3CFSB

Structural basis of the interaction of rbap46/rbap48 with histone h4
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
404
structure length
383
Chain Sequence
FEDTVEERVINEEYKIWKKNTPFLYDLVMTHALQWPSLTVQWLPEVTKPEGKDYALHWLVLGTHTSDEQNHLVVARVHIPNDDTGKIECEIKINHEGEVNRARYMPQNPHIIATKTPSSDVLVFDYTKHPAKPDPSGECNPDLRLRGHQKEGYGLSWNSNLSGHLLSASDDHTVCLWDINAGPKEGKIVDAKAIFTGHSAVVEDVAWHLLHESLFGSVADDQKLMIWDTRSNTTSKPSHLVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHTFESHKDEIFQVHWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQIWQMAENIYND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone-binding protein RBBP7
publication title Structural Basis for the Recognition of Histone H4 by the Histone-Chaperone RbAp46.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Histone/chaperone
total genus 88
structure length 383
sequence length 404
ec nomenclature
pdb deposition date 2008-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00400 WD40 WD domain, G-beta repeat
B PF12265 CAF1C_H4-bd Histone-binding protein RBBP4 or subunit C of CAF1 complex
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3cfsB00
5IC7A 1XKSA 2J56H 4HDJA 5CXCB 4A0BB 2H13A 4A2LA 3GREA 3EI4B 4GM9A 2BBKH 4QL1A 5IT9g 4J86A 1GXRA 3UKUC 5B4WA 4XEIC 2W18A 5FLXg 4FA1D 4LG9A 1FWXA 4UI9R 5GXHA 4GZ8A 3SCYA 3IIYA 1XHMA 2BCJB 3RN0D 4J73A 3C5MA 4L9OA 5AMSA 2H6QA 2H9PA 3AH8B 4A11B 4Y5RD 3EI2A 5EMJB 5GMKn 2O9KA 3SFZA 1U4CA 3JROA 3AL9A 4O1QD 5A2Qg 4IMMA 2GC7A 3I7OA 2EBSA 1PEVA 2IUVA 4MK0B 4GQBB 3DWLC 3AL8B 1SQ9A 4JSPC 4TZ4A 3RRMC 3RSEC 3SBRA 4CZVA 4NSXA 2CNXA 4J0XA 3OTTA 4L3HD 4XYIA 3EI1B 3IIWA 3UVMA 4J78A 2HESX 3MZLA 3N0DA 1PBYB 3UVOA 4GGCA 2AGWA 4X61B 3E0CA 3JPXA 4PBZA 5CXCA 4A0BA 3L4OD 4AEZA 2HKMA 2Q7QA 3SMRA 3EI4A 3PVWB 1S4UX 3N0EA 5FKSA 3BG0A 2P9PC 4GGAA 5H1MA 2PBIB 3HFQA 4ES0A 2IAAA 5AFU3 4FB1D 2IWFA 3SXTD 2HKRA 3UKRC 3DM0A 2XL2A 4FHLA 5EMLB 4A2MA 2UZYB 2I0SA 5THAA 4FWWA 3PSCB 4J8BA 2GC4A 4QRJA 1L0QA 3IKOA 3PXTD 5I5JA 4O3UB 3MKSB 4OWRA 1VYHC 2Z2NA 4ERYA 3F3GA 2YNNA 4H5IA 3SLED 3EI1A 3VH0A 3GFCA 2AH1A 3AFCA 3JZHA 2P9IC 5IGQA 4Y7RA 2QC5A 3OKYB 1PI6A 1ERJA 5IJ8E 4D6VA 5FKRA 4AOWA 3IJ1A 4A7JA 4PSWB 1NR0A 5C2WB 2B4EA 4JSXC 3CFVA 3DXKC 3C9CA 3FRXA 2YMUA 5EM2B 1TYQC 4H5JA 4A09B 1P22A 3I2NA 2OVPB 4E54B 1SHYB 2CN2A 4J81A 4CY3A 1GOTB 3OW8A 2QXVA 2AGZA 3RLMD 2AGXA 4BUJC 1R5MA 2B5LA 3V7DB 5I5MA 2XU7A 1K32A 3NVQA 1JMXB 5CYKB 3VA6A 3RFGA 3EWEA 4O3TB 1GG2B 3A0FA 5FXYA 2PM9B 2I3TA 3I7HA 3MMYA 4J8GA 4J87A 3NVXA 3OL2B 3DXMC 2P9KC 2YNOA 3PVUB 5K19A 2HJ4A 3I8EA 4IA9A 3V5WB 3UVLA 3SBQA 2CO0A 2OK4A 4U1EI 3RMZD 2P9LC 1N6EA 2B5NA 1U2VC 2IURA 3OKYA 4LG8A 2HYEA 4FA4D 3KRXB 2G9AA 5C2VB 5EMMB 4GQ1A 3I7NA 4X3EA 3CFSB 2YBAA 4GM3A 5JWZA 5AJAA 2H9NA 5HE1B 2YNPA 3EI3B 5TF2A 4A09A 1OMWB 4A0AB 5H14A 1YFQA 5HE2B 5IGOA 1GP2B 2TRCB 4L3GD 1K8KC 5EALA 1JOFA 2OIZA 5CYKA 4BL0A 3I7PA 4A11A 3SHFA 4ERQA 4CZYA 3F3PA 4J79A 5C9ZB 3UVKA 3I8CA 5EMKB 3BWSA 4QT8A 2PM9A 2UZXB 5HE0B 4X63B 1B9YA 2AGYA 3OL2A 3OKTA 3C75H 5FA5B 3AL8A 3OKWA 5CXBB 4ZOZA 3MXXA 5TEEA 4K3ID 4K3JB 4I79A 2XYIA 3C99A 4FA9D 3MZKA 3PXWD 4GGDA 4ESGA 4CI3A 2AQ5A 3JZGA 4XYHA 2CO0C 3I7LA 4PNKB 1MG2A 4N14A 3IJ0A 4PBYA 4GQ2P 5TDHB 2Z2OA 4E5ZB 3PSLA 1MDAH 4CI8A 2P9NC 5FKTA 5EARA 3EI3A 4J84A 4KFMB 2GNQA 1N6FA 3BG1A 2I0RA 3EG6A 3U4YA 3SN6B 4FAVD 4PXWA 4OZUA 3SBPA 3UVNA 4CY1A 5H17A 3ZWLB 2B5MA 1JJUB 3PXSD 1Q47A 4FAND 3SWSD 3SVWD 3KRWB 4D0KA 3F3FA 3SJLD 5K1CC 2H47A 3JB9L 2H9MA 4QQEA 5GXIA 2H6KA 3NVNA 3I7KA 3RFHA 5HE3B 4ZOYA 4PSXB 5CXBA 5EAPA 2Z2PA 2PM7B 2OJYA 4ZOXA 3V9FA 1N6DA 3JAMg 2HJBA 3EU7A 4ZN4A 3PE7A 4FA5D 2OVQB 2P9SC 1SQJA 2CE9A 4CI1A 1XIPA 2IUQA 4YVDA 2MTAH 4ZOVA 2IWKA 5HYNB 4A08B 2I3SA 5FKQA 1MG3A 4E5ZA 3P4FA 1B9XA 5SXMA 5GSAA 3MKQA 4J77A 3J80g 3JZNA 2H68A 4PC0A 4R7AB 5EAMA 4U7AA 4JSVC 4L1QD 4CC9A 4JXMA 3L4MD 5EM2A 2OK6A 3ORVD 2HXCA 2XL3A 4E54A 1PGUA 3RN1D 4LGNA 4GMBA 2AGLA 3CIKB 1A0RB 4JT6C 3FM0A 4Z8LA 3FGBA 2J57G 3ULEC 1OLZA 4BH6A 2H6NA 4O9DA 5FQDA 5I5IA 2H9LA 2OVRB 3ODTA 4CY5A 2J55H 4O45A 3UR4A 2P9UC 4CI2A 2G99A 3I89A 3B7FA 2H14A 3EI2B 3JRPA 4J0WA 1RI6A 2CE8A 1NEXB 2CN3A 4A08A 1TBGA 4CZXA 2YB8B 5IJ7E 5KDOB 3DSMA 4EWRA 3W15A 3J81g 4JSNC 4JD2C 5TEFA 4ERZA 2I0TA 3EMHA 2H3XA 5HQGA 2IUPA 2AH0A 4G56B 4JT5C 4CY2A 1JMZB 1QNIA 4A0AA 4J82A 3IJCA 2PM6B 4GM8A 4X60B 3VGZA 3K26A 3K27A
chains in the Genus database with same CATH superfamily
2VC2A 5IC7A 3KCIA 1XKSA 2J56H 4HDJA 5CXCB 4A0BB 2H13A 3ZDYA 4A2LA 3GREA 3EI4B 4GM9A 2BBKH 4QL1A 4BCBA 5IT9g 4J86A 1GXRA 3UKUC 5B4WA 2VDPA 4XEIC 2W18A 5FLXg 4FA1D 4LG9A 1FWXA 4UI9R 5GXHA 4GZ8A 3SCYA 4NBMA 3IIYA 3IJEA 1XHMA 2BCJB 3RN0D 1E5TA 4J73A 3C5MA 4L9OA 5AMSA 2H6QA 2H9PA 3AH8B 4A11B 4Y5RD 4Z7NA 3EI2A 5EMJB 2HU8A 5GMKn 3EQ8A 2O9KA 3SFZA 1TYEA 1U4CA 3JROA 3AL9A 4O1QD 5A2Qg 4IMMA 2GC7A 2VZ1A 3I7OA 2EBSA 1PEVA 2IUVA 4MK0B 3O4GA 4GQBB 3DWLC 3AL8B 1SQ9A 4JSPC 4AN1A 1QFMA 4TZ4A 3RRMC 3RSEC 3SBRA 4CZVA 1UOPA 3MUOA 2CNXA 4L3HD 4J0XA 3OTTA 4NSXA 4XYIA 3EI1B 3IIWA 3UVMA 4J78A 2HESX 3MZLA 3N0DA 1PBYB 3ZE0A 3UVOA 4GGCA 2AGWA 4X61B 5E6RA 3E0CA 3JPXA 4PBZA 5CXCA 3K72A 4A0BA 3L4OD 4WK0A 4AEZA 2HKMA 2Q7QA 3SMRA 3EI4A 3PVWB 1K3IA 1GOGA 1S4UX 3N0EA 5FKSA 3BG0A 2P9PC 4GGAA 4L1MA 5H1MA 2PBIB 1O6GA 3HFQA 5C92A 4ES0A 2IAAA 5AFU3 3EQ7A 4FB1D 2IWFA 3SXTD 2HKRA 3UKRC 3DM0A 2XL2A 5M5VA 5HDBA 4FHLA 5C86A 5EMLB 3O4HA 4BCCA 4A2MA 2UZYB 4AX4A 4G1MA 4DNVA 3IVMA 3QI0A 2I0SA 1T2XA 3T3MA 3MUNA 5THAA 4FWWA 3PSCB 1A12A 4J8BA 2GC4A 3T3PA 4QRJA 1L0QA 3IKOA 4DNWA 3PXTD 5E6SA 4G1EA 5I5JA 4O3UB 3MKSB 4WJKA 4OWRA 1VYHC 2Z2NA 2JKXA 4MMYA 4ERYA 3F3GA 2YNNA 4H5IA 3SLED 3EI1A 5M5TA 3VH0A 3GFCA 1GOFA 2AH1A 3AFCA 3JZHA 2P9IC 5IGQA 4Y7RA 2QC5A 3OKYB 2VDOA 1PI6A 1ERJA 5IJ8E 4D6VA 2BKLA 5FKRA 4AOWA 3IJ1A 3ZDXA 1VZ2A 2VZ3A 4UM8A 4A7JA 1UOQA 4PSWB 1NR0A 5C2WB 2B4EA 4JSXC 3CFVA 3DXKC 3C9CA 3FRXA 3MVDK 3ZE1A 2YMUA 5EM2B 1TYQC 1VZ3A 4H5JA 4A09B 1P22A 3I2NA 2OVPB 4E54B 1SHYB 2CN2A 4J81A 4CY3A 1GOTB 2EIBA 3OW8A 2QXVA 2AGZA 3RLMD 2AGXA 4BUJC 1R5MA 2B5LA 3V7DB 5I5MA 2XU7A 1K32A 3NVQA 1JMXB 5CYKB 3VA6A 3RFGA 3EWEA 5M5UA 3FCUA 4O3TB 1GG2B 3A0FA 5FXYA 2PM9B 3DDUA 2I3TA 3I7HA 3MMYA 4J8GA 4J87A 4G55A 3NVXA 3OL2B 4NENA 3IUJA 3DXMC 2P9KC 2YNOA 3PVUB 5K19A 3OF7A 4DNUA 2HJ4A 3I8EA 3K71A 4IA9A 3V5WB 3UVLA 3SBQA 2CO0A 2OK4A 4U1EI 3RMZD 2HU5A 3IUNA 2VDRA 2P9LC 1N6EA 2B5NA 1U2VC 2IURA 3OKYA 4LG8A 2HYEA 4O02A 1H2WA 3KRXB 4FA4D 2G9AA 5C2VB 5EMMB 5E6UA 4GQ1A 2EIEA 4RE5A 2QZPA 3I7NA 4X3EA 3CFSB 2YBAA 4GM3A 5JWZA 5AJAA 2H9NA 1H2ZA 5HE1B 4MMZA 2YNPA 1E8NA 3EI3B 3IULA 5TF2A 3IUMA 4A09A 1OMWB 3O4IA 4A0AB 5H14A 1YFQA 5HE2B 5IGOA 1L5GA 1GP2B 2TRCB 4L3GD 1K8KC 3NIFA 5EALA 1JOFA 2OIZA 5CYKA 4BL0A 3I7PA 4A11A 3SHFA 4ERQA 4CZYA 3F3PA 4J79A 5C9ZB 3UVKA 3I8CA 5EMKB 4O2WA 3BWSA 4QT8A 2PM9A 2WQ8A 2UZXB 5HE0B 4X63B 1B9YA 2AGYA 3OL2A 3OKTA 3C75H 5FA5B 2VDNA 4BP9A 3AL8A 3OKWA 2VDLA 5CXBB 4ZOZA 3MXXA 5TEEA 3K6SA 3V4PA 4K3ID 4BP8A 4K3JB 4I79A 2XYIA 3C99A 4FA9D 1O6FA 3MZKA 3PXWD 4GGDA 4ESGA 4CI3A 2AQ5A 2XZGA 3JZGA 4XYHA 2CO0C 3I7LA 1QFSA 4PNKB 1MG2A 4N14A 3IJ0A 4PBYA 4GQ2P 5TDHB 2Z2OA 4E5ZB 3PSLA 1MDAH 4JHNA 3QHYB 4CI8A 2P9NC 4NAAA 3V4VA 5FKTA 1H2XA 1H2YA 5EARA 3EI3A 4J84A 2GNQA 4KFMB 1N6FA 3BG1A 2I0RA 3EG6A 3U4YA 3SN6B 4FAVD 1M1XA 3FCSA 4PXWA 4OZUA 3O4JA 3SBPA 2EICA 3UVNA 5FFOA 3VI3A 4CY1A 1VE6A 5H17A 3ZWLB 2B5MA 1JJUB 3PXSD 1Q47A 4FAND 3SWSD 3IUQA 1BPOA 3SVWD 3KRWB 4D0KA 3NIGA 3F3FA 3SJLD 4NC4A 5K1CC 2H47A 3JB9L 2H9MA 4QQEA 5GXIA 2H6KA 3NVNA 3I7KA 1JTDB 3RFHA 3ZE2A 5HE3B 4ZOYA 4PSXB 5CXBA 5EAPA 2Z2PA 5M5RA 2PM7B 1I2MB 2OJYA 4ZOXA 3V9FA 1N6DA 3JAMg 2HJBA 3EU7A 4ZN4A 4JHPC 3PE7A 4FA5D 3VI4A 2OVQB 2P9SC 2XE4A 4Z7QA 1SQJA 2CE9A 4CI1A 1XIPA 2IUQA 4IRZA 4QAMA 2MTAH 4YVDA 4ZOVA 2IWKA 2HU7A 5HYNB 4A08B 5M61A 2I3SA 5FKQA 1MG3A 4E5ZA 3P4FA 1GOHA 1B9XA 2VDQA 5SXMA 5GSAA 3MKQA 4D9SA 4J77A 3J80g 3JZNA 2H68A 4MMXA 4PC0A 4R7AB 5EAMA 1C9LA 4U7AA 4JSVC 4L1QD 4CC9A 4JXMA 3L4MD 4UM9A 5EM2A 2OK6A 3ORVD 2HXCA 3NIDA 4AN0A 2XL3A 4RE6A 4E54A 1PGUA 3RN1D 4LGNA 4GMBA 2AGLA 2VDMA 3CIKB 1A0RB 4JT6C 3FM0A 4Z8LA 3FGBA 4WK4A 2J57G 2QR5A 3ULEC 3IURA 1OLZA 4BH6A 2H6NA 4O9DA 5FQDA 5I5IA 2H9LA 2OVRB 1UTCA 4Z7OA 3ODTA 4CY5A 2J55H 4O45A 3UR4A 2P9UC 4CI2A 2G99A 3I89A 3B7FA 1YR2A 3EQ9A 1U8CA 4AMYA 2H14A 3EI2B 3ZDZA 4WK2A 3JRPA 4J0WA 1RI6A 2CE8A 2EIDA 1NEXB 4BCDA 2CN3A 4A08A 1VE7A 1TBGA 1JV2A 3GD1I 2VDKA 2YB8B 4CZXA 5IJ7E 5KDOB 3DSMA 4EWRA 3W15A 3J81g 4JSNC 1C9IA 4JD2C 5TEFA 2XDWA 4ERZA 2I0TA 3EMHA 2H3XA 5HQGA 2IUPA 2AH0A 4G56B 4JT5C 4AMZA 4CY2A 1JMZB 5FFGA 1QNIA 4A0AA 4J82A 3GC3B 3IJCA 1E8MA 2PM6B 5M5SA 1UOOA 4GM8A 4X60B 3VGZA 3K26A 3K27A
chains in the Genus database with same CATH topology
5IC7A 1XKSA 2J56H 4HDJA 5CXCB 4A0BB 2H13A 4A2LA 3GREA 3EI4B 4GM9A 2BBKH 4QL1A 5IT9g 4J86A 1GXRA 3UKUC 5B4WA 4XEIC 2W18A 5FLXg 4FA1D 4LG9A 1FWXA 4UI9R 5GXHA 4GZ8A 3SCYA 3IIYA 1XHMA 2BCJB 3RN0D 4J73A 3C5MA 4L9OA 5AMSA 2H6QA 2H9PA 3AH8B 4A11B 4Y5RD 3EI2A 5EMJB 5GMKn 2O9KA 3SFZA 1U4CA 3JROA 3AL9A 4O1QD 5A2Qg 4IMMA 2GC7A 3I7OA 2EBSA 1PEVA 2IUVA 4MK0B 4GQBB 3DWLC 3AL8B 1SQ9A 4JSPC 4TZ4A 3RRMC 3RSEC 3SBRA 4CZVA 4NSXA 2CNXA 4J0XA 3OTTA 4L3HD 4XYIA 3EI1B 3IIWA 3UVMA 4J78A 2HESX 3MZLA 3N0DA 1PBYB 3UVOA 4GGCA 2AGWA 4X61B 3E0CA 3JPXA 4PBZA 5CXCA 4A0BA 3L4OD 4AEZA 2HKMA 2Q7QA 3SMRA 3EI4A 3PVWB 1S4UX 3N0EA 5FKSA 3BG0A 2P9PC 4GGAA 5H1MA 2PBIB 3HFQA 4ES0A 2IAAA 5AFU3 4FB1D 2IWFA 3SXTD 2HKRA 3UKRC 3DM0A 2XL2A 4FHLA 5EMLB 4A2MA 2UZYB 2I0SA 5THAA 4FWWA 3PSCB 4J8BA 2GC4A 4QRJA 1L0QA 3IKOA 3PXTD 5I5JA 4O3UB 3MKSB 4OWRA 1VYHC 2Z2NA 4ERYA 3F3GA 2YNNA 4H5IA 3SLED 3EI1A 3VH0A 3GFCA 2AH1A 3AFCA 3JZHA 2P9IC 5IGQA 4Y7RA 2QC5A 3OKYB 1PI6A 1ERJA 5IJ8E 4D6VA 5FKRA 4AOWA 3IJ1A 4A7JA 4PSWB 1NR0A 5C2WB 2B4EA 4JSXC 3CFVA 3DXKC 3C9CA 3FRXA 2YMUA 5EM2B 1TYQC 4H5JA 4A09B 1P22A 3I2NA 2OVPB 4E54B 1SHYB 2CN2A 4J81A 4CY3A 1GOTB 3OW8A 2QXVA 2AGZA 3RLMD 2AGXA 4BUJC 1R5MA 2B5LA 3V7DB 5I5MA 2XU7A 1K32A 3NVQA 1JMXB 5CYKB 3VA6A 3RFGA 3EWEA 4O3TB 1GG2B 3A0FA 5FXYA 2PM9B 2I3TA 3I7HA 3MMYA 4J8GA 4J87A 3NVXA 3OL2B 3DXMC 2P9KC 2YNOA 3PVUB 5K19A 2HJ4A 3I8EA 4IA9A 3V5WB 3UVLA 3SBQA 2CO0A 2OK4A 4U1EI 3RMZD 2P9LC 1N6EA 2B5NA 1U2VC 2IURA 3OKYA 4LG8A 2HYEA 4FA4D 3KRXB 2G9AA 5C2VB 5EMMB 4GQ1A 3I7NA 4X3EA 3CFSB 2YBAA 4GM3A 5JWZA 5AJAA 2H9NA 5HE1B 2YNPA 3EI3B 5TF2A 4A09A 1OMWB 4A0AB 5H14A 1YFQA 5HE2B 5IGOA 1GP2B 2TRCB 4L3GD 1K8KC 5EALA 1JOFA 2OIZA 5CYKA 4BL0A 3I7PA 4A11A 3SHFA 4ERQA 4CZYA 3F3PA 4J79A 5C9ZB 3UVKA 3I8CA 5EMKB 3BWSA 4QT8A 2PM9A 2UZXB 5HE0B 4X63B 1B9YA 2AGYA 3OL2A 3OKTA 3C75H 5FA5B 3AL8A 3OKWA 5CXBB 4ZOZA 3MXXA 5TEEA 4K3ID 4K3JB 4I79A 2XYIA 3C99A 4FA9D 3MZKA 3PXWD 4GGDA 4ESGA 4CI3A 2AQ5A 3JZGA 4XYHA 2CO0C 3I7LA 4PNKB 1MG2A 4N14A 3IJ0A 4PBYA 4GQ2P 5TDHB 2Z2OA 4E5ZB 3PSLA 1MDAH 4CI8A 2P9NC 5FKTA 5EARA 3EI3A 4J84A 4KFMB 2GNQA 1N6FA 3BG1A 2I0RA 3EG6A 3U4YA 3SN6B 4FAVD 4PXWA 4OZUA 3SBPA 3UVNA 4CY1A 5H17A 3ZWLB 2B5MA 1JJUB 3PXSD 1Q47A 4FAND 3SWSD 3SVWD 3KRWB 4D0KA 3F3FA 3SJLD 5K1CC 2H47A 3JB9L 2H9MA 4QQEA 5GXIA 2H6KA 3NVNA 3I7KA 3RFHA 5HE3B 4ZOYA 4PSXB 5CXBA 5EAPA 2Z2PA 2PM7B 2OJYA 4ZOXA 3V9FA 1N6DA 3JAMg 2HJBA 3EU7A 4ZN4A 3PE7A 4FA5D 2OVQB 2P9SC 1SQJA 2CE9A 4CI1A 1XIPA 2IUQA 4YVDA 2MTAH 4ZOVA 2IWKA 5HYNB 4A08B 2I3SA 5FKQA 1MG3A 4E5ZA 3P4FA 1B9XA 5SXMA 5GSAA 3MKQA 4J77A 3J80g 3JZNA 2H68A 4PC0A 4R7AB 5EAMA 4U7AA 4JSVC 4L1QD 4CC9A 4JXMA 3L4MD 5EM2A 2OK6A 3ORVD 2HXCA 2XL3A 4E54A 1PGUA 3RN1D 4LGNA 4GMBA 2AGLA 3CIKB 1A0RB 4JT6C 3FM0A 4Z8LA 3FGBA 2J57G 3ULEC 1OLZA 4BH6A 2H6NA 4O9DA 5FQDA 5I5IA 2H9LA 2OVRB 3ODTA 4CY5A 2J55H 4O45A 3UR4A 2P9UC 4CI2A 2G99A 3I89A 3B7FA 2H14A 3EI2B 3JRPA 4J0WA 1RI6A 2CE8A 1NEXB 2CN3A 4A08A 1TBGA 4CZXA 2YB8B 5IJ7E 5KDOB 3DSMA 4EWRA 3W15A 3J81g 4JSNC 4JD2C 5TEFA 4ERZA 2I0TA 3EMHA 2H3XA 5HQGA 2IUPA 2AH0A 4G56B 4JT5C 4CY2A 1JMZB 1QNIA 4A0AA 4J82A 3IJCA 2PM6B 4GM8A 4X60B 3VGZA 3K26A 3K27A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IC7 A;  1XKS A;  2J56 H;  4HDJ A;  5CXC B;  4A0B B;  2H13 A;  4A2L A;  3GRE A;  3EI4 B;  4GM9 A;  2BBK H;  4QL1 A;  5IT9 g;  4J86 A;  1GXR A;  3UKU C;  5B4W A;  4XEI C;  2W18 A;  5FLX g;  4FA1 D;  4LG9 A;  1FWX A;  4UI9 R;  5GXH A;  4GZ8 A;  3SCY A;  3IIY A;  1XHM A;  2BCJ B;  3RN0 D;  4J73 A;  3C5M A;  4L9O A;  5AMS A;  2H6Q A;  2H9P A;  3AH8 B;  4A11 B;  4Y5R D;  3EI2 A;  5EMJ B;  5GMK n;  2O9K A;  3SFZ A;  1U4C A;  3JRO A;  3AL9 A;  4O1Q D;  5A2Q g;  4IMM A;  2GC7 A;  3I7O A;  2EBS A;  1PEV A;  2IUV A;  4MK0 B;  4GQB B;  3DWL C;  3AL8 B;  1SQ9 A;  4JSP C;  4TZ4 A;  3RRM C;  3RSE C;  3SBR A;  4CZV A;  4NSX A;  2CNX A;  4J0X A;  3OTT A;  4L3H D;  4XYI A;  3EI1 B;  3IIW A;  3UVM A;  4J78 A;  2HES X;  3MZL A;  3N0D A;  1PBY B;  3UVO A;  4GGC A;  2AGW A;  4X61 B;  3E0C A;  3JPX A;  4PBZ A;  5CXC A;  4A0B A;  3L4O D;  4AEZ A;  2HKM A;  2Q7Q A;  3SMR A;  3EI4 A;  3PVW B;  1S4U X;  3N0E A;  5FKS A;  3BG0 A;  2P9P C;  4GGA A;  5H1M A;  2PBI B;  3HFQ A;  4ES0 A;  2IAA A;  5AFU 3;  4FB1 D;  2IWF A;  3SXT D;  2HKR A;  3UKR C;  3DM0 A;  2XL2 A;  4FHL A;  5EML B;  4A2M A;  2UZY B;  2I0S A;  5THA A;  4FWW A;  3PSC B;  4J8B A;  2GC4 A;  4QRJ A;  1L0Q A;  3IKO A;  3PXT D;  5I5J A;  4O3U B;  3MKS B;  4OWR A;  1VYH C;  2Z2N A;  4ERY A;  3F3G A;  2YNN A;  4H5I A;  3SLE D;  3EI1 A;  3VH0 A;  3GFC A;  2AH1 A;  3AFC A;  3JZH A;  2P9I C;  5IGQ A;  4Y7R A;  2QC5 A;  3OKY B;  1PI6 A;  1ERJ A;  5IJ8 E;  4D6V A;  5FKR A;  4AOW A;  3IJ1 A;  4A7J A;  4PSW B;  1NR0 A;  5C2W B;  2B4E A;  4JSX C;  3CFV A;  3DXK C;  3C9C A;  3FRX A;  2YMU A;  5EM2 B;  1TYQ C;  4H5J A;  4A09 B;  1P22 A;  3I2N A;  2OVP B;  4E54 B;  1SHY B;  2CN2 A;  4J81 A;  4CY3 A;  1GOT B;  3OW8 A;  2QXV A;  2AGZ A;  3RLM D;  2AGX A;  4BUJ C;  1R5M A;  2B5L A;  3V7D B;  5I5M A;  2XU7 A;  1K32 A;  3NVQ A;  1JMX B;  5CYK B;  3VA6 A;  3RFG A;  3EWE A;  4O3T B;  1GG2 B;  3A0F A;  5FXY A;  2PM9 B;  2I3T A;  3I7H A;  3MMY A;  4J8G A;  4J87 A;  3NVX A;  3OL2 B;  3DXM C;  2P9K C;  2YNO A;  3PVU B;  5K19 A;  2HJ4 A;  3I8E A;  4IA9 A;  3V5W B;  3UVL A;  3SBQ A;  2CO0 A;  2OK4 A;  4U1E I;  3RMZ D;  2P9L C;  1N6E A;  2B5N A;  1U2V C;  2IUR A;  3OKY A;  4LG8 A;  2HYE A;  4FA4 D;  3KRX B;  2G9A A;  5C2V B;  5EMM B;  4GQ1 A;  3I7N A;  4X3E A;  3CFS B;  2YBA A;  4GM3 A;  5JWZ A;  5AJA A;  2H9N A;  5HE1 B;  2YNP A;  3EI3 B;  5TF2 A;  4A09 A;  1OMW B;  4A0A B;  5H14 A;  1YFQ A;  5HE2 B;  5IGO A;  1GP2 B;  2TRC B;  4L3G D;  1K8K C;  5EAL A;  1JOF A;  2OIZ A;  5CYK A;  4BL0 A;  3I7P A;  4A11 A;  3SHF A;  4ERQ A;  4CZY A;  3F3P A;  4J79 A;  5C9Z B;  3UVK A;  3I8C A;  5EMK B;  3BWS A;  4QT8 A;  2PM9 A;  2UZX B;  5HE0 B;  4X63 B;  1B9Y A;  2AGY A;  3OL2 A;  3OKT A;  3C75 H;  5FA5 B;  3AL8 A;  3OKW A;  5CXB B;  4ZOZ A;  3MXX A;  5TEE A;  4K3I D;  4K3J B;  4I79 A;  2XYI A;  3C99 A;  4FA9 D;  3MZK A;  3PXW D;  4GGD A;  4ESG A;  4CI3 A;  2AQ5 A;  3JZG A;  4XYH A;  2CO0 C;  3I7L A;  4PNK B;  1MG2 A;  4N14 A;  3IJ0 A;  4PBY A;  4GQ2 P;  5TDH B;  2Z2O A;  4E5Z B;  3PSL A;  1MDA H;  4CI8 A;  2P9N C;  5FKT A;  5EAR A;  3EI3 A;  4J84 A;  4KFM B;  2GNQ A;  1N6F A;  3BG1 A;  2I0R A;  3EG6 A;  3U4Y A;  3SN6 B;  4FAV D;  4PXW A;  4OZU A;  3SBP A;  3UVN A;  4CY1 A;  5H17 A;  3ZWL B;  2B5M A;  1JJU B;  3PXS D;  1Q47 A;  4FAN D;  3SWS D;  3SVW D;  3KRW B;  4D0K A;  3F3F A;  3SJL D;  5K1C C;  2H47 A;  3JB9 L;  2H9M A;  4QQE A;  5GXI A;  2H6K A;  3NVN A;  3I7K A;  3RFH A;  5HE3 B;  4ZOY A;  4PSX B;  5CXB A;  5EAP A;  2Z2P A;  2PM7 B;  2OJY A;  4ZOX A;  3V9F A;  1N6D A;  3JAM g;  2HJB A;  3EU7 A;  4ZN4 A;  3PE7 A;  4FA5 D;  2OVQ B;  2P9S C;  1SQJ A;  2CE9 A;  4CI1 A;  1XIP A;  2IUQ A;  4YVD A;  2MTA H;  4ZOV A;  2IWK A;  5HYN B;  4A08 B;  2I3S A;  5FKQ A;  1MG3 A;  4E5Z A;  3P4F A;  1B9X A;  5SXM A;  5GSA A;  3MKQ A;  4J77 A;  3J80 g;  3JZN A;  2H68 A;  4PC0 A;  4R7A B;  5EAM A;  4U7A A;  4JSV C;  4L1Q D;  4CC9 A;  4JXM A;  3L4M D;  5EM2 A;  2OK6 A;  3ORV D;  2HXC A;  2XL3 A;  4E54 A;  1PGU A;  3RN1 D;  4LGN A;  4GMB A;  2AGL A;  3CIK B;  1A0R B;  4JT6 C;  3FM0 A;  4Z8L A;  3FGB A;  2J57 G;  3ULE C;  1OLZ A;  4BH6 A;  2H6N A;  4O9D A;  5FQD A;  5I5I A;  2H9L A;  2OVR B;  3ODT A;  4CY5 A;  2J55 H;  4O45 A;  3UR4 A;  2P9U C;  4CI2 A;  2G99 A;  3I89 A;  3B7F A;  2H14 A;  3EI2 B;  3JRP A;  4J0W A;  1RI6 A;  2CE8 A;  1NEX B;  2CN3 A;  4A08 A;  1TBG A;  4CZX A;  2YB8 B;  5IJ7 E;  5KDO B;  3DSM A;  4EWR A;  3W15 A;  3J81 g;  4JSN C;  4JD2 C;  5TEF A;  4ERZ A;  2I0T A;  3EMH A;  2H3X A;  5HQG A;  2IUP A;  2AH0 A;  4G56 B;  4JT5 C;  4CY2 A;  1JMZ B;  1QNI A;  4A0A A;  4J82 A;  3IJC A;  2PM6 B;  4GM8 A;  4X60 B;  3VGZ A;  3K26 A;  3K27 A; 
#chains in the Genus database with same CATH topology
 2VC2 A;  5IC7 A;  3KCI A;  1XKS A;  2J56 H;  4HDJ A;  5CXC B;  4A0B B;  2H13 A;  3ZDY A;  4A2L A;  3GRE A;  3EI4 B;  4GM9 A;  2BBK H;  4QL1 A;  4BCB A;  5IT9 g;  4J86 A;  1GXR A;  3UKU C;  5B4W A;  2VDP A;  4XEI C;  2W18 A;  5FLX g;  4FA1 D;  4LG9 A;  1FWX A;  4UI9 R;  5GXH A;  4GZ8 A;  3SCY A;  4NBM A;  3IIY A;  3IJE A;  1XHM A;  2BCJ B;  3RN0 D;  1E5T A;  4J73 A;  3C5M A;  4L9O A;  5AMS A;  2H6Q A;  2H9P A;  3AH8 B;  4A11 B;  4Y5R D;  4Z7N A;  3EI2 A;  5EMJ B;  2HU8 A;  5GMK n;  3EQ8 A;  2O9K A;  3SFZ A;  1TYE A;  1U4C A;  3JRO A;  3AL9 A;  4O1Q D;  5A2Q g;  4IMM A;  2GC7 A;  2VZ1 A;  3I7O A;  2EBS A;  1PEV A;  2IUV A;  4MK0 B;  3O4G A;  4GQB B;  3DWL C;  3AL8 B;  1SQ9 A;  4JSP C;  4AN1 A;  1QFM A;  4TZ4 A;  3RRM C;  3RSE C;  3SBR A;  4CZV A;  1UOP A;  3MUO A;  2CNX A;  4L3H D;  4J0X A;  3OTT A;  4NSX A;  4XYI A;  3EI1 B;  3IIW A;  3UVM A;  4J78 A;  2HES X;  3MZL A;  3N0D A;  1PBY B;  3ZE0 A;  3UVO A;  4GGC A;  2AGW A;  4X61 B;  5E6R A;  3E0C A;  3JPX A;  4PBZ A;  5CXC A;  3K72 A;  4A0B A;  3L4O D;  4WK0 A;  4AEZ A;  2HKM A;  2Q7Q A;  3SMR A;  3EI4 A;  3PVW B;  1K3I A;  1GOG A;  1S4U X;  3N0E A;  5FKS A;  3BG0 A;  2P9P C;  4GGA A;  4L1M A;  5H1M A;  2PBI B;  1O6G A;  3HFQ A;  5C92 A;  4ES0 A;  2IAA A;  5AFU 3;  3EQ7 A;  4FB1 D;  2IWF A;  3SXT D;  2HKR A;  3UKR C;  3DM0 A;  2XL2 A;  5M5V A;  5HDB A;  4FHL A;  5C86 A;  5EML B;  3O4H A;  4BCC A;  4A2M A;  2UZY B;  4AX4 A;  4G1M A;  4DNV A;  3IVM A;  3QI0 A;  2I0S A;  1T2X A;  3T3M A;  3MUN A;  5THA A;  4FWW A;  3PSC B;  1A12 A;  4J8B A;  2GC4 A;  3T3P A;  4QRJ A;  1L0Q A;  3IKO A;  4DNW A;  3PXT D;  5E6S A;  4G1E A;  5I5J A;  4O3U B;  3MKS B;  4WJK A;  4OWR A;  1VYH C;  2Z2N A;  2JKX A;  4MMY A;  4ERY A;  3F3G A;  2YNN A;  4H5I A;  3SLE D;  3EI1 A;  5M5T A;  3VH0 A;  3GFC A;  1GOF A;  2AH1 A;  3AFC A;  3JZH A;  2P9I C;  5IGQ A;  4Y7R A;  2QC5 A;  3OKY B;  2VDO A;  1PI6 A;  1ERJ A;  5IJ8 E;  4D6V A;  2BKL A;  5FKR A;  4AOW A;  3IJ1 A;  3ZDX A;  1VZ2 A;  2VZ3 A;  4UM8 A;  4A7J A;  1UOQ A;  4PSW B;  1NR0 A;  5C2W B;  2B4E A;  4JSX C;  3CFV A;  3DXK C;  3C9C A;  3FRX A;  3MVD K;  3ZE1 A;  2YMU A;  5EM2 B;  1TYQ C;  1VZ3 A;  4H5J A;  4A09 B;  1P22 A;  3I2N A;  2OVP B;  4E54 B;  1SHY B;  2CN2 A;  4J81 A;  4CY3 A;  1GOT B;  2EIB A;  3OW8 A;  2QXV A;  2AGZ A;  3RLM D;  2AGX A;  4BUJ C;  1R5M A;  2B5L A;  3V7D B;  5I5M A;  2XU7 A;  1K32 A;  3NVQ A;  1JMX B;  5CYK B;  3VA6 A;  3RFG A;  3EWE A;  5M5U A;  3FCU A;  4O3T B;  1GG2 B;  3A0F A;  5FXY A;  2PM9 B;  3DDU A;  2I3T A;  3I7H A;  3MMY A;  4J8G A;  4J87 A;  4G55 A;  3NVX A;  3OL2 B;  4NEN A;  3IUJ A;  3DXM C;  2P9K C;  2YNO A;  3PVU B;  5K19 A;  3OF7 A;  4DNU A;  2HJ4 A;  3I8E A;  3K71 A;  4IA9 A;  3V5W B;  3UVL A;  3SBQ A;  2CO0 A;  2OK4 A;  4U1E I;  3RMZ D;  2HU5 A;  3IUN A;  2VDR A;  2P9L C;  1N6E A;  2B5N A;  1U2V C;  2IUR A;  3OKY A;  4LG8 A;  2HYE A;  4O02 A;  1H2W A;  3KRX B;  4FA4 D;  2G9A A;  5C2V B;  5EMM B;  5E6U A;  4GQ1 A;  2EIE A;  4RE5 A;  2QZP A;  3I7N A;  4X3E A;  3CFS B;  2YBA A;  4GM3 A;  5JWZ A;  5AJA A;  2H9N A;  1H2Z A;  5HE1 B;  4MMZ A;  2YNP A;  1E8N A;  3EI3 B;  3IUL A;  5TF2 A;  3IUM A;  4A09 A;  1OMW B;  3O4I A;  4A0A B;  5H14 A;  1YFQ A;  5HE2 B;  5IGO A;  1L5G A;  1GP2 B;  2TRC B;  4L3G D;  1K8K C;  3NIF A;  5EAL A;  1JOF A;  2OIZ A;  5CYK A;  4BL0 A;  3I7P A;  4A11 A;  3SHF A;  4ERQ A;  4CZY A;  3F3P A;  4J79 A;  5C9Z B;  3UVK A;  3I8C A;  5EMK B;  4O2W A;  3BWS A;  4QT8 A;  2PM9 A;  2WQ8 A;  2UZX B;  5HE0 B;  4X63 B;  1B9Y A;  2AGY A;  3OL2 A;  3OKT A;  3C75 H;  5FA5 B;  2VDN A;  4BP9 A;  3AL8 A;  3OKW A;  2VDL A;  5CXB B;  4ZOZ A;  3MXX A;  5TEE A;  3K6S A;  3V4P A;  4K3I D;  4BP8 A;  4K3J B;  4I79 A;  2XYI A;  3C99 A;  4FA9 D;  1O6F A;  3MZK A;  3PXW D;  4GGD A;  4ESG A;  4CI3 A;  2AQ5 A;  2XZG A;  3JZG A;  4XYH A;  2CO0 C;  3I7L A;  1QFS A;  4PNK B;  1MG2 A;  4N14 A;  3IJ0 A;  4PBY A;  4GQ2 P;  5TDH B;  2Z2O A;  4E5Z B;  3PSL A;  1MDA H;  4JHN A;  3QHY B;  4CI8 A;  2P9N C;  4NAA A;  3V4V A;  5FKT A;  1H2X A;  1H2Y A;  5EAR A;  3EI3 A;  4J84 A;  2GNQ A;  4KFM B;  1N6F A;  3BG1 A;  2I0R A;  3EG6 A;  3U4Y A;  3SN6 B;  4FAV D;  1M1X A;  3FCS A;  4PXW A;  4OZU A;  3O4J A;  3SBP A;  2EIC A;  3UVN A;  5FFO A;  3VI3 A;  4CY1 A;  1VE6 A;  5H17 A;  3ZWL B;  2B5M A;  1JJU B;  3PXS D;  1Q47 A;  4FAN D;  3SWS D;  3IUQ A;  1BPO A;  3SVW D;  3KRW B;  4D0K A;  3NIG A;  3F3F A;  3SJL D;  4NC4 A;  5K1C C;  2H47 A;  3JB9 L;  2H9M A;  4QQE A;  5GXI A;  2H6K A;  3NVN A;  3I7K A;  1JTD B;  3RFH A;  3ZE2 A;  5HE3 B;  4ZOY A;  4PSX B;  5CXB A;  5EAP A;  2Z2P A;  5M5R A;  2PM7 B;  1I2M B;  2OJY A;  4ZOX A;  3V9F A;  1N6D A;  3JAM g;  2HJB A;  3EU7 A;  4ZN4 A;  4JHP C;  3PE7 A;  4FA5 D;  3VI4 A;  2OVQ B;  2P9S C;  2XE4 A;  4Z7Q A;  1SQJ A;  2CE9 A;  4CI1 A;  1XIP A;  2IUQ A;  4IRZ A;  4QAM A;  2MTA H;  4YVD A;  4ZOV A;  2IWK A;  2HU7 A;  5HYN B;  4A08 B;  5M61 A;  2I3S A;  5FKQ A;  1MG3 A;  4E5Z A;  3P4F A;  1GOH A;  1B9X A;  2VDQ A;  5SXM A;  5GSA A;  3MKQ A;  4D9S A;  4J77 A;  3J80 g;  3JZN A;  2H68 A;  4MMX A;  4PC0 A;  4R7A B;  5EAM A;  1C9L A;  4U7A A;  4JSV C;  4L1Q D;  4CC9 A;  4JXM A;  3L4M D;  4UM9 A;  5EM2 A;  2OK6 A;  3ORV D;  2HXC A;  3NID A;  4AN0 A;  2XL3 A;  4RE6 A;  4E54 A;  1PGU A;  3RN1 D;  4LGN A;  4GMB A;  2AGL A;  2VDM A;  3CIK B;  1A0R B;  4JT6 C;  3FM0 A;  4Z8L A;  3FGB A;  4WK4 A;  2J57 G;  2QR5 A;  3ULE C;  3IUR A;  1OLZ A;  4BH6 A;  2H6N A;  4O9D A;  5FQD A;  5I5I A;  2H9L A;  2OVR B;  1UTC A;  4Z7O A;  3ODT A;  4CY5 A;  2J55 H;  4O45 A;  3UR4 A;  2P9U C;  4CI2 A;  2G99 A;  3I89 A;  3B7F A;  1YR2 A;  3EQ9 A;  1U8C A;  4AMY A;  2H14 A;  3EI2 B;  3ZDZ A;  4WK2 A;  3JRP A;  4J0W A;  1RI6 A;  2CE8 A;  2EID A;  1NEX B;  4BCD A;  2CN3 A;  4A08 A;  1VE7 A;  1TBG A;  1JV2 A;  3GD1 I;  2VDK A;  2YB8 B;  4CZX A;  5IJ7 E;  5KDO B;  3DSM A;  4EWR A;  3W15 A;  3J81 g;  4JSN C;  1C9I A;  4JD2 C;  5TEF A;  2XDW A;  4ERZ A;  2I0T A;  3EMH A;  2H3X A;  5HQG A;  2IUP A;  2AH0 A;  4G56 B;  4JT5 C;  4AMZ A;  4CY2 A;  1JMZ B;  5FFG A;  1QNI A;  4A0A A;  4J82 A;  3GC3 B;  3IJC A;  1E8M A;  2PM6 B;  5M5S A;  1UOO A;  4GM8 A;  4X60 B;  3VGZ A;  3K26 A;  3K27 A; 
#chains in the Genus database with same CATH homology
 5IC7 A;  1XKS A;  2J56 H;  4HDJ A;  5CXC B;  4A0B B;  2H13 A;  4A2L A;  3GRE A;  3EI4 B;  4GM9 A;  2BBK H;  4QL1 A;  5IT9 g;  4J86 A;  1GXR A;  3UKU C;  5B4W A;  4XEI C;  2W18 A;  5FLX g;  4FA1 D;  4LG9 A;  1FWX A;  4UI9 R;  5GXH A;  4GZ8 A;  3SCY A;  3IIY A;  1XHM A;  2BCJ B;  3RN0 D;  4J73 A;  3C5M A;  4L9O A;  5AMS A;  2H6Q A;  2H9P A;  3AH8 B;  4A11 B;  4Y5R D;  3EI2 A;  5EMJ B;  5GMK n;  2O9K A;  3SFZ A;  1U4C A;  3JRO A;  3AL9 A;  4O1Q D;  5A2Q g;  4IMM A;  2GC7 A;  3I7O A;  2EBS A;  1PEV A;  2IUV A;  4MK0 B;  4GQB B;  3DWL C;  3AL8 B;  1SQ9 A;  4JSP C;  4TZ4 A;  3RRM C;  3RSE C;  3SBR A;  4CZV A;  4NSX A;  2CNX A;  4J0X A;  3OTT A;  4L3H D;  4XYI A;  3EI1 B;  3IIW A;  3UVM A;  4J78 A;  2HES X;  3MZL A;  3N0D A;  1PBY B;  3UVO A;  4GGC A;  2AGW A;  4X61 B;  3E0C A;  3JPX A;  4PBZ A;  5CXC A;  4A0B A;  3L4O D;  4AEZ A;  2HKM A;  2Q7Q A;  3SMR A;  3EI4 A;  3PVW B;  1S4U X;  3N0E A;  5FKS A;  3BG0 A;  2P9P C;  4GGA A;  5H1M A;  2PBI B;  3HFQ A;  4ES0 A;  2IAA A;  5AFU 3;  4FB1 D;  2IWF A;  3SXT D;  2HKR A;  3UKR C;  3DM0 A;  2XL2 A;  4FHL A;  5EML B;  4A2M A;  2UZY B;  2I0S A;  5THA A;  4FWW A;  3PSC B;  4J8B A;  2GC4 A;  4QRJ A;  1L0Q A;  3IKO A;  3PXT D;  5I5J A;  4O3U B;  3MKS B;  4OWR A;  1VYH C;  2Z2N A;  4ERY A;  3F3G A;  2YNN A;  4H5I A;  3SLE D;  3EI1 A;  3VH0 A;  3GFC A;  2AH1 A;  3AFC A;  3JZH A;  2P9I C;  5IGQ A;  4Y7R A;  2QC5 A;  3OKY B;  1PI6 A;  1ERJ A;  5IJ8 E;  4D6V A;  5FKR A;  4AOW A;  3IJ1 A;  4A7J A;  4PSW B;  1NR0 A;  5C2W B;  2B4E A;  4JSX C;  3CFV A;  3DXK C;  3C9C A;  3FRX A;  2YMU A;  5EM2 B;  1TYQ C;  4H5J A;  4A09 B;  1P22 A;  3I2N A;  2OVP B;  4E54 B;  1SHY B;  2CN2 A;  4J81 A;  4CY3 A;  1GOT B;  3OW8 A;  2QXV A;  2AGZ A;  3RLM D;  2AGX A;  4BUJ C;  1R5M A;  2B5L A;  3V7D B;  5I5M A;  2XU7 A;  1K32 A;  3NVQ A;  1JMX B;  5CYK B;  3VA6 A;  3RFG A;  3EWE A;  4O3T B;  1GG2 B;  3A0F A;  5FXY A;  2PM9 B;  2I3T A;  3I7H A;  3MMY A;  4J8G A;  4J87 A;  3NVX A;  3OL2 B;  3DXM C;  2P9K C;  2YNO A;  3PVU B;  5K19 A;  2HJ4 A;  3I8E A;  4IA9 A;  3V5W B;  3UVL A;  3SBQ A;  2CO0 A;  2OK4 A;  4U1E I;  3RMZ D;  2P9L C;  1N6E A;  2B5N A;  1U2V C;  2IUR A;  3OKY A;  4LG8 A;  2HYE A;  4FA4 D;  3KRX B;  2G9A A;  5C2V B;  5EMM B;  4GQ1 A;  3I7N A;  4X3E A;  3CFS B;  2YBA A;  4GM3 A;  5JWZ A;  5AJA A;  2H9N A;  5HE1 B;  2YNP A;  3EI3 B;  5TF2 A;  4A09 A;  1OMW B;  4A0A B;  5H14 A;  1YFQ A;  5HE2 B;  5IGO A;  1GP2 B;  2TRC B;  4L3G D;  1K8K C;  5EAL A;  1JOF A;  2OIZ A;  5CYK A;  4BL0 A;  3I7P A;  4A11 A;  3SHF A;  4ERQ A;  4CZY A;  3F3P A;  4J79 A;  5C9Z B;  3UVK A;  3I8C A;  5EMK B;  3BWS A;  4QT8 A;  2PM9 A;  2UZX B;  5HE0 B;  4X63 B;  1B9Y A;  2AGY A;  3OL2 A;  3OKT A;  3C75 H;  5FA5 B;  3AL8 A;  3OKW A;  5CXB B;  4ZOZ A;  3MXX A;  5TEE A;  4K3I D;  4K3J B;  4I79 A;  2XYI A;  3C99 A;  4FA9 D;  3MZK A;  3PXW D;  4GGD A;  4ESG A;  4CI3 A;  2AQ5 A;  3JZG A;  4XYH A;  2CO0 C;  3I7L A;  4PNK B;  1MG2 A;  4N14 A;  3IJ0 A;  4PBY A;  4GQ2 P;  5TDH B;  2Z2O A;  4E5Z B;  3PSL A;  1MDA H;  4CI8 A;  2P9N C;  5FKT A;  5EAR A;  3EI3 A;  4J84 A;  4KFM B;  2GNQ A;  1N6F A;  3BG1 A;  2I0R A;  3EG6 A;  3U4Y A;  3SN6 B;  4FAV D;  4PXW A;  4OZU A;  3SBP A;  3UVN A;  4CY1 A;  5H17 A;  3ZWL B;  2B5M A;  1JJU B;  3PXS D;  1Q47 A;  4FAN D;  3SWS D;  3SVW D;  3KRW B;  4D0K A;  3F3F A;  3SJL D;  5K1C C;  2H47 A;  3JB9 L;  2H9M A;  4QQE A;  5GXI A;  2H6K A;  3NVN A;  3I7K A;  3RFH A;  5HE3 B;  4ZOY A;  4PSX B;  5CXB A;  5EAP A;  2Z2P A;  2PM7 B;  2OJY A;  4ZOX A;  3V9F A;  1N6D A;  3JAM g;  2HJB A;  3EU7 A;  4ZN4 A;  3PE7 A;  4FA5 D;  2OVQ B;  2P9S C;  1SQJ A;  2CE9 A;  4CI1 A;  1XIP A;  2IUQ A;  4YVD A;  2MTA H;  4ZOV A;  2IWK A;  5HYN B;  4A08 B;  2I3S A;  5FKQ A;  1MG3 A;  4E5Z A;  3P4F A;  1B9X A;  5SXM A;  5GSA A;  3MKQ A;  4J77 A;  3J80 g;  3JZN A;  2H68 A;  4PC0 A;  4R7A B;  5EAM A;  4U7A A;  4JSV C;  4L1Q D;  4CC9 A;  4JXM A;  3L4M D;  5EM2 A;  2OK6 A;  3ORV D;  2HXC A;  2XL3 A;  4E54 A;  1PGU A;  3RN1 D;  4LGN A;  4GMB A;  2AGL A;  3CIK B;  1A0R B;  4JT6 C;  3FM0 A;  4Z8L A;  3FGB A;  2J57 G;  3ULE C;  1OLZ A;  4BH6 A;  2H6N A;  4O9D A;  5FQD A;  5I5I A;  2H9L A;  2OVR B;  3ODT A;  4CY5 A;  2J55 H;  4O45 A;  3UR4 A;  2P9U C;  4CI2 A;  2G99 A;  3I89 A;  3B7F A;  2H14 A;  3EI2 B;  3JRP A;  4J0W A;  1RI6 A;  2CE8 A;  1NEX B;  2CN3 A;  4A08 A;  1TBG A;  4CZX A;  2YB8 B;  5IJ7 E;  5KDO B;  3DSM A;  4EWR A;  3W15 A;  3J81 g;  4JSN C;  4JD2 C;  5TEF A;  4ERZ A;  2I0T A;  3EMH A;  2H3X A;  5HQG A;  2IUP A;  2AH0 A;  4G56 B;  4JT5 C;  4CY2 A;  1JMZ B;  1QNI A;  4A0A A;  4J82 A;  3IJC A;  2PM6 B;  4GM8 A;  4X60 B;  3VGZ A;  3K26 A;  3K27 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...