4L1MA

Structure of the first rcc1-like domain of herc2
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
363
structure length
358
Chain Sequence
LQEVIGWGLIGWKYGPIQCEGLANLGVTQIACAEKRFLILSRNGRVYTQAYNSDTLAPQLVQGLASRNIVKIAAHSDGHHYLALAATGEVYSWGCGDGGRLGHGDTVPLEEPKVISAFSGKQAGKHVVHIACGSTYSAAITAEGELYTWGRGNYGRLGHGSSEDEAIPMLVAGLKGLKVIDVACGSGDAQTLAVTENGQVWSWGDGDYGKLGRGGSDGCKTPKLIEKLQDLDVVKVRCGSQFSIALTKDGQVYSWGKGDNQRLGHGTEEHVRYPKLLEGLQGKKVIDVAAGSTHCLALTEDSEVHSWGSNDQCQHFDTLRVTKPEPAALPGLDTKHIVGIACGPAQSFAWSSCSEWSI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 ubiquitin-protein ligase HERC2
publication title Structure of the first RCC1-like domain of HERC2
rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 93
structure length 358
sequence length 363
chains with identical sequence B, C
ec nomenclature ec 2.3.2.26: HECT-type E3 ubiquitin transferase.
pdb deposition date 2013-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00415 RCC1 Regulator of chromosome condensation (RCC1) repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.30 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Regulator of chromosome condensation 1/beta-lactamase-inhibitor protein II 4l1mA00
3QI0A 1JTDB 4L1MA 4DNUA 4O2WA 3KCIA 3MVDK 4NAAA 3OF7A 4DNVA 4DNWA 4JHNA 1A12A 4JHPC 4NBMA 4NC4A 3QHYB 4QAMA 1I2MB 4D9SA
chains in the Genus database with same CATH superfamily
3O4GA 2VDQA 4PBYA 2OK4A 4L1MA 4A0BB 4G56B 4PBZA 5EM2B 3NIFA 1K3IA 3A0FA 4O02A 2JKXA 4GQ2P 3FRXA 4JSXC 3SCYA 4G1EA 5TEEA 1U8CA 4O1QD 3IUNA 2B5LA 4L9OA 5HE3B 2GNQA 1ERJA 2HKRA 3O4JA 3K6SA 2P9IC 1P22A 3SFZA 2GC7A 4ESGA 2HU7A 2CNXA 5GMKn 2H3XA 3DDUA 1C9LA 5SXMA 4N14A 4A08A 3V7DB 2VDMA 3JZNA 4J84A 4EWRA 4A7JA 4LG9A 5KDOB 3NIDA 5IGQA 3NVNA 1UTCA 2AQ5A 4BCDA 2EIEA 4O3TB 3SBRA 4BP8A 2PBIB 1NR0A 3T3PA 5EMLB 4E54A 4J87A 3JPXA 5I5MA 3AL8A 4CI2A 3K26A 4QT8A 4A11B 4ZOXA 3RMZD 4D0KA 4BH6A 4J86A 5IJ7E 3EI4B 3UR4A 1I2MB 2VDNA 3KRWB 3C75H 1FWXA 3E0CA 3IIYA 1H2XA 3RFGA 3EMHA 3MKQA 4O2WA 2CE9A 2GC4A 3RN1D 2VDLA 4MMYA 3ODTA 2OIZA 5IC7A 4Z7NA 3EI2B 2YNNA 3DWLC 4MK0B 5C92A 3I8EA 1T2XA 1GOFA 4WK0A 2H9LA 5C2VB 3SMRA 2G99A 2H6QA 3BG0A 4OWRA 4UM8A 4A0AB 2UZXB 4PXWA 2CO0A 1JV2A 3IJ1A 4ES0A 5EMMB 3JB9L 5H1MA 1GOHA 4NAAA 1UOPA 2XE4A 5FKRA 1JMZB 1VE7A 5TF2A 2W18A 1H2WA 4BCCA 4Z7QA 4Y7RA 4WJKA 3OKTA 2VDOA 3AFCA 1A12A 4R7AB 4BP9A 3OKWA 4QQEA 3MUOA 3IJCA 2QZPA 3ZDXA 2VC2A 4GGCA 2OK6A 4FA9D 2O9KA 4PSXB 1H2YA 3C5MA 2OVPB 2PM9A 4FWWA 3ZE1A 4J0XA 2OVQB 4X60B 3RSEC 2HYEA 2CN2A 5M5SA 4JSNC 3F3FA 2XDWA 2YMUA 3IUMA 3SBQA 1K32A 1PGUA 2HKMA 3ZDYA 4QRJA 3I8CA 3FCSA 4QL1A 3CIKB 3V9FA 5IT9g 3EG6A 3J80g 5I5IA 4L3HD 4L3GD 2YB8B 5IGOA 2QXVA 4GZ8A 2Z2PA 4Z8LA 4DNUA 3C99A 3VI3A 2IUPA 3MKSB 2OVRB 3PVUB 2P9UC 3RLMD 5HYNB 3T3MA 3CFVA 1VYHC 3CFSB 4UI9R 5JWZA 4A08B 3EI3A 1VE6A 2P9KC 5C2WB 3SHFA 3HFQA 1O6FA 5EMKB 4GM9A 1E5TA 3OL2A 3UVKA 2B4EA 4UM9A 3PSLA 3P4FA 4CZXA 4E54B 4Y5RD 3AL8B 3N0DA 2YNOA 4JSVC 1MDAH 2OJYA 2QR5A 4BCBA 5CYKA 1C9IA 4RE5A 4GMBA 5CXBA 5A2Qg 4NBMA 1UOOA 5EARA 5TDHB 4J73A 4K3ID 2P9PC 4AX4A 1U2VC 3OTTA 4J78A 2P9SC 2VDKA 3KRXB 1R5MA 2XZGA 4IRZA 3L4OD 4AMZA 4J82A 4CC9A 2IUQA 4CY5A 3NVQA 3EQ7A 2IWFA 2VDRA 1K8KC 2EBSA 5C9ZB 2QC5A 1N6EA 1JMXB 1U4CA 1GP2B 1BPOA 4ZOZA 3JROA 5EAPA 5EALA 5M5UA 3AL9A 1XKSA 2HJ4A 4GGDA 4E5ZA 2BBKH 3SXTD 4BUJC 2H9NA 3QI0A 4GQ1A 2YBAA 1TBGA 4X63B 2H6KA 4O3UB 2EIDA 2J57G 3V4PA 3L4MD 4PSWB 4FA4D 4J8GA 3PSCB 2H47A 4J81A 3ZE0A 1PEVA 5AFU3 1VZ3A 3GD1I 4A09B 1YFQA 3JAMg 4DNWA 2AGYA 2WQ8A 3IJ0A 2PM9B 2YNPA 2MTAH 1RI6A 4IA9A 4NC4A 1N6DA 4U7AA 3F3GA 3AH8B 4X3EA 2VZ3A 3OKYA 4J77A 1O6GA 4FAVD 3ZWLB 3MZKA 4ERQA 5CXCA 1QFMA 5K1CC 1JTDB 4ZOYA 2PM6B 3MVDK 3F3PA 3UVLA 4WK4A 3I7KA 3BWSA 3C9CA 3ULEC 2HU8A 5FKQA 1UOQA 3IIWA 1A0RB 1TYEA 1JJUB 3EWEA 3ZE2A 1GXRA 4JT6C 1YR2A 3IURA 3K27A 2HXCA 1PI6A 1QFSA 3IVMA 2TRCB 3QHYB 4FAND 2PM7B 2EICA 2XL2A 2VZ1A 2IAAA 3SBPA 3IUJA 4TZ4A 4ERZA 3NIGA 5GSAA 3V4VA 3I7LA 3SLED 3EI3B 3VA6A 3I89A 2I3SA 3UVMA 2CO0C 2HJBA 1GOGA 3GFCA 4JXMA 5HQGA 3PE7A 4DNVA 5K19A 3RFHA 3SVWD 3OL2B 3RRMC 2H9PA 4FB1D 2H13A 4D6VA 3B7FA 4CY3A 5HDBA 5B4WA 4A2MA 2AH1A 4G1MA 5FLXg 5H17A 3FGBA 5CYKB 4D9SA 4RE6A 3FCUA 2I0RA 5HE2B 4AN1A 2J55H 4AOWA 3EI1A 3UKRC 5CXBB 1VZ2A 4PNKB 4FA5D 2B5MA 3KCIA 3IJEA 3V5WB 2XYIA 2AGWA 2I0SA 5HE1B 3GREA 1L0QA 1M1XA 2P9LC 3MMYA 3DM0A 4AMYA 1Q47A 5M5VA 2AGZA 3UVOA 3PXSD 1OLZA 2HU5A 5E6SA 1SQ9A 4KFMB 1MG2A 5E6RA 1XHMA 4IMMA 4Z7OA 4XEIC 2AGXA 4J79A 4A0BA 5THAA 5EM2A 2Z2NA 5FFGA 3UKUC 3O4IA 4CZVA 3MXXA 1B9YA 4QAMA 4OZUA 2B5NA 2IWKA 2P9NC 3VI4A 5M5TA 2Q7QA 3DXMC 1SQJA 5AJAA 4J0WA 4K3JB 1S4UX 2BCJB 3I7PA 3OF7A 4E5ZB 3O4HA 1L5GA 3I7HA 4GM8A 1H2ZA 4CI1A 3SN6B 1GG2B 3DSMA 4CZYA 4GM3A 3BG1A 4LGNA 2J56H 4JD2C 2IUVA 1B9XA 3ORVD 1SHYB 4GGAA 3SJLD 1E8MA 3DXKC 2CN3A 4HDJA 2EIBA 4MMZA 4JT5C 4JSPC 4H5JA 5HE0B 1GOTB 2BKLA 4XYIA 5AMSA 4ZN4A 3PXWD 3UVNA 2I0TA 3GC3B 4CI8A 3OKYB 4CY1A 4A11A 3EU7A 4FA1D 5CXCB 5H14A 4CY2A 1JOFA 3EI4A 4PC0A 3IULA 4JHNA 3PVWB 3JZGA 3FM0A 4YVDA 4GQBB 5FQDA 3NVXA 4BL0A 1E8NA 1NEXB 5I5JA 3W15A 3JRPA 4G55A 5TEFA 5M61A 3IUQA 2AGLA 3JZHA 2Z2OA 5IJ8E 1PBYB 4ERYA 2XU7A 1OMWB 3VGZA 5FKTA 4MMXA 4X61B 2H6NA 4AN0A 3EI2A 5FA5B 2H14A 4NENA 5E6UA 3RN0D 3K71A 2H9MA 4A2LA 3SWSD 1N6FA 3J81g 4I79A 3IKOA 4A0AA 3I7OA 3I2NA 5C86A 5FKSA 4CI3A 3EQ8A 4U1EI 4ZOVA 2G9AA 5GXIA 4NSXA 5EMJB 1MG3A 4A09A 3PXTD 3MUNA 2H68A 1TYQC 4LG8A 3K72A 2IURA 1XIPA 4FHLA 2AH0A 3ZDZA 2HESX 4AEZA 3U4YA 4WK2A 5M5RA 4J8BA 3EQ9A 3N0EA 3OW8A 3EI1B 2CE8A 3MZLA 4O45A 2VDPA 4JHPC 3I7NA 5FXYA 5EAMA 1QNIA 4L1QD 5FFOA 4H5IA 4O9DA 4XYHA 3VH0A 5GXHA 2XL3A 2UZYB 2I3TA
chains in the Genus database with same CATH topology
3QI0A 1JTDB 4L1MA 4DNUA 4O2WA 3KCIA 3MVDK 4NAAA 3OF7A 4DNVA 4DNWA 4JHNA 1A12A 4JHPC 4NBMA 4NC4A 3QHYB 4QAMA 1I2MB 4D9SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QI0 A;  1JTD B;  4L1M A;  4DNU A;  4O2W A;  3KCI A;  3MVD K;  4NAA A;  3OF7 A;  4DNV A;  4DNW A;  4JHN A;  1A12 A;  4JHP C;  4NBM A;  4NC4 A;  3QHY B;  4QAM A;  1I2M B;  4D9S A; 
#chains in the Genus database with same CATH topology
 3O4G A;  2VDQ A;  4PBY A;  2OK4 A;  4L1M A;  4A0B B;  4G56 B;  4PBZ A;  5EM2 B;  3NIF A;  1K3I A;  3A0F A;  4O02 A;  2JKX A;  4GQ2 P;  3FRX A;  4JSX C;  3SCY A;  4G1E A;  5TEE A;  1U8C A;  4O1Q D;  3IUN A;  2B5L A;  4L9O A;  5HE3 B;  2GNQ A;  1ERJ A;  2HKR A;  3O4J A;  3K6S A;  2P9I C;  1P22 A;  3SFZ A;  2GC7 A;  4ESG A;  2HU7 A;  2CNX A;  5GMK n;  2H3X A;  3DDU A;  1C9L A;  5SXM A;  4N14 A;  4A08 A;  3V7D B;  2VDM A;  3JZN A;  4J84 A;  4EWR A;  4A7J A;  4LG9 A;  5KDO B;  3NID A;  5IGQ A;  3NVN A;  1UTC A;  2AQ5 A;  4BCD A;  2EIE A;  4O3T B;  3SBR A;  4BP8 A;  2PBI B;  1NR0 A;  3T3P A;  5EML B;  4E54 A;  4J87 A;  3JPX A;  5I5M A;  3AL8 A;  4CI2 A;  3K26 A;  4QT8 A;  4A11 B;  4ZOX A;  3RMZ D;  4D0K A;  4BH6 A;  4J86 A;  5IJ7 E;  3EI4 B;  3UR4 A;  1I2M B;  2VDN A;  3KRW B;  3C75 H;  1FWX A;  3E0C A;  3IIY A;  1H2X A;  3RFG A;  3EMH A;  3MKQ A;  4O2W A;  2CE9 A;  2GC4 A;  3RN1 D;  2VDL A;  4MMY A;  3ODT A;  2OIZ A;  5IC7 A;  4Z7N A;  3EI2 B;  2YNN A;  3DWL C;  4MK0 B;  5C92 A;  3I8E A;  1T2X A;  1GOF A;  4WK0 A;  2H9L A;  5C2V B;  3SMR A;  2G99 A;  2H6Q A;  3BG0 A;  4OWR A;  4UM8 A;  4A0A B;  2UZX B;  4PXW A;  2CO0 A;  1JV2 A;  3IJ1 A;  4ES0 A;  5EMM B;  3JB9 L;  5H1M A;  1GOH A;  4NAA A;  1UOP A;  2XE4 A;  5FKR A;  1JMZ B;  1VE7 A;  5TF2 A;  2W18 A;  1H2W A;  4BCC A;  4Z7Q A;  4Y7R A;  4WJK A;  3OKT A;  2VDO A;  3AFC A;  1A12 A;  4R7A B;  4BP9 A;  3OKW A;  4QQE A;  3MUO A;  3IJC A;  2QZP A;  3ZDX A;  2VC2 A;  4GGC A;  2OK6 A;  4FA9 D;  2O9K A;  4PSX B;  1H2Y A;  3C5M A;  2OVP B;  2PM9 A;  4FWW A;  3ZE1 A;  4J0X A;  2OVQ B;  4X60 B;  3RSE C;  2HYE A;  2CN2 A;  5M5S A;  4JSN C;  3F3F A;  2XDW A;  2YMU A;  3IUM A;  3SBQ A;  1K32 A;  1PGU A;  2HKM A;  3ZDY A;  4QRJ A;  3I8C A;  3FCS A;  4QL1 A;  3CIK B;  3V9F A;  5IT9 g;  3EG6 A;  3J80 g;  5I5I A;  4L3H D;  4L3G D;  2YB8 B;  5IGO A;  2QXV A;  4GZ8 A;  2Z2P A;  4Z8L A;  4DNU A;  3C99 A;  3VI3 A;  2IUP A;  3MKS B;  2OVR B;  3PVU B;  2P9U C;  3RLM D;  5HYN B;  3T3M A;  3CFV A;  1VYH C;  3CFS B;  4UI9 R;  5JWZ A;  4A08 B;  3EI3 A;  1VE6 A;  2P9K C;  5C2W B;  3SHF A;  3HFQ A;  1O6F A;  5EMK B;  4GM9 A;  1E5T A;  3OL2 A;  3UVK A;  2B4E A;  4UM9 A;  3PSL A;  3P4F A;  4CZX A;  4E54 B;  4Y5R D;  3AL8 B;  3N0D A;  2YNO A;  4JSV C;  1MDA H;  2OJY A;  2QR5 A;  4BCB A;  5CYK A;  1C9I A;  4RE5 A;  4GMB A;  5CXB A;  5A2Q g;  4NBM A;  1UOO A;  5EAR A;  5TDH B;  4J73 A;  4K3I D;  2P9P C;  4AX4 A;  1U2V C;  3OTT A;  4J78 A;  2P9S C;  2VDK A;  3KRX B;  1R5M A;  2XZG A;  4IRZ A;  3L4O D;  4AMZ A;  4J82 A;  4CC9 A;  2IUQ A;  4CY5 A;  3NVQ A;  3EQ7 A;  2IWF A;  2VDR A;  1K8K C;  2EBS A;  5C9Z B;  2QC5 A;  1N6E A;  1JMX B;  1U4C A;  1GP2 B;  1BPO A;  4ZOZ A;  3JRO A;  5EAP A;  5EAL A;  5M5U A;  3AL9 A;  1XKS A;  2HJ4 A;  4GGD A;  4E5Z A;  2BBK H;  3SXT D;  4BUJ C;  2H9N A;  3QI0 A;  4GQ1 A;  2YBA A;  1TBG A;  4X63 B;  2H6K A;  4O3U B;  2EID A;  2J57 G;  3V4P A;  3L4M D;  4PSW B;  4FA4 D;  4J8G A;  3PSC B;  2H47 A;  4J81 A;  3ZE0 A;  1PEV A;  5AFU 3;  1VZ3 A;  3GD1 I;  4A09 B;  1YFQ A;  3JAM g;  4DNW A;  2AGY A;  2WQ8 A;  3IJ0 A;  2PM9 B;  2YNP A;  2MTA H;  1RI6 A;  4IA9 A;  4NC4 A;  1N6D A;  4U7A A;  3F3G A;  3AH8 B;  4X3E A;  2VZ3 A;  3OKY A;  4J77 A;  1O6G A;  4FAV D;  3ZWL B;  3MZK A;  4ERQ A;  5CXC A;  1QFM A;  5K1C C;  1JTD B;  4ZOY A;  2PM6 B;  3MVD K;  3F3P A;  3UVL A;  4WK4 A;  3I7K A;  3BWS A;  3C9C A;  3ULE C;  2HU8 A;  5FKQ A;  1UOQ A;  3IIW A;  1A0R B;  1TYE A;  1JJU B;  3EWE A;  3ZE2 A;  1GXR A;  4JT6 C;  1YR2 A;  3IUR A;  3K27 A;  2HXC A;  1PI6 A;  1QFS A;  3IVM A;  2TRC B;  3QHY B;  4FAN D;  2PM7 B;  2EIC A;  2XL2 A;  2VZ1 A;  2IAA A;  3SBP A;  3IUJ A;  4TZ4 A;  4ERZ A;  3NIG A;  5GSA A;  3V4V A;  3I7L A;  3SLE D;  3EI3 B;  3VA6 A;  3I89 A;  2I3S A;  3UVM A;  2CO0 C;  2HJB A;  1GOG A;  3GFC A;  4JXM A;  5HQG A;  3PE7 A;  4DNV A;  5K19 A;  3RFH A;  3SVW D;  3OL2 B;  3RRM C;  2H9P A;  4FB1 D;  2H13 A;  4D6V A;  3B7F A;  4CY3 A;  5HDB A;  5B4W A;  4A2M A;  2AH1 A;  4G1M A;  5FLX g;  5H17 A;  3FGB A;  5CYK B;  4D9S A;  4RE6 A;  3FCU A;  2I0R A;  5HE2 B;  4AN1 A;  2J55 H;  4AOW A;  3EI1 A;  3UKR C;  5CXB B;  1VZ2 A;  4PNK B;  4FA5 D;  2B5M A;  3KCI A;  3IJE A;  3V5W B;  2XYI A;  2AGW A;  2I0S A;  5HE1 B;  3GRE A;  1L0Q A;  1M1X A;  2P9L C;  3MMY A;  3DM0 A;  4AMY A;  1Q47 A;  5M5V A;  2AGZ A;  3UVO A;  3PXS D;  1OLZ A;  2HU5 A;  5E6S A;  1SQ9 A;  4KFM B;  1MG2 A;  5E6R A;  1XHM A;  4IMM A;  4Z7O A;  4XEI C;  2AGX A;  4J79 A;  4A0B A;  5THA A;  5EM2 A;  2Z2N A;  5FFG A;  3UKU C;  3O4I A;  4CZV A;  3MXX A;  1B9Y A;  4QAM A;  4OZU A;  2B5N A;  2IWK A;  2P9N C;  3VI4 A;  5M5T A;  2Q7Q A;  3DXM C;  1SQJ A;  5AJA A;  4J0W A;  4K3J B;  1S4U X;  2BCJ B;  3I7P A;  3OF7 A;  4E5Z B;  3O4H A;  1L5G A;  3I7H A;  4GM8 A;  1H2Z A;  4CI1 A;  3SN6 B;  1GG2 B;  3DSM A;  4CZY A;  4GM3 A;  3BG1 A;  4LGN A;  2J56 H;  4JD2 C;  2IUV A;  1B9X A;  3ORV D;  1SHY B;  4GGA A;  3SJL D;  1E8M A;  3DXK C;  2CN3 A;  4HDJ A;  2EIB A;  4MMZ A;  4JT5 C;  4JSP C;  4H5J A;  5HE0 B;  1GOT B;  2BKL A;  4XYI A;  5AMS A;  4ZN4 A;  3PXW D;  3UVN A;  2I0T A;  3GC3 B;  4CI8 A;  3OKY B;  4CY1 A;  4A11 A;  3EU7 A;  4FA1 D;  5CXC B;  5H14 A;  4CY2 A;  1JOF A;  3EI4 A;  4PC0 A;  3IUL A;  4JHN A;  3PVW B;  3JZG A;  3FM0 A;  4YVD A;  4GQB B;  5FQD A;  3NVX A;  4BL0 A;  1E8N A;  1NEX B;  5I5J A;  3W15 A;  3JRP A;  4G55 A;  5TEF A;  5M61 A;  3IUQ A;  2AGL A;  3JZH A;  2Z2O A;  5IJ8 E;  1PBY B;  4ERY A;  2XU7 A;  1OMW B;  3VGZ A;  5FKT A;  4MMX A;  4X61 B;  2H6N A;  4AN0 A;  3EI2 A;  5FA5 B;  2H14 A;  4NEN A;  5E6U A;  3RN0 D;  3K71 A;  2H9M A;  4A2L A;  3SWS D;  1N6F A;  3J81 g;  4I79 A;  3IKO A;  4A0A A;  3I7O A;  3I2N A;  5C86 A;  5FKS A;  4CI3 A;  3EQ8 A;  4U1E I;  4ZOV A;  2G9A A;  5GXI A;  4NSX A;  5EMJ B;  1MG3 A;  4A09 A;  3PXT D;  3MUN A;  2H68 A;  1TYQ C;  4LG8 A;  3K72 A;  2IUR A;  1XIP A;  4FHL A;  2AH0 A;  3ZDZ A;  2HES X;  4AEZ A;  3U4Y A;  4WK2 A;  5M5R A;  4J8B A;  3EQ9 A;  3N0E A;  3OW8 A;  3EI1 B;  2CE8 A;  3MZL A;  4O45 A;  2VDP A;  4JHP C;  3I7N A;  5FXY A;  5EAM A;  1QNI A;  4L1Q D;  5FFO A;  4H5I A;  4O9D A;  4XYH A;  3VH0 A;  5GXH A;  2XL3 A;  2UZY B;  2I3T A; 
#chains in the Genus database with same CATH homology
 3QI0 A;  1JTD B;  4L1M A;  4DNU A;  4O2W A;  3KCI A;  3MVD K;  4NAA A;  3OF7 A;  4DNV A;  4DNW A;  4JHN A;  1A12 A;  4JHP C;  4NBM A;  4NC4 A;  3QHY B;  4QAM A;  1I2M B;  4D9S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...