BUJ C;  5IGQ A;  3IJC A;  3SWS D;  4PC0 A;  3PVU B;  5M5T A;  1PBY B;  2IAA A;  3PXT D;  2IWF A;  5H1M A;  5IJ7 E;  3CFV A;  1PEV A;  1R5M A;  4L1M A;  1RI6 A;  3KRW B;  2YNO A;  1B9X A;  3ZWL B;  1S4U X;  5FFG A;  3V4V A;  4BP8 A;  4FA1 D;  4FAN D;  1TBG A;  5IC7 A;  2YBA A;  3SJL D;  2H9P A;  5FKQ A;  3NVQ A;  4WJK A;  3E0C A;  4JXM A;  4TZ4 A;  3W15 A;  1GXR A;  3EI1 B;  2VZ1 A;  3PXW D;  5I5J A;  5IJ8 E;  2GC4 A;  5FFO A;  3EI1 A;  2CE9 A;  4ES0 A;  2QZP A;  4QRJ A;  1GP2 B;  4O02 A;  5E6R A;  4CZV A;  2CNX A;  2B5M A;  4PBY A;  4L3G D;  3K27 A;  4MMZ A;  3DXM C;  2B5N A;  2VDK A;  3NIF A;  3NVN A;  2EIB A;  4XYH A;  2H9N A;  1SHY B;  1MDA H;  2VDN A;  3OKW A;  4A09 B;  4E54 B;  1T2X A;  4HDJ A;  3OKY B;  4A09 A;  4AOW A;  3T3P A;  4E54 A;  3MZK A;  2IUQ A;  3OKY A;  4JSV C;  4X3E A;  2VZ3 A;  4G55 A;  2TRC B;  2HU5 A;  5TEE A;  2IUV A;  3CFS B;  3ZDX A;  5C9Z B;  3OKT A;  3SXT D;  4LGN A;  3V7D B;  3AL9 A;  4WK0 A;  3VA6 A;  4X63 B;  1YFQ A;  5C2V B;  5M5S A;  5EAR A;  4O3T B;  3SVW D;  5FXY A;  4JT6 C;  3C99 A;  1VE7 A;  4ZOX A;  4A08 B;  3FCS A;  3I7L A;  3MKQ A;  4ZOZ A;  5HDB A;  5KDO B;  1FWX A;  4AX4 A;  2HJ4 A;  4A08 A;  1JMX B;  3NIG A;  4JD2 C;  5CXC B;  2H6Q A;  2P9P C;  5EM2 B;  5CXC A;  3UVM A;  2PM9 B;  5EM2 A;  4A11 B;  2CN2 A;  5AFU 3;  4IA9 A;  2PM9 A;  5THA A;  3B7F A;  4A11 A;  2OK6 A;  4J84 A;  5FKS A;  2MTA H;  4CI1 A;  1VZ3 A;  3MZL A;  3ZE2 A;  4D0K A;  3K71 A;  2I3S A;  3V5W B;  3IIY A;  3JZH A;  5TDH B;  4I79 A;  2I0R A;  1U4C A;  4PSW B;  3IJ0 A;  3QHY B;  2EBS A;  1VE6 A;  4MK0 B;  3SHF A;  4ESG A;  3F3P A;  1E8M A;  3RFG A;  2YB8 B;  4L9O A;  3I7N A;  4ERY A;  1K3I A;  4PXW A;  4U1E I;  4RE6 A;  2QC5 A;  5HE0 B;  4CY1 A;  1PGU A;  2Z2P A;  4Y7R A;  1XHM A;  3VI3 A;  1XIP A;  3F3G A;  2P9U C;  2HXC A;  1MG2 A;  2P9L C;  3PSC B;  5EAL A;  3BG0 A;  2IUP A;  4AN1 A;  3VI4 A;  2G99 A;  3PVW B;  3EWE A;  4NSX A;  4LG9 A;  2IUR A;  2VDL A;  4DNU A;  5GSA A;  1I2M B;  5TEF A;  3IUL A;  3EI2 B;  4FA9 D;  3HFQ A;  2B4E A;  4PSX B;  5AMS A;  3EMH A;  4CZY A;  3FGB A;  3JB9 L;  3EI2 A;  4Z8L A;  4BCB A;  3I89 A;  1M1X A;  1GOF A;  4CY2 A;  2J55 H;  4DNW A;  5H14 A;  4J0X A;  3ODT A;  4K3J B;  4QQE A;  2OVR B;  2OVP B;  4J8B A;  2JKX A;  4PNK B;  3O4G A;  4H5I A;  3OTT A;  2BCJ B;  4N14 A;  2HU7 A;  2HU8 A;  3JZG A;  4IMM A;  4O1Q D;  4QT8 A;  2AQ5 A;  2P9I C;  3P4F A;  2Q7Q A;  4JSX C;  3SBR A;  3JRP A;  2I3T A;  3UVL A;  5M5V A;  4FA5 D;  4GGA A;  1L5G A;  4H5J A;  4XYI A;  1A12 A;  4A0A B;  2XE4 A;  3NVX A;  3L4O D;  1JMZ B;  3ORV D;  4L3H D;  3RRM C;  4A0A A;  4YVD A;  1BPO A;  4RE5 A;  4KFM B;  1JJU B;  4AMZ A;  4IRZ A;  3A0F A;  1VZ2 A;  5IGO A;  3ZDY A;  1YR2 A;  5E6S A;  2EIC A;  3MUN A;  2W18 A;  3SBP A;  4QL1 A;  3J81 g;  2BKL A;  2XL2 A;  3AL8 B;  3I7K A;  1QFM A;  5CXB B;  3N0E A;  3VGZ A;  3AL8 A;  4UM9 A;  1SQ9 A;  5CYK B;  2H68 A;  5EML B;  5CXB A;  2I0T A;  3SCY A;  4ERQ A;  3IJ1 A;  5IT9 g;  3DSM A;  5TF2 A;  5I5M A;  1A0R B;  2HKM A;  5H17 A;  2XYI A;  3N0D A;  1Q47 A;  5CYK A;  2H9M A;  4UI9 R;  1JV2 A;  4BCD A;  4MMX A;  4AN0 A;  3UVN A;  4FWW A;  4J77 A;  1ERJ A;  2H6K A;  3KCI A;  5JWZ A;  1UOQ A;  2AGY A;  3ULE C;  5GXH A;  5HQG A;  2CO0 A;  4A2L A;  3DWL C;  5FLX g;  4J73 A;  3FCU A;  3OL2 B;  4J0W A;  4JT5 C;  5FA5 B;  4CI8 A;  3OL2 A;  5FKT A;  3I7O A;  3UKU C;  3JAM g;  5HE3 B;  1H2W A;  2H13 A;  3IUM A;  2HJB A;  2VDO A;  4JSN C;  4ZOV A;  2YMU A;  4O45 A;  5M61 A;  1VYH C;  3GD1 I;  3I8C A;  4O9D A;  2P9K C;  2PM6 B;  2H6N A;  2OK4 A;  1GOT B;  3OW8 A;  5EAP A;  2CO0 C;  4PBZ A;  2Z2O A;  2BBK H;  5E6U A;  2VC2 A;  3RFH A;  3C5M A;  3I7P A;  4CY3 A;  1U2V C;  1N6F A;  2B5L A;  4E5Z B;  3O4I A;  3V9F A;  2O9K A;  1UOP A;  4Y5R D;  1QNI A;  5C86 A;  4E5Z A;  3UVO A;  4DNV A;  4GM3 A;  4GQB B;  3SFZ A;  3BG1 A;  3FRX A;  3I8E A;  4FB1 D;  4GGD A;  3IUQ A;  4AMY A;  4GZ8 A;  4J86 A;  2AH0 A;  5HYN B;  2HKR A;  5A2Q g;  1B9Y A;  4G56 B;  3DM0 A;  5HE1 B;  3IUN A;  4LG8 A;  2VDR A;  2AGZ A;  3PXS D;  5M5R A;  1GOG A;  1MG3 A;  1P22 A;  1C9L A;  3EI3 B;  4MMY A;  3RMZ D;  1UTC A;  2XDW A;  4J81 A;  2QXV A;  3EI3 A;  5B4W A;  3FM0 A;  2UZX B;  2GNQ A;  3IVM A;  2OJY A;  4Z7O A;  4FHL A;  4R7A B;  3O4H A;  2P9N C;  4OWR A;  1GG2 B;  4NC4 A;  5EMK B;  2CN3 A;  4J8G A;  3EQ7 A;  1L0Q A;  4UM8 A;  4D9S A;  3SBQ A;  4A7J A;  1N6E A;  3C9C A;  2P9S C;  5SXM A;  3AFC A;  2AH1 A;  4J87 A;  3UVK A;  3K72 A;  2YNP A;  3IIW A;  3F3F A;  5I5I A;  3NID A;  2H47 A;  3IUR A;  3MXX A;  2AGW A;  2AGX A;  4NAA A;  4O2W A;  3JPX A;  4G1E A;  3SLE D;  1XKS A;  3EI4 B;  4CZX A;  2QR5 A;  3EI4 A;  2I0S A;  3GFC A;  2YNN A;  3RSE C;  5C2W B;  2CE8 A;  5EAM A;  3O4J A;  2J57 G;  4CI3 A;  2UZY B;  3PSL A;  2AGL A;  4Z7N A;  1OMW B;  3IKO A;  4O3U B;  3RLM D;  5GXI A;  4BH6 A;  4J79 A;  3U4Y A;  1GOH A;  2OVQ B;  2PM7 B;  4Z7Q A;  4ZOY A;  3UKR C;  4BL0 A;  4OZU A;  3EQ8 A;  1OLZ A;  3I2N A;  2VDQ A;  3UR4 A;  1O6G A;  2HES X;  3SMR A;  2H3X A;  4WK2 A;  2VDM A;  1N6D A;  4CC9 A;  1TYQ C;  2OIZ A;  1K32 A;  3OF7 A;  4NEN A;  2XU7 A;  2XZG A;  2EID A;  3RN0 D;  3J80 g;  5GMK n;  2HYE A;  3GRE A;  4GGC A;  4GM8 A;  4JHP C;  3EG6 A;  3EQ9 A;  3SN6 B;  3MKS B;  3I7H A;  1C9I A;  4D6V A;  4EWR A;  4J78 A;  1E8N A;  5FQD A;  1K8K C; 
#chains in the Genus database with same CATH homology
 3GD1 I;  1C9I A;  4G55 A;  1C9L A;  1BPO A;  1UTC A;  2XZG A;  5M5S A;  5M5U A;  5M5T A;  5M5R A;  5M61 A;  3GC3 B;  5M5V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...