4L1MA

Structure of the first rcc1-like domain of herc2
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
363
structure length
358
Chain Sequence
LQEVIGWGLIGWKYGPIQCEGLANLGVTQIACAEKRFLILSRNGRVYTQAYNSDTLAPQLVQGLASRNIVKIAAHSDGHHYLALAATGEVYSWGCGDGGRLGHGDTVPLEEPKVISAFSGKQAGKHVVHIACGSTYSAAITAEGELYTWGRGNYGRLGHGSSEDEAIPMLVAGLKGLKVIDVACGSGDAQTLAVTENGQVWSWGDGDYGKLGRGGSDGCKTPKLIEKLQDLDVVKVRCGSQFSIALTKDGQVYSWGKGDNQRLGHGTEEHVRYPKLLEGLQGKKVIDVAAGSTHCLALTEDSEVHSWGSNDQCQHFDTLRVTKPEPAALPGLDTKHIVGIACGPAQSFAWSSCSEWSI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ligase
molecule keywords E3 ubiquitin-protein ligase HERC2
publication title Structure of the first RCC1-like domain of HERC2
rcsb
source organism Homo sapiens
total genus 93
structure length 358
sequence length 363
chains with identical sequence B, C
ec nomenclature ec 2.3.2.26: HECT-type E3 ubiquitin transferase.
pdb deposition date 2013-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00415 RCC1 Regulator of chromosome condensation (RCC1) repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.30 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Regulator of chromosome condensation 1/beta-lactamase-inhibitor protein II 4l1mA00
3QI0A 4JHNA 4NAAA 3KCIA 4O2WA 1JTDB 4NBMA 4D9SA 4NC4A 4DNWA 4QAMA 4L1MA 4DNUA 3QHYB 4DNVA 3OF7A 1A12A 3MVDK 4JHPC 1I2MB
chains in the Genus database with same CATH superfamily
3IVMA 3IJEA 3FGBA 2OVPB 3AL8A 3PXTD 4J77A 3EI4A 4ZN4A 4A09B 1QFMA 2VDRA 4BCCA 3KRWB 3RN1D 1OMWB 3EI2B 5FKRA 3CFSB 3PE7A 4GM9A 2B5MA 2H9MA 5SXMA 2VDMA 3EWEA 4CZYA 1E8NA 4LG8A 4U7AA 4ERYA 1B9XA 3CFVA 5KDOB 5CYKA 2P9PC 3NVXA 3SHFA 1L0QA 2XZGA 3QI0A 2AGXA 1PEVA 5IJ7E 4UM9A 1GP2B 5EM2A 5M5SA 3PVWB 4I79A 3CIKB 3F3GA 2IURA 2BCJB 5M5UA 1U8CA 4BL0A 4G55A 1PI6A 4JXMA 3MZKA 4ERZA 5HYNB 4E54B 4A2MA 3NVNA 5EAMA 1N6DA 4PXWA 3RN0D 4WK0A 4MMXA 3ZDYA 5I5MA 1H2XA 5EMKB 5CXCA 1O6GA 1YR2A 5C92A 5E6SA 4A0AA 1PGUA 3I7OA 4GM3A 4R7AB 2AH1A 3I89A 5FFGA 4JSNC 4J8BA 5EMMB 1GOFA 2VC2A 2H47A 4J8GA 4CC9A 3E0CA 3EQ9A 4O02A 3OW8A 4J84A 1OLZA 5C2WB 1RI6A 1S4UX 3EI3A 5C2VB 2CO0C 3RLMD 3ULEC 3P4FA 5HE3B 2H9PA 2G99A 3I2NA 4AOWA 4AEZA 3I8EA 1NR0A 1A0RB 2G9AA 4K3ID 2EICA 3PXSD 3SBPA 5GXHA 4K3JB 3C5MA 2P9LC 2OK6A 3I7NA 3OKWA 3ORVD 1Q47A 4AX4A 2EIDA 2I0RA 3IULA 1P22A 4O3UB 4CY3A 1FWXA 3EI1A 4QL1A 3B7FA 1TYQC 4PBZA 3GREA 2YBAA 3ODTA 4A11A 1K32A 2CE8A 5IGQA 3A0FA 4JHPC 3ZE1A 4XEIC 4ERQA 5EMJB 4Y5RD 4JT5C 2Q7QA 1O6FA 5FLXg 2H14A 4MMYA 3V9FA 2W18A 5TEEA 2MTAH 2IUQA 2IWKA 3NVQA 4QQEA 1YFQA 1JMZB 4BH6A 4ESGA 1GOHA 4PSWB 3UVKA 3IJCA 1PBYB 3V5WB 4A08B 2EIEA 3HFQA 2XL3A 4CZXA 4E5ZA 4QAMA 1SQJA 1U2VC 1C9IA 5FXYA 4AMZA 4X61B 3L4MD 3BG0A 4CZVA 4E54A 2I3SA 3J81g 2AQ5A 4BUJC 2IAAA 5A2Qg 3VH0A 2B4EA 5M5RA 2VDOA 5GSAA 1JOFA 1GOTB 1L5GA 1TYEA 2GNQA 3MKQA 1K8KC 2Z2OA 3I7PA 1JMXB 1C9LA 3BWSA 2VDKA 4BP8A 3O4HA 4GM8A 2AGYA 2VDNA 4J87A 3W15A 3IIYA 4J0WA 2VZ3A 4GGDA 5E6UA 3VGZA 3L4OD 2IUPA 4GQ2P 1T2XA 2B5NA 3J80g 2CO0A 3V4VA 3MKSB 4FA4D 4CI8A 3SFZA 2H6KA 1SHYB 3OKYB 5M5TA 3JB9L 2QC5A 3DM0A 2CNXA 4O3TB 2VZ1A 4A0BB 5TEFA 2H13A 2XYIA 2I0SA 2HJ4A 3NIDA 4AN1A 5B4WA 1N6FA 1VZ3A 4O45A 3GC3B 1H2WA 4GGCA 3JRPA 1A12A 1E5TA 3NIGA 3RMZD 4EWRA 3C75H 1B9YA 2HESX 1XIPA 3T3MA 5CXBB 3IIWA 3I8CA 2YB8B 4H5JA 2QXVA 3ZE0A 3PSLA 4MMZA 5EMLB 3K71A 2YMUA 3SWSD 3SBRA 2HU8A 5HE0B 5AMSA 3KRXB 3K72A 3U4YA 5I5IA 4Z8LA 4J78A 3FM0A 5C86A 4RE6A 4HDJA 1GG2B 4FA1D 3SVWD 4A08A 4Y7RA 5FKSA 2I3TA 4CI2A 4G1EA 1JV2A 3JZHA 3SXTD 3SJLD 3SLED 4ZOVA 4L9OA 2J56H 4ZOZA 4GQ1A 3AL8B 5GMKn 4ZOXA 4J82A 2OIZA 3UKRC 3EI4B 4OWRA 4L3GD 2WQ8A 2XL2A 5H14A 2HYEA 2YNNA 4D9SA 3SBQA 1TBGA 4J81A 3UKUC 4A09A 2H3XA 3EG6A 3EI2A 3NIFA 4Z7OA 1UOOA 4J0XA 4MK0B 1JJUB 1UTCA 2J57G 1U4CA 5CYKB 3DXMC 3PVUB 4WK4A 2PM6B 2H9LA 2XE4A 3MXXA 5EM2B 3V7DB 5C9ZB 2UZYB 4NENA 2J55H 2JKXA 2P9KC 4H5IA 3FRXA 3VI4A 3MZLA 3C99A 3EQ8A 2P9UC 5TDHB 2UZXB 1QNIA 2OVQB 2EIBA 5E6RA 2PBIB 4L1MA 1QFSA 4WJKA 3SCYA 2AGWA 3OL2B 1VE6A 5EARA 4O9DA 5HE2B 5FA5B 3MVDK 4O1QD 4Z7QA 5JWZA 2GC4A 4IRZA 5FFOA 1H2YA 5M5VA 3GFCA 5IGOA 5CXCB 1UOQA 2PM9B 4A0AB 2PM7B 3UR4A 3AFCA 2HKRA 4FHLA 3K26A 5K19A 4L1QD 2P9IC 4FWWA 4FA9D 4IA9A 1VZ2A 2H68A 2Z2NA 2I0TA 4GGAA 2HXCA 2OJYA 4Z7NA 1N6EA 2BKLA 4LG9A 4X63B 3VA6A 3F3FA 4LGNA 4CY1A 4DNVA 2HJBA 2VDPA 2O9KA 2TRCB 3JZGA 1I2MB 2IWFA 3I7HA 1XKSA 5IC7A 1H2ZA 1UOPA 3DDUA 5H17A 4CI3A 2AGLA 3ZDZA 3O4JA 3SMRA 5FQDA 1MG2A 1NEXB 4QT8A 5AJAA 4NAAA 3EI1B 4NBMA 2HU7A 1SQ9A 2CE9A 2VDLA 5H1MA 4A11B 4X60B 3PSCB 3IJ0A 3JAMg 4KFMB 4AN0A 3JROA 2CN3A 5HQGA 4CY2A 4FAVD 3FCUA 4IMMA 4UI9R 3OKTA 3EU7A 4OZUA 3ZWLB 4BP9A 3RFHA 4GMBA 3BG1A 2P9NC 3IUMA 2AGZA 1MG3A 3N0EA 3IUJA 2HU5A 3C9CA 4E5ZB 2XU7A 4JHNA 3KCIA 2Z2PA 3EMHA 4A2LA 4JT6C 5M61A 4JSXC 4WK2A 5I5JA 3AL9A 3QHYB 4J73A 3OF7A 4N14A 3O4GA 1M1XA 3K27A 3OL2A 3UVNA 4A7JA 3I7KA 3IUQA 3GD1I 3MUNA 3I7LA 4TZ4A 4X3EA 4XYIA 1E8MA 3JPXA 1XHMA 3RFGA 2PM9A 3MUOA 4BCDA 3PXWD 4PBYA 2YNPA 1GXRA 4JD2C 5AFU3 2CN2A 2B5LA 4RE5A 4DNUA 4ZOYA 4CI1A 4GZ8A 4JSPC 5FKQA 3F3PA 5EAPA 4GQBB 1VE7A 2OVRB 2P9SC 4PNKB 5FKTA 5IT9g 4FAND 1R5MA 1GOGA 2QR5A 3O4IA 3IKOA 3DXKC 4NSXA 4FB1D 4J86A 4D6VA 3OKYA 4D0KA 3IJ1A 3MMYA 1VYHC 2VDQA 4J79A 3ZE2A 3UVOA 4A0BA 3SN6B 4PSXB 2BBKH 2OK4A 4O2WA 5THAA 5HE1B 1JTDB 4JSVC 5EALA 3V4PA 1K3IA 4DNWA 3UVLA 5K1CC 4L3HD 4G1MA 4YVDA 1MDAH 3EQ7A 5HDBA 4PC0A 4CY5A 4U1EI 3ZDXA 3RRMC 4XYHA 4G56B 2GC7A 4FA5D 4BCBA 2HKMA 5CXBA 5IJ8E 1BPOA 2H9NA 4AMYA 2H6NA 3DWLC 4QRJA 2AH0A 3IURA 1ERJA 2EBSA 3IUNA 5TF2A 3RSEC 3VI3A 3UVMA 3T3PA 3AH8B 4NC4A 3OTTA 4UM8A 3DSMA 4ES0A 2QZPA 3EI3B 5GXIA 2IUVA 2XDWA 2H6QA 3K6SA 3JZNA 2YNOA 3N0DA 3FCSA
chains in the Genus database with same CATH topology
3QI0A 4JHNA 4NAAA 3KCIA 4O2WA 1JTDB 4NBMA 4D9SA 4NC4A 4DNWA 4QAMA 4L1MA 4DNUA 3QHYB 4DNVA 3OF7A 1A12A 3MVDK 4JHPC 1I2MB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QI0 A;  4JHN A;  4NAA A;  3KCI A;  4O2W A;  1JTD B;  4NBM A;  4D9S A;  4NC4 A;  4DNW A;  4QAM A;  4L1M A;  4DNU A;  3QHY B;  4DNV A;  3OF7 A;  1A12 A;  3MVD K;  4JHP C;  1I2M B; 
#chains in the Genus database with same CATH topology
 3IVM A;  3IJE A;  3FGB A;  2OVP B;  3AL8 A;  3PXT D;  4J77 A;  3EI4 A;  4ZN4 A;  4A09 B;  1QFM A;  2VDR A;  4BCC A;  3KRW B;  3RN1 D;  1OMW B;  3EI2 B;  5FKR A;  3CFS B;  3PE7 A;  4GM9 A;  2B5M A;  2H9M A;  5SXM A;  2VDM A;  3EWE A;  4CZY A;  1E8N A;  4LG8 A;  4U7A A;  4ERY A;  1B9X A;  3CFV A;  5KDO B;  5CYK A;  2P9P C;  3NVX A;  3SHF A;  1L0Q A;  2XZG A;  3QI0 A;  2AGX A;  1PEV A;  5IJ7 E;  4UM9 A;  1GP2 B;  5EM2 A;  5M5S A;  3PVW B;  4I79 A;  3CIK B;  3F3G A;  2IUR A;  2BCJ B;  5M5U A;  1U8C A;  4BL0 A;  4G55 A;  1PI6 A;  4JXM A;  3MZK A;  4ERZ A;  5HYN B;  4E54 B;  4A2M A;  3NVN A;  5EAM A;  1N6D A;  4PXW A;  3RN0 D;  4WK0 A;  4MMX A;  3ZDY A;  5I5M A;  1H2X A;  5EMK B;  5CXC A;  1O6G A;  1YR2 A;  5C92 A;  5E6S A;  4A0A A;  1PGU A;  3I7O A;  4GM3 A;  4R7A B;  2AH1 A;  3I89 A;  5FFG A;  4JSN C;  4J8B A;  5EMM B;  1GOF A;  2VC2 A;  2H47 A;  4J8G A;  4CC9 A;  3E0C A;  3EQ9 A;  4O02 A;  3OW8 A;  4J84 A;  1OLZ A;  5C2W B;  1RI6 A;  1S4U X;  3EI3 A;  5C2V B;  2CO0 C;  3RLM D;  3ULE C;  3P4F A;  5HE3 B;  2H9P A;  2G99 A;  3I2N A;  4AOW A;  4AEZ A;  3I8E A;  1NR0 A;  1A0R B;  2G9A A;  4K3I D;  2EIC A;  3PXS D;  3SBP A;  5GXH A;  4K3J B;  3C5M A;  2P9L C;  2OK6 A;  3I7N A;  3OKW A;  3ORV D;  1Q47 A;  4AX4 A;  2EID A;  2I0R A;  3IUL A;  1P22 A;  4O3U B;  4CY3 A;  1FWX A;  3EI1 A;  4QL1 A;  3B7F A;  1TYQ C;  4PBZ A;  3GRE A;  2YBA A;  3ODT A;  4A11 A;  1K32 A;  2CE8 A;  5IGQ A;  3A0F A;  4JHP C;  3ZE1 A;  4XEI C;  4ERQ A;  5EMJ B;  4Y5R D;  4JT5 C;  2Q7Q A;  1O6F A;  5FLX g;  2H14 A;  4MMY A;  3V9F A;  2W18 A;  5TEE A;  2MTA H;  2IUQ A;  2IWK A;  3NVQ A;  4QQE A;  1YFQ A;  1JMZ B;  4BH6 A;  4ESG A;  1GOH A;  4PSW B;  3UVK A;  3IJC A;  1PBY B;  3V5W B;  4A08 B;  2EIE A;  3HFQ A;  2XL3 A;  4CZX A;  4E5Z A;  4QAM A;  1SQJ A;  1U2V C;  1C9I A;  5FXY A;  4AMZ A;  4X61 B;  3L4M D;  3BG0 A;  4CZV A;  4E54 A;  2I3S A;  3J81 g;  2AQ5 A;  4BUJ C;  2IAA A;  5A2Q g;  3VH0 A;  2B4E A;  5M5R A;  2VDO A;  5GSA A;  1JOF A;  1GOT B;  1L5G A;  1TYE A;  2GNQ A;  3MKQ A;  1K8K C;  2Z2O A;  3I7P A;  1JMX B;  1C9L A;  3BWS A;  2VDK A;  4BP8 A;  3O4H A;  4GM8 A;  2AGY A;  2VDN A;  4J87 A;  3W15 A;  3IIY A;  4J0W A;  2VZ3 A;  4GGD A;  5E6U A;  3VGZ A;  3L4O D;  2IUP A;  4GQ2 P;  1T2X A;  2B5N A;  3J80 g;  2CO0 A;  3V4V A;  3MKS B;  4FA4 D;  4CI8 A;  3SFZ A;  2H6K A;  1SHY B;  3OKY B;  5M5T A;  3JB9 L;  2QC5 A;  3DM0 A;  2CNX A;  4O3T B;  2VZ1 A;  4A0B B;  5TEF A;  2H13 A;  2XYI A;  2I0S A;  2HJ4 A;  3NID A;  4AN1 A;  5B4W A;  1N6F A;  1VZ3 A;  4O45 A;  3GC3 B;  1H2W A;  4GGC A;  3JRP A;  1A12 A;  1E5T A;  3NIG A;  3RMZ D;  4EWR A;  3C75 H;  1B9Y A;  2HES X;  1XIP A;  3T3M A;  5CXB B;  3IIW A;  3I8C A;  2YB8 B;  4H5J A;  2QXV A;  3ZE0 A;  3PSL A;  4MMZ A;  5EML B;  3K71 A;  2YMU A;  3SWS D;  3SBR A;  2HU8 A;  5HE0 B;  5AMS A;  3KRX B;  3K72 A;  3U4Y A;  5I5I A;  4Z8L A;  4J78 A;  3FM0 A;  5C86 A;  4RE6 A;  4HDJ A;  1GG2 B;  4FA1 D;  3SVW D;  4A08 A;  4Y7R A;  5FKS A;  2I3T A;  4CI2 A;  4G1E A;  1JV2 A;  3JZH A;  3SXT D;  3SJL D;  3SLE D;  4ZOV A;  4L9O A;  2J56 H;  4ZOZ A;  4GQ1 A;  3AL8 B;  5GMK n;  4ZOX A;  4J82 A;  2OIZ A;  3UKR C;  3EI4 B;  4OWR A;  4L3G D;  2WQ8 A;  2XL2 A;  5H14 A;  2HYE A;  2YNN A;  4D9S A;  3SBQ A;  1TBG A;  4J81 A;  3UKU C;  4A09 A;  2H3X A;  3EG6 A;  3EI2 A;  3NIF A;  4Z7O A;  1UOO A;  4J0X A;  4MK0 B;  1JJU B;  1UTC A;  2J57 G;  1U4C A;  5CYK B;  3DXM C;  3PVU B;  4WK4 A;  2PM6 B;  2H9L A;  2XE4 A;  3MXX A;  5EM2 B;  3V7D B;  5C9Z B;  2UZY B;  4NEN A;  2J55 H;  2JKX A;  2P9K C;  4H5I A;  3FRX A;  3VI4 A;  3MZL A;  3C99 A;  3EQ8 A;  2P9U C;  5TDH B;  2UZX B;  1QNI A;  2OVQ B;  2EIB A;  5E6R A;  2PBI B;  4L1M A;  1QFS A;  4WJK A;  3SCY A;  2AGW A;  3OL2 B;  1VE6 A;  5EAR A;  4O9D A;  5HE2 B;  5FA5 B;  3MVD K;  4O1Q D;  4Z7Q A;  5JWZ A;  2GC4 A;  4IRZ A;  5FFO A;  1H2Y A;  5M5V A;  3GFC A;  5IGO A;  5CXC B;  1UOQ A;  2PM9 B;  4A0A B;  2PM7 B;  3UR4 A;  3AFC A;  2HKR A;  4FHL A;  3K26 A;  5K19 A;  4L1Q D;  2P9I C;  4FWW A;  4FA9 D;  4IA9 A;  1VZ2 A;  2H68 A;  2Z2N A;  2I0T A;  4GGA A;  2HXC A;  2OJY A;  4Z7N A;  1N6E A;  2BKL A;  4LG9 A;  4X63 B;  3VA6 A;  3F3F A;  4LGN A;  4CY1 A;  4DNV A;  2HJB A;  2VDP A;  2O9K A;  2TRC B;  3JZG A;  1I2M B;  2IWF A;  3I7H A;  1XKS A;  5IC7 A;  1H2Z A;  1UOP A;  3DDU A;  5H17 A;  4CI3 A;  2AGL A;  3ZDZ A;  3O4J A;  3SMR A;  5FQD A;  1MG2 A;  1NEX B;  4QT8 A;  5AJA A;  4NAA A;  3EI1 B;  4NBM A;  2HU7 A;  1SQ9 A;  2CE9 A;  2VDL A;  5H1M A;  4A11 B;  4X60 B;  3PSC B;  3IJ0 A;  3JAM g;  4KFM B;  4AN0 A;  3JRO A;  2CN3 A;  5HQG A;  4CY2 A;  4FAV D;  3FCU A;  4IMM A;  4UI9 R;  3OKT A;  3EU7 A;  4OZU A;  3ZWL B;  4BP9 A;  3RFH A;  4GMB A;  3BG1 A;  2P9N C;  3IUM A;  2AGZ A;  1MG3 A;  3N0E A;  3IUJ A;  2HU5 A;  3C9C A;  4E5Z B;  2XU7 A;  4JHN A;  3KCI A;  2Z2P A;  3EMH A;  4A2L A;  4JT6 C;  5M61 A;  4JSX C;  4WK2 A;  5I5J A;  3AL9 A;  3QHY B;  4J73 A;  3OF7 A;  4N14 A;  3O4G A;  1M1X A;  3K27 A;  3OL2 A;  3UVN A;  4A7J A;  3I7K A;  3IUQ A;  3GD1 I;  3MUN A;  3I7L A;  4TZ4 A;  4X3E A;  4XYI A;  1E8M A;  3JPX A;  1XHM A;  3RFG A;  2PM9 A;  3MUO A;  4BCD A;  3PXW D;  4PBY A;  2YNP A;  1GXR A;  4JD2 C;  5AFU 3;  2CN2 A;  2B5L A;  4RE5 A;  4DNU A;  4ZOY A;  4CI1 A;  4GZ8 A;  4JSP C;  5FKQ A;  3F3P A;  5EAP A;  4GQB B;  1VE7 A;  2OVR B;  2P9S C;  4PNK B;  5FKT A;  5IT9 g;  4FAN D;  1R5M A;  1GOG A;  2QR5 A;  3O4I A;  3IKO A;  3DXK C;  4NSX A;  4FB1 D;  4J86 A;  4D6V A;  3OKY A;  4D0K A;  3IJ1 A;  3MMY A;  1VYH C;  2VDQ A;  4J79 A;  3ZE2 A;  3UVO A;  4A0B A;  3SN6 B;  4PSX B;  2BBK H;  2OK4 A;  4O2W A;  5THA A;  5HE1 B;  1JTD B;  4JSV C;  5EAL A;  3V4P A;  1K3I A;  4DNW A;  3UVL A;  5K1C C;  4L3H D;  4G1M A;  4YVD A;  1MDA H;  3EQ7 A;  5HDB A;  4PC0 A;  4CY5 A;  4U1E I;  3ZDX A;  3RRM C;  4XYH A;  4G56 B;  2GC7 A;  4FA5 D;  4BCB A;  2HKM A;  5CXB A;  5IJ8 E;  1BPO A;  2H9N A;  4AMY A;  2H6N A;  3DWL C;  4QRJ A;  2AH0 A;  3IUR A;  1ERJ A;  2EBS A;  3IUN A;  5TF2 A;  3RSE C;  3VI3 A;  3UVM A;  3T3P A;  3AH8 B;  4NC4 A;  3OTT A;  4UM8 A;  3DSM A;  4ES0 A;  2QZP A;  3EI3 B;  5GXI A;  2IUV A;  2XDW A;  2H6Q A;  3K6S A;  3JZN A;  2YNO A;  3N0D A;  3FCS A; 
#chains in the Genus database with same CATH homology
 3QI0 A;  4JHN A;  4NAA A;  3KCI A;  4O2W A;  1JTD B;  4NBM A;  4D9S A;  4NC4 A;  4DNW A;  4QAM A;  4L1M A;  4DNU A;  3QHY B;  4DNV A;  3OF7 A;  1A12 A;  3MVD K;  4JHP C;  1I2M B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...