5M5TA

Clathrin heavy chain n-terminal domain bound to a non-natural clathrin-box motif peptide (amph4t1)
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
360
structure length
360
Chain Sequence
b'ILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMNDPSNPIRRPISADSAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMTDDVTFWKWISLNTVALVTDNAVYHWSMEGESQPVKMFDRHSSLAGCQIINYRTDAKQKWLLLTGISAQQNRVVGAMQLYSVDRKVSQPIEGHAASFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTGNQPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISGETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITNVLQNPDLALRMAVRNNLAGAEEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Clathrin heavy chain 1
publication title Cellular and viral peptides bind multiple sites on the N-terminal domain of clathrin.
pubmed doi rcsb
source organism Bos taurus
molecule tags Endocytosis
total genus 84
structure length 360
sequence length 360
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01394 Clathrin_propel Clathrin propeller repeat
A PF09268 Clathrin-link Clathrin, heavy-chain linker
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.110 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Clathrin heavy-chain terminal domain 5m5tA00
5M5RA 3GC3B 1UTCA 1BPOA 3GD1I 1C9LA 5M61A 5M5VA 4G55A 5M5TA 5M5UA 5M5SA 1C9IA 2XZGA
chains in the Genus database with same CATH superfamily
2OVPB 3IJEA 3O4JA 4IRZA 3B7FA 2BBKH 3FM0A 3CFVA 4JSXC 4FA4D 3A0FA 3PVWB 4NENA 5TDHB 2YNOA 3SWSD 3V5WB 4A2MA 1QFSA 4GMBA 4QRJA 3GC3B 3V4VA 3IJ1A 4Y7RA 1U2VC 3VA6A 3K72A 3V4PA 2VC2A 4NBMA 5IGQA 3K6SA 3NVQA 3HFQA 2P9KC 4G56B 3L4OD 2CN3A 4XYHA 4OWRA 4AN0A 5TF2A 4FB1D 3MZKA 2VDMA 3JAMg 2H6QA 3ZE0A 2CN2A 3KRWB 3I7KA 1Q47A 3VGZA 3EMHA 5JWZA 3PSLA 1GOFA 4D6VA 3JROA 3F3FA 3MKQA 4O1QD 2HKMA 5M5SA 4ERZA 3N0DA 5I5IA 3JZGA 5IC7A 3RN0D 1XKSA 2GNQA 4L1MA 5TEFA 4BP9A 1M1XA 4BCBA 2IURA 5CXCB 2OVQB 4GGCA 4GGDA 3V7DB 1MG3A 2XYIA 1BPOA 4X3EA 5E6RA 5HE3B 5C86A 1OMWB 1QNIA 1UOPA 2H9LA 1O6GA 5HQGA 4DNUA 3EI1B 2VDRA 3O4IA 2HU5A 2YNPA 2P9SC 5EMLB 3ZDZA 3JZNA 1FWXA 4TZ4A 4BCDA 4L3HD 4A0AB 2OK6A 4A09A 2BCJB 2MTAH 4NC4A 1UOOA 4CZVA 4J79A 5CYKB 3EI3A 3NIFA 4QQEA 3EU7A 1RI6A 4LG8A 3SMRA 2XE4A 5AJAA 2H6NA 2UZXB 3ZDYA 2AGZA 4JHPC 4X61B 5CXBA 4H5IA 3C9CA 2GC7A 1I2MB 4ERYA 3VI3A 5FKSA 3PXWD 4UM9A 4O2WA 1N6DA 1QFMA 1GG2B 4G55A 5HE0B 2IUQA 4CY1A 3OKYA 4FAVD 2I3SA 1YR2A 4LGNA 3L4MD 5EM2B 1VYHC 3C99A 5GSAA 2VDPA 3MXXA 3AH8B 4JHNA 2AH0A 2B5NA 4NAAA 3ZE1A 4A7JA 4FA9D 3DSMA 4I79A 5IT9g 3UVKA 3MMYA 3NVNA 4RE5A 1B9YA 5C2VB 3U4YA 2Z2NA 2JKXA 3RFHA 5EAPA 3EQ8A 2CO0C 1A12A 3C5MA 3RN1D 3FCSA 5HYNB 4IA9A 3N0EA 2VDLA 3AL8A 3BG0A 4K3JB 4WK2A 3OKWA 3IUMA 4HDJA 2Q7QA 3DM0A 4QL1A 3I7PA 4A0BA 4E54A 3F3GA 4J0XA 2H3XA 4A09B 4FAND 4Z7OA 3UVMA 3QHYB 2HU8A 4EWRA 3SVWD 3EQ7A 4K3ID 3EI3B 1U4CA 3E0CA 2HYEA 1GP2B 3O4HA 4A08B 3EI2B 4CI1A 1U8CA 4L1QD 4CI8A 3DWLC 4J8BA 4AMYA 5IJ7E 5EMJB 4FHLA 5FLXg 4G1MA 3OW8A 4O3UB 1NR0A 3IJ0A 3BG1A 1L0QA 1H2WA 3ORVD 1MDAH 4AOWA 2P9PC 4H5JA 4J87A 4J81A 4E5ZB 4MK0B 3BWSA 4PNKB 4BH6A 2XL3A 2YNNA 4A11B 3OF7A 3FRXA 1TBGA 3NIGA 4WJKA 5IJ8E 2J57G 1PEVA 3KRXB 2Z2OA 4ES0A 4RE6A 2HJ4A 5H17A 5HDBA 5C9ZB 3I7OA 4X63B 3JB9L 2AGWA 3JRPA 2TRCB 5EAMA 3SFZA 5AFU3 3SCYA 1R5MA 2YBAA 4X60B 5EALA 1K3IA 4PC0A 5K1CC 4PBYA 2HJBA 4CI2A 2EBSA 5GMKn 1GOGA 3V9FA 4J86A 2VDNA 4DNVA 5M5TA 2VZ3A 4L3GD 4A0BB 2XU7A 3W15A 4ZOVA 2PM9B 3SBQA 3KCIA 4LG9A 2I0SA 1PI6A 2EIEA 1TYQC 4CY5A 5I5MA 5M5RA 3EI4A 2AH1A 4YVDA 3UVOA 2P9NC 4CI3A 3CFSB 2IUPA 3NIDA 3I7NA 4J82A 1VE7A 4XEIC 1K8KC 2HU7A 1JMZB 2CNXA 3NVXA 4CZYA 5FKRA 2P9UC 3RRMC 1SQ9A 2O9KA 3IUJA 3JPXA 4DNWA 4FWWA 1T2XA 4CY2A 4XYIA 5C2WB 1H2ZA 4N14A 3UR4A 3UKRC 2H14A 3IUQA 4QT8A 3RSEC 2VDQA 5M5VA 5SXMA 4AMZA 4A2LA 5HE1B 4NSXA 3QI0A 3RFGA 2W18A 4J84A 4D9SA 4OZUA 2B4EA 2VDKA 3MKSB 4MMYA 3J80g 4ERQA 2P9IC 2HESX 1GOHA 3K27A 2QC5A 4PSXB 4PXWA 4AN1A 2AGYA 3IIWA 1N6EA 2QR5A 4BP8A 4JSPC 2CO0A 1N6FA 3IUNA 2QXVA 1GOTB 5E6SA 4CY3A 3IIYA 3MZLA 4KFMB 3UKUC 3ZWLB 3OTTA 1JJUB 3JZHA 1B9XA 2EICA 4UI9R 1SHYB 3EI4B 2OVRB 5FFOA 1MG2A 5E6UA 4PSWB 4WK4A 4JT6C 5CXBB 5CXCA 4GM8A 5FKTA 3SHFA 1UTCA 1SQJA 5IGOA 4O02A 3MUOA 2H9PA 2CE9A 2QZPA 2VZ1A 3SXTD 2J56H 4U7AA 5C92A 4A0AA 3O4GA 1YFQA 2H13A 3UVNA 1S4UX 3OKYB 3SN6B 2H68A 2G9AA 4UM8A 4ESGA 3SJLD 1NEXB 4O45A 5CYKA 5M61A 5THAA 2GC4A 2EIDA 3C75H 1L5GA 2H9NA 4CC9A 3SBPA 1O6FA 2B5LA 4J77A 1A0RB 4JSNC 5FKQA 4Z7NA 2UZYB 4GGAA 4AEZA 2P9LC 4Z7QA 4JD2C 2Z2PA 2AGLA 4GQ2P 4GZ8A 3K26A 2G99A 1H2YA 3PE7A 3OL2A 2WQ8A 4ZN4A 3EWEA 3AFCA 5K19A 4Z8LA 2XZGA 2H9MA 4D0KA 2PM7B 3PXTD 3AL8B 3FCUA 5EM2A 3EQ9A 3ULEC 4QAMA 1VE6A 3CIKB 3P4FA 3PVUB 3I8CA 4L9OA 2IWFA 5H14A 3K71A 4J78A 1JTDB 4E54B 4O9DA 3AL9A 1VZ3A 1JOFA 3GREA 3DXKC 5EMMB 1VZ2A 5EMKB 5FA5B 2CE8A 2XDWA 4IMMA 2EIBA 3ZDXA 3ZE2A 2OK4A 4WK0A 3GD1I 4GM3A 3IVMA 4PBZA 3IULA 3IKOA 3OKTA 5TEEA 4J8GA 4MMZA 1XHMA 3UVLA 3J81g 1UOQA 4JSVC 3RMZD 4GM9A 3FGBA 1H2XA 5A2Qg 4R7AB 2I0RA 2OIZA 1E8NA 2VDOA 1C9LA 1XIPA 5H1MA 1P22A 4A08A 3EI2A 2PBIB 4J0WA 3F3PA 4ZOXA 4AX4A 2J55H 2H47A 5HE2B 5B4WA 5I5JA 4FA5D 3OL2B 3T3MA 3I89A 4BUJC 4ZOYA 2I0TA 3I7LA 1OLZA 4BL0A 4GQ1A 2B5MA 4E5ZA 3SBRA 5FQDA 1JMXB 4A11A 2IAAA 4GQBB 3IJCA 1GXRA 1K32A 2H6KA 3RLMD 4MMXA 3MVDK 2BKLA 2HXCA 3MUNA 1TYEA 3ODTA 1JV2A 2I3TA 4BCCA 4J73A 1ERJA 2AGXA 4U1EI 2HKRA 5GXIA 5FXYA 5AMSA 4CZXA 5M5UA 4JT5C 4JXMA 3IURA 2PM6B 3I7HA 5FFGA 3DXMC 3VH0A 3I8EA 3T3PA 2AQ5A 3GFCA 2OJYA 4O3TB 5KDOB 3PSCB 1C9IA 1E8MA 1PGUA 2YMUA 1E5TA 4ZOZA 3SLED 4FA1D 2IWKA 5EARA 5GXHA 3PXSD 4Y5RD 3EI1A 3EG6A 2PM9A 3I2NA 4G1EA 3VI4A 2IUVA 1PBYB 3DDUA 2XL2A 2YB8B
chains in the Genus database with same CATH topology
5M5RA 3GC3B 1UTCA 1BPOA 3GD1I 1C9LA 5M61A 5M5VA 4G55A 5M5TA 5M5UA 5M5SA 1C9IA 2XZGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5M5R A;  3GC3 B;  1UTC A;  1BPO A;  3GD1 I;  1C9L A;  5M61 A;  5M5V A;  4G55 A;  5M5T A;  5M5U A;  5M5S A;  1C9I A;  2XZG A; 
#chains in the Genus database with same CATH topology
 2OVP B;  3IJE A;  3O4J A;  4IRZ A;  3B7F A;  2BBK H;  3FM0 A;  3CFV A;  4JSX C;  4FA4 D;  3A0F A;  3PVW B;  4NEN A;  5TDH B;  2YNO A;  3SWS D;  3V5W B;  4A2M A;  1QFS A;  4GMB A;  4QRJ A;  3GC3 B;  3V4V A;  3IJ1 A;  4Y7R A;  1U2V C;  3VA6 A;  3K72 A;  3V4P A;  2VC2 A;  4NBM A;  5IGQ A;  3K6S A;  3NVQ A;  3HFQ A;  2P9K C;  4G56 B;  3L4O D;  2CN3 A;  4XYH A;  4OWR A;  4AN0 A;  5TF2 A;  4FB1 D;  3MZK A;  2VDM A;  3JAM g;  2H6Q A;  3ZE0 A;  2CN2 A;  3KRW B;  3I7K A;  1Q47 A;  3VGZ A;  3EMH A;  5JWZ A;  3PSL A;  1GOF A;  4D6V A;  3JRO A;  3F3F A;  3MKQ A;  4O1Q D;  2HKM A;  5M5S A;  4ERZ A;  3N0D A;  5I5I A;  3JZG A;  5IC7 A;  3RN0 D;  1XKS A;  2GNQ A;  4L1M A;  5TEF A;  4BP9 A;  1M1X A;  4BCB A;  2IUR A;  5CXC B;  2OVQ B;  4GGC A;  4GGD A;  3V7D B;  1MG3 A;  2XYI A;  1BPO A;  4X3E A;  5E6R A;  5HE3 B;  5C86 A;  1OMW B;  1QNI A;  1UOP A;  2H9L A;  1O6G A;  5HQG A;  4DNU A;  3EI1 B;  2VDR A;  3O4I A;  2HU5 A;  2YNP A;  2P9S C;  5EML B;  3ZDZ A;  3JZN A;  1FWX A;  4TZ4 A;  4BCD A;  4L3H D;  4A0A B;  2OK6 A;  4A09 A;  2BCJ B;  2MTA H;  4NC4 A;  1UOO A;  4CZV A;  4J79 A;  5CYK B;  3EI3 A;  3NIF A;  4QQE A;  3EU7 A;  1RI6 A;  4LG8 A;  3SMR A;  2XE4 A;  5AJA A;  2H6N A;  2UZX B;  3ZDY A;  2AGZ A;  4JHP C;  4X61 B;  5CXB A;  4H5I A;  3C9C A;  2GC7 A;  1I2M B;  4ERY A;  3VI3 A;  5FKS A;  3PXW D;  4UM9 A;  4O2W A;  1N6D A;  1QFM A;  1GG2 B;  4G55 A;  5HE0 B;  2IUQ A;  4CY1 A;  3OKY A;  4FAV D;  2I3S A;  1YR2 A;  4LGN A;  3L4M D;  5EM2 B;  1VYH C;  3C99 A;  5GSA A;  2VDP A;  3MXX A;  3AH8 B;  4JHN A;  2AH0 A;  2B5N A;  4NAA A;  3ZE1 A;  4A7J A;  4FA9 D;  3DSM A;  4I79 A;  5IT9 g;  3UVK A;  3MMY A;  3NVN A;  4RE5 A;  1B9Y A;  5C2V B;  3U4Y A;  2Z2N A;  2JKX A;  3RFH A;  5EAP A;  3EQ8 A;  2CO0 C;  1A12 A;  3C5M A;  3RN1 D;  3FCS A;  5HYN B;  4IA9 A;  3N0E A;  2VDL A;  3AL8 A;  3BG0 A;  4K3J B;  4WK2 A;  3OKW A;  3IUM A;  4HDJ A;  2Q7Q A;  3DM0 A;  4QL1 A;  3I7P A;  4A0B A;  4E54 A;  3F3G A;  4J0X A;  2H3X A;  4A09 B;  4FAN D;  4Z7O A;  3UVM A;  3QHY B;  2HU8 A;  4EWR A;  3SVW D;  3EQ7 A;  4K3I D;  3EI3 B;  1U4C A;  3E0C A;  2HYE A;  1GP2 B;  3O4H A;  4A08 B;  3EI2 B;  4CI1 A;  1U8C A;  4L1Q D;  4CI8 A;  3DWL C;  4J8B A;  4AMY A;  5IJ7 E;  5EMJ B;  4FHL A;  5FLX g;  4G1M A;  3OW8 A;  4O3U B;  1NR0 A;  3IJ0 A;  3BG1 A;  1L0Q A;  1H2W A;  3ORV D;  1MDA H;  4AOW A;  2P9P C;  4H5J A;  4J87 A;  4J81 A;  4E5Z B;  4MK0 B;  3BWS A;  4PNK B;  4BH6 A;  2XL3 A;  2YNN A;  4A11 B;  3OF7 A;  3FRX A;  1TBG A;  3NIG A;  4WJK A;  5IJ8 E;  2J57 G;  1PEV A;  3KRX B;  2Z2O A;  4ES0 A;  4RE6 A;  2HJ4 A;  5H17 A;  5HDB A;  5C9Z B;  3I7O A;  4X63 B;  3JB9 L;  2AGW A;  3JRP A;  2TRC B;  5EAM A;  3SFZ A;  5AFU 3;  3SCY A;  1R5M A;  2YBA A;  4X60 B;  5EAL A;  1K3I A;  4PC0 A;  5K1C C;  4PBY A;  2HJB A;  4CI2 A;  2EBS A;  5GMK n;  1GOG A;  3V9F A;  4J86 A;  2VDN A;  4DNV A;  5M5T A;  2VZ3 A;  4L3G D;  4A0B B;  2XU7 A;  3W15 A;  4ZOV A;  2PM9 B;  3SBQ A;  3KCI A;  4LG9 A;  2I0S A;  1PI6 A;  2EIE A;  1TYQ C;  4CY5 A;  5I5M A;  5M5R A;  3EI4 A;  2AH1 A;  4YVD A;  3UVO A;  2P9N C;  4CI3 A;  3CFS B;  2IUP A;  3NID A;  3I7N A;  4J82 A;  1VE7 A;  4XEI C;  1K8K C;  2HU7 A;  1JMZ B;  2CNX A;  3NVX A;  4CZY A;  5FKR A;  2P9U C;  3RRM C;  1SQ9 A;  2O9K A;  3IUJ A;  3JPX A;  4DNW A;  4FWW A;  1T2X A;  4CY2 A;  4XYI A;  5C2W B;  1H2Z A;  4N14 A;  3UR4 A;  3UKR C;  2H14 A;  3IUQ A;  4QT8 A;  3RSE C;  2VDQ A;  5M5V A;  5SXM A;  4AMZ A;  4A2L A;  5HE1 B;  4NSX A;  3QI0 A;  3RFG A;  2W18 A;  4J84 A;  4D9S A;  4OZU A;  2B4E A;  2VDK A;  3MKS B;  4MMY A;  3J80 g;  4ERQ A;  2P9I C;  2HES X;  1GOH A;  3K27 A;  2QC5 A;  4PSX B;  4PXW A;  4AN1 A;  2AGY A;  3IIW A;  1N6E A;  2QR5 A;  4BP8 A;  4JSP C;  2CO0 A;  1N6F A;  3IUN A;  2QXV A;  1GOT B;  5E6S A;  4CY3 A;  3IIY A;  3MZL A;  4KFM B;  3UKU C;  3ZWL B;  3OTT A;  1JJU B;  3JZH A;  1B9X A;  2EIC A;  4UI9 R;  1SHY B;  3EI4 B;  2OVR B;  5FFO A;  1MG2 A;  5E6U A;  4PSW B;  4WK4 A;  4JT6 C;  5CXB B;  5CXC A;  4GM8 A;  5FKT A;  3SHF A;  1UTC A;  1SQJ A;  5IGO A;  4O02 A;  3MUO A;  2H9P A;  2CE9 A;  2QZP A;  2VZ1 A;  3SXT D;  2J56 H;  4U7A A;  5C92 A;  4A0A A;  3O4G A;  1YFQ A;  2H13 A;  3UVN A;  1S4U X;  3OKY B;  3SN6 B;  2H68 A;  2G9A A;  4UM8 A;  4ESG A;  3SJL D;  1NEX B;  4O45 A;  5CYK A;  5M61 A;  5THA A;  2GC4 A;  2EID A;  3C75 H;  1L5G A;  2H9N A;  4CC9 A;  3SBP A;  1O6F A;  2B5L A;  4J77 A;  1A0R B;  4JSN C;  5FKQ A;  4Z7N A;  2UZY B;  4GGA A;  4AEZ A;  2P9L C;  4Z7Q A;  4JD2 C;  2Z2P A;  2AGL A;  4GQ2 P;  4GZ8 A;  3K26 A;  2G99 A;  1H2Y A;  3PE7 A;  3OL2 A;  2WQ8 A;  4ZN4 A;  3EWE A;  3AFC A;  5K19 A;  4Z8L A;  2XZG A;  2H9M A;  4D0K A;  2PM7 B;  3PXT D;  3AL8 B;  3FCU A;  5EM2 A;  3EQ9 A;  3ULE C;  4QAM A;  1VE6 A;  3CIK B;  3P4F A;  3PVU B;  3I8C A;  4L9O A;  2IWF A;  5H14 A;  3K71 A;  4J78 A;  1JTD B;  4E54 B;  4O9D A;  3AL9 A;  1VZ3 A;  1JOF A;  3GRE A;  3DXK C;  5EMM B;  1VZ2 A;  5EMK B;  5FA5 B;  2CE8 A;  2XDW A;  4IMM A;  2EIB A;  3ZDX A;  3ZE2 A;  2OK4 A;  4WK0 A;  3GD1 I;  4GM3 A;  3IVM A;  4PBZ A;  3IUL A;  3IKO A;  3OKT A;  5TEE A;  4J8G A;  4MMZ A;  1XHM A;  3UVL A;  3J81 g;  1UOQ A;  4JSV C;  3RMZ D;  4GM9 A;  3FGB A;  1H2X A;  5A2Q g;  4R7A B;  2I0R A;  2OIZ A;  1E8N A;  2VDO A;  1C9L A;  1XIP A;  5H1M A;  1P22 A;  4A08 A;  3EI2 A;  2PBI B;  4J0W A;  3F3P A;  4ZOX A;  4AX4 A;  2J55 H;  2H47 A;  5HE2 B;  5B4W A;  5I5J A;  4FA5 D;  3OL2 B;  3T3M A;  3I89 A;  4BUJ C;  4ZOY A;  2I0T A;  3I7L A;  1OLZ A;  4BL0 A;  4GQ1 A;  2B5M A;  4E5Z A;  3SBR A;  5FQD A;  1JMX B;  4A11 A;  2IAA A;  4GQB B;  3IJC A;  1GXR A;  1K32 A;  2H6K A;  3RLM D;  4MMX A;  3MVD K;  2BKL A;  2HXC A;  3MUN A;  1TYE A;  3ODT A;  1JV2 A;  2I3T A;  4BCC A;  4J73 A;  1ERJ A;  2AGX A;  4U1E I;  2HKR A;  5GXI A;  5FXY A;  5AMS A;  4CZX A;  5M5U A;  4JT5 C;  4JXM A;  3IUR A;  2PM6 B;  3I7H A;  5FFG A;  3DXM C;  3VH0 A;  3I8E A;  3T3P A;  2AQ5 A;  3GFC A;  2OJY A;  4O3T B;  5KDO B;  3PSC B;  1C9I A;  1E8M A;  1PGU A;  2YMU A;  1E5T A;  4ZOZ A;  3SLE D;  4FA1 D;  2IWK A;  5EAR A;  5GXH A;  3PXS D;  4Y5R D;  3EI1 A;  3EG6 A;  2PM9 A;  3I2N A;  4G1E A;  3VI4 A;  2IUV A;  1PBY B;  3DDU A;  2XL2 A;  2YB8 B; 
#chains in the Genus database with same CATH homology
 5M5R A;  3GC3 B;  1UTC A;  1BPO A;  3GD1 I;  1C9L A;  5M61 A;  5M5V A;  4G55 A;  5M5T A;  5M5U A;  5M5S A;  1C9I A;  2XZG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...