5M5TA

Clathrin heavy chain n-terminal domain bound to a non-natural clathrin-box motif peptide (amph4t1)
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
360
structure length
360
Chain Sequence
ILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMNDPSNPIRRPISADSAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMTDDVTFWKWISLNTVALVTDNAVYHWSMEGESQPVKMFDRHSSLAGCQIINYRTDAKQKWLLLTGISAQQNRVVGAMQLYSVDRKVSQPIEGHAASFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTGNQPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISGETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITNVLQNPDLALRMAVRNNLAGAEEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endocytosis
molecule keywords Clathrin heavy chain 1
publication title Cellular and viral peptides bind multiple sites on the N-terminal domain of clathrin.
pubmed doi rcsb
source organism Bos taurus
total genus 84
structure length 360
sequence length 360
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01394 Clathrin_propel Clathrin propeller repeat
A PF09268 Clathrin-link Clathrin, heavy-chain linker
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.110 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Clathrin heavy-chain terminal domain 5m5tA00
2XZGA 5M5RA 5M5VA 4G55A 5M5TA 1BPOA 5M61A 5M5UA 5M5SA 1C9IA 3GD1I 1UTCA 1C9LA 3GC3B
chains in the Genus database with same CATH superfamily
2QR5A 3T3MA 3SLED 3I7NA 5CXCA 1QFSA 1VYHC 1YFQA 3KRXB 4CC9A 2B5MA 5CYKB 3J81g 4GM8A 1GXRA 5M5VA 1TBGA 4GGAA 2CO0C 4CZXA 1VE7A 2TRCB 2XYIA 4LG8A 1PI6A 4HDJA 4TZ4A 3MVDK 4CI3A 2PM6B 2P9UC 2Q7QA 3EI2B 5FKTA 3VI3A 2HXCA 3JZNA 5EAMA 4A7JA 3EQ8A 2QZPA 4XYIA 4X63B 4K3ID 5HYNB 3MMYA 5EMKB 1MG3A 3P4FA 4G56B 4U1EI 3T3PA 1PGUA 5M5RA 3SXTD 3BWSA 2I0RA 4RE6A 1JOFA 1TYEA 4UI9R 3O4JA 1H2WA 4CZVA 3GREA 4BCDA 4J0XA 1B9XA 2CNXA 1JMXB 4L3GD 1H2YA 5HQGA 1JMZB 4Z7OA 2HKRA 4E5ZB 3DSMA 2I3SA 3F3PA 5I5JA 3IUJA 2VZ1A 2H9LA 4FAVD 1C9IA 3OKYB 2AGLA 4X60B 2P9NC 1QNIA 2YNOA 5IGOA 4O3UB 5B4WA 4Z7QA 3O4HA 4O9DA 2H3XA 4ZN4A 4MMZA 1L5GA 2YMUA 4PBYA 5E6SA 4E54A 3V4PA 2XL3A 3GC3B 4PXWA 2OVPB 3OL2A 3NVXA 3PVUB 4EWRA 2VDMA 1SQJA 2HJBA 5M5SA 3IJEA 4GGCA 3JZGA 2H68A 2IUQA 5TEFA 2PM7B 4MMXA 2H47A 3FRXA 5GXHA 4ZOXA 4GM3A 3SBQA 3IIWA 2B4EA 5HE2B 2YNNA 3VH0A 5EMLB 3EG6A 5C2WB 3I7HA 3ZDZA 1L0QA 5FKSA 4O1QD 3ZWLB 3IVMA 1P22A 5FKQA 3CFVA 2MTAH 2VZ3A 4D6VA 3L4OD 1XHMA 3EQ9A 2AH1A 4QRJA 3VI4A 3SFZA 4YVDA 4JSXC 3NVNA 3C5MA 1MDAH 4J77A 5FFGA 4Y7RA 4GMBA 2W18A 2QC5A 3SJLD 3ZE2A 3I8EA 3NVQA 3I89A 1GOTB 1R5MA 4BL0A 2IURA 4JXMA 3IULA 4IRZA 5EM2A 3ZE1A 1E8NA 2P9PC 4MMYA 4CY2A 3K27A 4CY3A 2HU5A 4ERYA 4Z7NA 4L9OA 3OF7A 4H5JA 2H9PA 4PC0A 4ZOYA 2QXVA 5H14A 1OLZA 2XL2A 2XU7A 2VDPA 4J84A 3RLMD 4ERQA 5EM2B 2IWFA 3SMRA 3EI2A 3AH8B 3B7FA 1SQ9A 2H9MA 2CO0A 1K8KC 2VDKA 2BCJB 1GOHA 4A11A 3MZLA 3JB9L 3MXXA 3FM0A 2IUPA 1XIPA 3RRMC 4ZOZA 4A08B 2H13A 5EMJB 5H1MA 4DNVA 2GC4A 3K71A 5E6RA 3F3FA 5M5TA 3U4YA 4GQ2P 4JT5C 2H14A 3ZDXA 4N14A 4A11B 5IC7A 4CI2A 3C9CA 3IUNA 3SBPA 4LG9A 2CE9A 3HFQA 1E8MA 3I7OA 2OIZA 3I8CA 5M61A 2H9NA 1VZ3A 2XZGA 5TF2A 2G99A 4E5ZA 3GFCA 4I79A 2VDRA 5EARA 2HU8A 5FLXg 2CN3A 3N0DA 1UOOA 2HESX 4XYHA 4PBZA 1U4CA 3BG1A 3IURA 2CN2A 3UVMA 3RMZD 3OKYA 4D0KA 5EAPA 4A09A 3EWEA 2OK6A 1U8CA 4K3JB 3UKRC 4FA9D 3A0FA 3JROA 3O4IA 3PE7A 3QHYB 2J57G 3F3GA 5TDHB 4J79A 3EI1B 1E5TA 1UOQA 3IJCA 3SN6B 4A0AB 1U2VC 1UTCA 4BCBA 3FCSA 4A09B 1S4UX 1PEVA 4DNWA 5E6UA 3C99A 5HE0B 2HKMA 1B9YA 3JZHA 4WJKA 5TEEA 4ERZA 3UVKA 4Y5RD 4J8GA 3OKTA 3PXTD 4PNKB 4BP9A 1H2ZA 2EBSA 4IMMA 1ERJA 3PXWD 4BCCA 3UKUC 3RFHA 5IT9g 4NENA 3EU7A 3I7KA 5HDBA 2I0SA 2AGZA 1GG2B 2VC2A 3O4GA 5GMKn 3RN1D 3OW8A 3AL8B 4AN0A 3IIYA 5C92A 3VGZA 1YR2A 5AMSA 2J56H 5EMMB 1GOFA 4OWRA 4FA4D 5I5MA 3NIDA 3MUNA 2B5LA 5IJ7E 4KFMB 4BH6A 2OVQB 3J80g 3ORVD 1MG2A 1N6FA 4J81A 3JRPA 2YNPA 3JPXA 4JHPC 2PM9A 2EIEA 4AOWA 4BUJC 4NBMA 3SVWD 2YB8B 4WK4A 3UR4A 4JSNC 1VE6A 4AN1A 5CXBB 1NR0A 2IAAA 5AFU3 2XDWA 4O45A 1QFMA 4DNUA 2P9LC 4CZYA 3UVLA 2BKLA 4O3TB 4PSXB 5A2Qg 2PM9B 3PXSD 5FKRA 4PSWB 4CI1A 4FA1D 5KDOB 3V4VA 5C9ZB 4ESGA 3I7PA 4UM9A 2Z2PA 3C75H 2HYEA 4A08A 2AGWA 4JHNA 1K3IA 3IUQA 3PSLA 3VA6A 4FA5D 2BBKH 3GD1I 3SHFA 2EIDA 4G1EA 1M1XA 2I0TA 5C2VB 1N6EA 2IWKA 4XEIC 2H6NA 2Z2OA 3I2NA 3CFSB 2CE8A 5FA5B 1C9LA 4FHLA 2AGYA 3ULEC 3N0EA 4WK0A 1O6FA 1SHYB 4JSPC 4L1QD 2OVRB 3MZKA 5HE1B 3DXMC 4GQBB 3ZDYA 2P9SC 1Q47A 3EI4B 3EI3B 4J78A 4R7AB 2B5NA 3V5WB 1I2MB 5JWZA 4NSXA 3EI1A 3ZE0A 3E0CA 4L1MA 4X61B 5SXMA 5CXCB 4A0AA 2I3TA 1XKSA 4QQEA 5GXIA 2HJ4A 2WQ8A 4AMZA 2J55H 3DWLC 4FWWA 4O02A 3AFCA 4GZ8A 4FAND 2H6QA 4Z8LA 4AX4A 2P9IC 3FGBA 2GC7A 4UM8A 1TYQC 2EIBA 2VDOA 4NAAA 3OTTA 1BPOA 4J82A 4L3HD 1NEXB 2G9AA 5C86A 5I5IA 4J86A 4O2WA 4J8BA 3V9FA 2Z2NA 4J73A 5IGQA 3DM0A 1T2XA 3AL8A 2VDLA 4QL1A 3JAMg 5EALA 4CY1A 5FXYA 4QT8A 2IUVA 3UVNA 2AH0A 3KRWB 4A0BA 4JSVC 1FWXA 5HE3B 1A12A 4FB1D 1N6DA 2OJYA 4U7AA 3RN0D 3PVWB 3IUMA 4A2LA 2AGXA 3FCUA 4GGDA 3MKSB 1A0RB 2O9KA 4JD2C 4QAMA 4AMYA 2P9KC 5CXBA 4CY5A 5AJAA 4BP8A 4A0BB 2UZXB 5H17A 3SBRA 2UZYB 5GSAA 5FQDA 1JV2A 4A2MA 4GQ1A 5M5UA 2AQ5A 4E54B 3MUOA 3OL2B 5K19A 3RFGA 4LGNA 3MKQA 3OKWA 4G1MA 3NIGA 5THAA 2PBIB 1RI6A 2JKXA 5IJ8E 3DXKC 2VDQA 4NC4A 1GP2B 1UOPA 2EICA 3K6SA 2YBAA 4ES0A 3IJ1A 1K32A 3SWSD 2XE4A 1PBYB 1JTDB 3IJ0A 2H6KA 3DDUA 3KCIA 3UVOA 2OK4A 3EMHA 4RE5A 4CI8A 4IA9A 3V7DB 4OZUA 3NIFA 2GNQA 4JT6C 4MK0B 3QI0A 3K26A 4WK2A 1OMWB 3PSCB 2HU7A 4X3EA 1H2XA 5K1CC 3CIKB 3L4MD 4G55A 1O6GA 5CYKA 4ZOVA 1VZ2A 3I7LA 1JJUB 5FFOA 1GOGA 4AEZA 4H5IA 4GM9A 4J87A 4J0WA 3AL9A 3EI4A 3SCYA 4D9SA 2VDNA 3EQ7A 3EI3A 3RSEC 3ODTA 3W15A 3BG0A 3IKOA 3K72A
chains in the Genus database with same CATH topology
2XZGA 5M5RA 5M5VA 4G55A 5M5TA 1BPOA 5M61A 5M5UA 5M5SA 1C9IA 3GD1I 1UTCA 1C9LA 3GC3B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XZG A;  5M5R A;  5M5V A;  4G55 A;  5M5T A;  1BPO A;  5M61 A;  5M5U A;  5M5S A;  1C9I A;  3GD1 I;  1UTC A;  1C9L A;  3GC3 B; 
#chains in the Genus database with same CATH topology
 2QR5 A;  3T3M A;  3SLE D;  3I7N A;  5CXC A;  1QFS A;  1VYH C;  1YFQ A;  3KRX B;  4CC9 A;  2B5M A;  5CYK B;  3J81 g;  4GM8 A;  1GXR A;  5M5V A;  1TBG A;  4GGA A;  2CO0 C;  4CZX A;  1VE7 A;  2TRC B;  2XYI A;  4LG8 A;  1PI6 A;  4HDJ A;  4TZ4 A;  3MVD K;  4CI3 A;  2PM6 B;  2P9U C;  2Q7Q A;  3EI2 B;  5FKT A;  3VI3 A;  2HXC A;  3JZN A;  5EAM A;  4A7J A;  3EQ8 A;  2QZP A;  4XYI A;  4X63 B;  4K3I D;  5HYN B;  3MMY A;  5EMK B;  1MG3 A;  3P4F A;  4G56 B;  4U1E I;  3T3P A;  1PGU A;  5M5R A;  3SXT D;  3BWS A;  2I0R A;  4RE6 A;  1JOF A;  1TYE A;  4UI9 R;  3O4J A;  1H2W A;  4CZV A;  3GRE A;  4BCD A;  4J0X A;  1B9X A;  2CNX A;  1JMX B;  4L3G D;  1H2Y A;  5HQG A;  1JMZ B;  4Z7O A;  2HKR A;  4E5Z B;  3DSM A;  2I3S A;  3F3P A;  5I5J A;  3IUJ A;  2VZ1 A;  2H9L A;  4FAV D;  1C9I A;  3OKY B;  2AGL A;  4X60 B;  2P9N C;  1QNI A;  2YNO A;  5IGO A;  4O3U B;  5B4W A;  4Z7Q A;  3O4H A;  4O9D A;  2H3X A;  4ZN4 A;  4MMZ A;  1L5G A;  2YMU A;  4PBY A;  5E6S A;  4E54 A;  3V4P A;  2XL3 A;  3GC3 B;  4PXW A;  2OVP B;  3OL2 A;  3NVX A;  3PVU B;  4EWR A;  2VDM A;  1SQJ A;  2HJB A;  5M5S A;  3IJE A;  4GGC A;  3JZG A;  2H68 A;  2IUQ A;  5TEF A;  2PM7 B;  4MMX A;  2H47 A;  3FRX A;  5GXH A;  4ZOX A;  4GM3 A;  3SBQ A;  3IIW A;  2B4E A;  5HE2 B;  2YNN A;  3VH0 A;  5EML B;  3EG6 A;  5C2W B;  3I7H A;  3ZDZ A;  1L0Q A;  5FKS A;  4O1Q D;  3ZWL B;  3IVM A;  1P22 A;  5FKQ A;  3CFV A;  2MTA H;  2VZ3 A;  4D6V A;  3L4O D;  1XHM A;  3EQ9 A;  2AH1 A;  4QRJ A;  3VI4 A;  3SFZ A;  4YVD A;  4JSX C;  3NVN A;  3C5M A;  1MDA H;  4J77 A;  5FFG A;  4Y7R A;  4GMB A;  2W18 A;  2QC5 A;  3SJL D;  3ZE2 A;  3I8E A;  3NVQ A;  3I89 A;  1GOT B;  1R5M A;  4BL0 A;  2IUR A;  4JXM A;  3IUL A;  4IRZ A;  5EM2 A;  3ZE1 A;  1E8N A;  2P9P C;  4MMY A;  4CY2 A;  3K27 A;  4CY3 A;  2HU5 A;  4ERY A;  4Z7N A;  4L9O A;  3OF7 A;  4H5J A;  2H9P A;  4PC0 A;  4ZOY A;  2QXV A;  5H14 A;  1OLZ A;  2XL2 A;  2XU7 A;  2VDP A;  4J84 A;  3RLM D;  4ERQ A;  5EM2 B;  2IWF A;  3SMR A;  3EI2 A;  3AH8 B;  3B7F A;  1SQ9 A;  2H9M A;  2CO0 A;  1K8K C;  2VDK A;  2BCJ B;  1GOH A;  4A11 A;  3MZL A;  3JB9 L;  3MXX A;  3FM0 A;  2IUP A;  1XIP A;  3RRM C;  4ZOZ A;  4A08 B;  2H13 A;  5EMJ B;  5H1M A;  4DNV A;  2GC4 A;  3K71 A;  5E6R A;  3F3F A;  5M5T A;  3U4Y A;  4GQ2 P;  4JT5 C;  2H14 A;  3ZDX A;  4N14 A;  4A11 B;  5IC7 A;  4CI2 A;  3C9C A;  3IUN A;  3SBP A;  4LG9 A;  2CE9 A;  3HFQ A;  1E8M A;  3I7O A;  2OIZ A;  3I8C A;  5M61 A;  2H9N A;  1VZ3 A;  2XZG A;  5TF2 A;  2G99 A;  4E5Z A;  3GFC A;  4I79 A;  2VDR A;  5EAR A;  2HU8 A;  5FLX g;  2CN3 A;  3N0D A;  1UOO A;  2HES X;  4XYH A;  4PBZ A;  1U4C A;  3BG1 A;  3IUR A;  2CN2 A;  3UVM A;  3RMZ D;  3OKY A;  4D0K A;  5EAP A;  4A09 A;  3EWE A;  2OK6 A;  1U8C A;  4K3J B;  3UKR C;  4FA9 D;  3A0F A;  3JRO A;  3O4I A;  3PE7 A;  3QHY B;  2J57 G;  3F3G A;  5TDH B;  4J79 A;  3EI1 B;  1E5T A;  1UOQ A;  3IJC A;  3SN6 B;  4A0A B;  1U2V C;  1UTC A;  4BCB A;  3FCS A;  4A09 B;  1S4U X;  1PEV A;  4DNW A;  5E6U A;  3C99 A;  5HE0 B;  2HKM A;  1B9Y A;  3JZH A;  4WJK A;  5TEE A;  4ERZ A;  3UVK A;  4Y5R D;  4J8G A;  3OKT A;  3PXT D;  4PNK B;  4BP9 A;  1H2Z A;  2EBS A;  4IMM A;  1ERJ A;  3PXW D;  4BCC A;  3UKU C;  3RFH A;  5IT9 g;  4NEN A;  3EU7 A;  3I7K A;  5HDB A;  2I0S A;  2AGZ A;  1GG2 B;  2VC2 A;  3O4G A;  5GMK n;  3RN1 D;  3OW8 A;  3AL8 B;  4AN0 A;  3IIY A;  5C92 A;  3VGZ A;  1YR2 A;  5AMS A;  2J56 H;  5EMM B;  1GOF A;  4OWR A;  4FA4 D;  5I5M A;  3NID A;  3MUN A;  2B5L A;  5IJ7 E;  4KFM B;  4BH6 A;  2OVQ B;  3J80 g;  3ORV D;  1MG2 A;  1N6F A;  4J81 A;  3JRP A;  2YNP A;  3JPX A;  4JHP C;  2PM9 A;  2EIE A;  4AOW A;  4BUJ C;  4NBM A;  3SVW D;  2YB8 B;  4WK4 A;  3UR4 A;  4JSN C;  1VE6 A;  4AN1 A;  5CXB B;  1NR0 A;  2IAA A;  5AFU 3;  2XDW A;  4O45 A;  1QFM A;  4DNU A;  2P9L C;  4CZY A;  3UVL A;  2BKL A;  4O3T B;  4PSX B;  5A2Q g;  2PM9 B;  3PXS D;  5FKR A;  4PSW B;  4CI1 A;  4FA1 D;  5KDO B;  3V4V A;  5C9Z B;  4ESG A;  3I7P A;  4UM9 A;  2Z2P A;  3C75 H;  2HYE A;  4A08 A;  2AGW A;  4JHN A;  1K3I A;  3IUQ A;  3PSL A;  3VA6 A;  4FA5 D;  2BBK H;  3GD1 I;  3SHF A;  2EID A;  4G1E A;  1M1X A;  2I0T A;  5C2V B;  1N6E A;  2IWK A;  4XEI C;  2H6N A;  2Z2O A;  3I2N A;  3CFS B;  2CE8 A;  5FA5 B;  1C9L A;  4FHL A;  2AGY A;  3ULE C;  3N0E A;  4WK0 A;  1O6F A;  1SHY B;  4JSP C;  4L1Q D;  2OVR B;  3MZK A;  5HE1 B;  3DXM C;  4GQB B;  3ZDY A;  2P9S C;  1Q47 A;  3EI4 B;  3EI3 B;  4J78 A;  4R7A B;  2B5N A;  3V5W B;  1I2M B;  5JWZ A;  4NSX A;  3EI1 A;  3ZE0 A;  3E0C A;  4L1M A;  4X61 B;  5SXM A;  5CXC B;  4A0A A;  2I3T A;  1XKS A;  4QQE A;  5GXI A;  2HJ4 A;  2WQ8 A;  4AMZ A;  2J55 H;  3DWL C;  4FWW A;  4O02 A;  3AFC A;  4GZ8 A;  4FAN D;  2H6Q A;  4Z8L A;  4AX4 A;  2P9I C;  3FGB A;  2GC7 A;  4UM8 A;  1TYQ C;  2EIB A;  2VDO A;  4NAA A;  3OTT A;  1BPO A;  4J82 A;  4L3H D;  1NEX B;  2G9A A;  5C86 A;  5I5I A;  4J86 A;  4O2W A;  4J8B A;  3V9F A;  2Z2N A;  4J73 A;  5IGQ A;  3DM0 A;  1T2X A;  3AL8 A;  2VDL A;  4QL1 A;  3JAM g;  5EAL A;  4CY1 A;  5FXY A;  4QT8 A;  2IUV A;  3UVN A;  2AH0 A;  3KRW B;  4A0B A;  4JSV C;  1FWX A;  5HE3 B;  1A12 A;  4FB1 D;  1N6D A;  2OJY A;  4U7A A;  3RN0 D;  3PVW B;  3IUM A;  4A2L A;  2AGX A;  3FCU A;  4GGD A;  3MKS B;  1A0R B;  2O9K A;  4JD2 C;  4QAM A;  4AMY A;  2P9K C;  5CXB A;  4CY5 A;  5AJA A;  4BP8 A;  4A0B B;  2UZX B;  5H17 A;  3SBR A;  2UZY B;  5GSA A;  5FQD A;  1JV2 A;  4A2M A;  4GQ1 A;  5M5U A;  2AQ5 A;  4E54 B;  3MUO A;  3OL2 B;  5K19 A;  3RFG A;  4LGN A;  3MKQ A;  3OKW A;  4G1M A;  3NIG A;  5THA A;  2PBI B;  1RI6 A;  2JKX A;  5IJ8 E;  3DXK C;  2VDQ A;  4NC4 A;  1GP2 B;  1UOP A;  2EIC A;  3K6S A;  2YBA A;  4ES0 A;  3IJ1 A;  1K32 A;  3SWS D;  2XE4 A;  1PBY B;  1JTD B;  3IJ0 A;  2H6K A;  3DDU A;  3KCI A;  3UVO A;  2OK4 A;  3EMH A;  4RE5 A;  4CI8 A;  4IA9 A;  3V7D B;  4OZU A;  3NIF A;  2GNQ A;  4JT6 C;  4MK0 B;  3QI0 A;  3K26 A;  4WK2 A;  1OMW B;  3PSC B;  2HU7 A;  4X3E A;  1H2X A;  5K1C C;  3CIK B;  3L4M D;  4G55 A;  1O6G A;  5CYK A;  4ZOV A;  1VZ2 A;  3I7L A;  1JJU B;  5FFO A;  1GOG A;  4AEZ A;  4H5I A;  4GM9 A;  4J87 A;  4J0W A;  3AL9 A;  3EI4 A;  3SCY A;  4D9S A;  2VDN A;  3EQ7 A;  3EI3 A;  3RSE C;  3ODT A;  3W15 A;  3BG0 A;  3IKO A;  3K72 A; 
#chains in the Genus database with same CATH homology
 2XZG A;  5M5R A;  5M5V A;  4G55 A;  5M5T A;  1BPO A;  5M61 A;  5M5U A;  5M5S A;  1C9I A;  3GD1 I;  1UTC A;  1C9L A;  3GC3 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...