3CFSB

Structural basis of the interaction of rbap46/rbap48 with histone h4
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
404
structure length
383
Chain Sequence
FEDTVEERVINEEYKIWKKNTPFLYDLVMTHALQWPSLTVQWLPEVTKPEGKDYALHWLVLGTHTSDEQNHLVVARVHIPNDDTGKIECEIKINHEGEVNRARYMPQNPHIIATKTPSSDVLVFDYTKHPAKPDPSGECNPDLRLRGHQKEGYGLSWNSNLSGHLLSASDDHTVCLWDINAGPKEGKIVDAKAIFTGHSAVVEDVAWHLLHESLFGSVADDQKLMIWDTRSNTTSKPSHLVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHTFESHKDEIFQVHWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQIWQMAENIYND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Histone/chaperone
molecule keywords Histone-binding protein RBBP7
publication title Structural Basis for the Recognition of Histone H4 by the Histone-Chaperone RbAp46.
pubmed doi rcsb
source organism Homo sapiens
total genus 88
structure length 383
sequence length 404
ec nomenclature
pdb deposition date 2008-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00400 WD40 WD domain, G-beta repeat
B PF12265 CAF1C_H4-bd Histone-binding protein RBBP4 or subunit C of CAF1 complex
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3cfsB00
5TDHB 3IIYA 4J73A 4PBZA 2HJ4A 5C2VB 3OL2B 4YVDA 4CZXA 2G9AA 3U4YA 4J81A 4GZ8A 3BWSA 4CY5A 4JSPC 4A0BB 2J56H 3BG0A 4J78A 5EMKB 1SHYB 3I7NA 4PC0A 2OVRB 1JMXB 4A2MA 3VGZA 5IJ8E 2IWKA 3MZKA 2UZXB 2QC5A 2CN3A 2H3XA 3SXTD 4CI2A 5GXHA 3PSLA 2AGWA 2Q7QA 3C5MA 4A0AB 3GFCA 4H5JA 3W15A 4Y5RD 5EMJB 1VYHC 4JXMA 3P4FA 3B7FA 4PSWB 5K19A 3OKYA 1MDAH 4FAND 4A09B 4U1EI 3JRPA 5CYKA 4J0WA 3ZWLB 4GQ2P 5C2WB 2TRCB 4A08B 4U7AA 4PBYA 2IAAA 3CFSB 5CXCA 3PXTD 1Q47A 3K27A 3BG1A 2H13A 5EMLB 2P9PC 1GXRA 4K3ID 4AEZA 2HKRA 2PM9A 3I7HA 2XL2A 4CI3A 5FLXg 3CIKB 1NEXB 2J57G 1U4CA 5IJ7E 4GQBB 4L3GD 2YMUA 3SHFA 5K1CC 2CNXA 2PBIB 2H9PA 2MTAH 5TEFA 2AGXA 3UKRC 2PM6B 3UVOA 1GG2B 3L4MD 3JZNA 3SJLD 3DXMC 3RN1D 3RMZD 3ODTA 3GREA 3SBQA 3RFHA 4E54B 4FA5D 3IJCA 2BBKH 4JD2C 2XYIA 5CXBA 4XYIA 4TZ4A 4KFMB 2P9UC 3SBPA 2QXVA 4FWWA 1RI6A 5I5MA 4OZUA 2CE9A 3PSCB 3AFCA 4E5ZA 2O9KA 3I7LA 3L4OD 5FXYA 4ZOVA 2I0TA 3MZLA 4UI9R 5EAPA 1QNIA 3RFGA 3F3GA 4FB1D 4O3UB 4QT8A 2HESX 5A2Qg 1N6DA 3I7KA 2IUQA 2AH1A 3I7PA 4D6VA 4GGCA 3UR4A 4A11A 2OJYA 3UVNA 3F3FA 2OK6A 1XIPA 4R7AB 3JROA 4EWRA 1TBGA 4Y7RA 4O1QD 3KRXB 1TYQC 3JAMg 3RSEC 2CE8A 2P9IC 5IC7A 3KRWB 4BUJC 5EARA 2B5MA 3I8EA 4A11B 4J0XA 5TEEA 3RLMD 4FAVD 5FKRA 4X60B 4N14A 3N0DA 3EWEA 2PM7B 1GOTB 2HKMA 3MKSB 4CY2A 4GGAA 3SCYA 5H14A 2H9LA 4J82A 3MXXA 2P9KC 5KDOB 3A0FA 4OWRA 2CO0A 3EI3A 2I3TA 1L0QA 4QL1A 4FHLA 3ULEC 4QQEA 3OKTA 2G99A 4GM8A 5FKQA 5EM2A 1JOFA 2I3SA 3K26A 2P9LC 2P9NC 3OKYB 2GNQA 2H6NA 1A0RB 3EI1A 1XKSA 3MMYA 4BL0A 4J8BA 4CY1A 3V9FA 5CYKB 1N6EA 3AH8B 4J84A 3F3PA 4D0KA 1N6FA 3DSMA 3ORVD 3UVLA 3OTTA 5H17A 4L1QD 4GMBA 5CXCB 2Z2PA 3UVMA 4LG9A 2OK4A 5HE1B 4JT6C 3EI1B 1K8KC 4QRJA 2Z2NA 5IGQA 2PM9B 4PXWA 2YBAA 5EAMA 1PI6A 4J87A 5C9ZB 5I5IA 3IJ0A 1S4UX 3FM0A 3EI4A 2I0SA 1PGUA 4LG8A 5FA5B 4L9OA 4A2LA 5TF2A 3HFQA 3AL8A 4O9DA 4O3TB 1GP2B 3E0CA 2XL3A 3IIWA 2CN2A 3MKQA 2W18A 2AGYA 2OVPB 4J86A 3EI2A 5CXBB 2AGZA 5GSAA 3EI4B 4ES0A 5AJAA 3SMRA 4H5IA 2B5NA 2AQ5A 5H1MA 3OL2A 2AH0A 2OIZA 5HE0B 4ZOYA 4JSXC 5EMMB 3AL8B 4JSNC 2H47A 3SWSD 4A0BA 3N0EA 4E5ZB 4Z8LA 3VH0A 1PEVA 2HXCA 4CZVA 2B5LA 2H6QA 4ERYA 4A7JA 3IJ1A 1SQ9A 3FGBA 1P22A 3PXWD 4NSXA 5GMKn 3JPXA 4J8GA 4ERQA 2I0RA 2P9SC 3EMHA 3DWLC 2J55H 4A0AA 3SFZA 2H6KA 4CZYA 4GM9A 5HQGA 2B4EA 5FKSA 1OLZA 2AGLA 3V7DB 3OW8A 3J81g 4LGNA 5HE3B 1XHMA 3PVUB 4A09A 2IUPA 3IKOA 4IA9A 5AMSA 1B9YA 3NVXA 2UZYB 5SXMA 1B9XA 4GGDA 4A08A 4GQ1A 2HYEA 5HE2B 3UVKA 3NVQA 5I5JA 1FWXA 2YB8B 4MK0B 1YFQA 4ZOZA 5IGOA 1K32A 4XYHA 4PNKB 4X3EA 4IMMA 3JZHA 3EI3B 3SLED 4ZOXA 3V5WB 5EALA 4BH6A 4ZN4A 2H68A 4ESGA 2XU7A 5AFU3 5EM2B 3PXSD 3JB9L 4GM3A 3PVWB 4I79A 4HDJA 4L3HD 5B4WA 2IURA 3SVWD 3CFVA 3SBRA 4X63B 4E54A 4G56B 2IWFA 3EU7A 3C99A 3C9CA 3J80g 2EBSA 2GC4A 3DM0A 1JMZB 3JZGA 4CY3A 5HYNB 3PE7A 4XEIC 5FKTA 2H9NA 3I89A 5JWZA 3OKWA 3SN6B 2HJBA 3DXKC 2BCJB 1PBYB 2YNNA 1NR0A 3VA6A 4ERZA 3NVNA 4FA4D 3RRMC 4CC9A 4JSVC 4FA1D 4J77A 4PSXB 2OVQB 2H9MA 4CI8A 4CI1A 5THAA 4X61B 5FQDA 3I2NA 1ERJA 1MG3A 1U2VC 3C75H 2Z2OA 1MG2A 5IT9g 1OMWB 3I7OA 4J79A 1JJUB 1R5MA 2YNOA 1SQJA 3I8CA 2CO0C 3RN0D 3AL9A 2IUVA 3EG6A 4O45A 3FRXA 4FA9D 5GXIA 3UKUC 2H14A 2YNPA 3EI2B 4AOWA 4JT5C 4K3JB 2GC7A
chains in the Genus database with same CATH superfamily
5TDHB 3IIYA 4G55A 4J73A 4PBZA 2HJ4A 5C2VB 3OL2B 4MMYA 4YVDA 4CZXA 2G9AA 3IURA 3U4YA 4J81A 4GZ8A 3BWSA 4CY5A 4JSPC 4WK2A 4A0BB 2J56H 3BG0A 4J78A 3QI0A 1GOHA 5EMKB 1SHYB 3I7NA 4PC0A 2OVRB 3ZE2A 2EICA 1JMXB 4A2MA 3VGZA 5IJ8E 5M5RA 2IWKA 3MZKA 2UZXB 2QC5A 3EQ9A 1E8NA 2JKXA 1C9LA 2CN3A 3IUQA 2H3XA 3SXTD 4CI2A 5GXHA 3PSLA 2AGWA 2Q7QA 3C5MA 4A0AB 3GFCA 4H5JA 3W15A 4BP9A 4Y5RD 2VDPA 5EMJB 1VYHC 3QHYB 2VDLA 4JXMA 3P4FA 3B7FA 4PSWB 5K19A 4WJKA 3OKYA 1MDAH 3NIFA 4FAND 3IVMA 4A09B 4U1EI 3ZDXA 3JRPA 5CYKA 4J0WA 3ZWLB 4AMYA 1VZ3A 4GQ2P 5C2WB 2EIDA 4UM9A 2TRCB 4A08B 4U7AA 4PBYA 1K3IA 2IAAA 3CFSB 5CXCA 1JTDB 3PXTD 3O4JA 1Q47A 3K27A 3BG1A 2H13A 5EMLB 2P9PC 1GXRA 4K3ID 4QAMA 4AEZA 2HKRA 2PM9A 3I7HA 2XL2A 4CI3A 5FLXg 3CIKB 1NEXB 2J57G 1U4CA 3MUNA 5IJ7E 4Z7NA 4GQBB 4L3GD 3EQ7A 2YMUA 3SHFA 1H2YA 5K1CC 2CNXA 2PBIB 2H9PA 2MTAH 5TEFA 2AGXA 3NIGA 2PM6B 3UKRC 3UVOA 1GG2B 3L4MD 3JZNA 3SJLD 3K6SA 3DXMC 3RN1D 3RMZD 3ODTA 3FCSA 3GREA 1GOGA 3SBQA 3RFHA 4E54B 4FA5D 4WK4A 3IJCA 4BCCA 2BBKH 4JD2C 2XYIA 5CXBA 4XYIA 4TZ4A 4KFMB 2P9UC 4Z7OA 3SBPA 2QXVA 4FWWA 1RI6A 5I5MA 4OZUA 1VE7A 2CE9A 3PSCB 3IULA 3AFCA 1A12A 2HU8A 4E5ZA 4BP8A 2O9KA 3I7LA 3L4OD 5FXYA 4ZOVA 2I0TA 1O6GA 2VDRA 3MZLA 4O2WA 4UI9R 5EAPA 1QNIA 3RFGA 3F3GA 4FB1D 4O3UB 5M5UA 1UOQA 4QT8A 2HESX 5A2Qg 1N6DA 3I7KA 2IUQA 2AH1A 3I7PA 4D6VA 4GGCA 3UR4A 4A11A 2OJYA 1H2WA 1L5GA 2QR5A 3UVNA 3F3FA 2OK6A 1XIPA 1H2ZA 4R7AB 3JROA 4EWRA 1TBGA 4Y7RA 4O1QD 3KRXB 4NBMA 1TYQC 3JAMg 3RSEC 2CE8A 5M5SA 2P9IC 5IC7A 3KRWB 5FFOA 4BUJC 5EARA 2B5MA 2HU7A 4UM8A 3I8EA 4A11B 4J0XA 5TEEA 3RLMD 4FAVD 5FKRA 4X60B 4N14A 4AX4A 3N0DA 1E8MA 3EWEA 2PM7B 1GOTB 2HKMA 3MKSB 1O6FA 4CY2A 4GGAA 2XDWA 3SCYA 4NC4A 5H14A 2H9LA 4J82A 4NAAA 3MXXA 2P9KC 5KDOB 3A0FA 4OWRA 2CO0A 3EI3A 2I3TA 1L0QA 4QL1A 4FHLA 3ULEC 4QQEA 4BCBA 3OKTA 4G1EA 2G99A 4GM8A 5FKQA 5EM2A 1JOFA 2I3SA 4AN0A 3K26A 2P9LC 2P9NC 1YR2A 2GNQA 2H6NA 3OKYB 1A0RB 3EI1A 1XKSA 3MMYA 4BL0A 3T3PA 4J8BA 4CY1A 3V9FA 2VDKA 1H2XA 5CYKB 1N6EA 3AH8B 4J84A 3F3PA 4D0KA 1N6FA 3DSMA 3ORVD 3UVLA 3OTTA 5H17A 4L1QD 4GMBA 5CXCB 2Z2PA 3UVMA 1UOOA 4LG9A 2OK4A 3V4PA 5HE1B 4JT6C 3EI1B 1K8KC 1BPOA 4QRJA 2Z2NA 5E6SA 5IGQA 2PM9B 4MMZA 4PXWA 2YBAA 5EAMA 5C92A 1PI6A 4J87A 5C9ZB 5I5IA 3IJ0A 1S4UX 4BCDA 1E5TA 3FM0A 3EI4A 2I0SA 1PGUA 5HDBA 3ZDZA 4LG8A 4JHPC 5M5TA 1UTCA 5FA5B 4L9OA 4A2LA 4DNUA 3MUOA 1TYEA 3IJEA 5TF2A 3HFQA 3AL8A 4O9DA 4DNWA 4O3TB 1GP2B 4Z7QA 3E0CA 2XL3A 3IIWA 2CN2A 2XZGA 3MKQA 2W18A 2AGYA 3VI3A 2OVPB 4J86A 3OF7A 3EI2A 5CXBB 2AGZA 5GSAA 3EI4B 4ES0A 5AJAA 3SMRA 2VDMA 4H5IA 2B5NA 2AQ5A 2VDQA 2WQ8A 3ZE1A 4AMZA 5H1MA 3OL2A 2AH0A 2OIZA 5HE0B 4ZOYA 2VC2A 4JSXC 5EMMB 3AL8B 4JSNC 2H47A 3SWSD 4A0BA 2VDOA 3N0EA 2EIEA 4Z8LA 4E5ZB 1PEVA 3VH0A 2HXCA 4CZVA 2B5LA 2H6QA 4ERYA 4A7JA 3IJ1A 2VZ3A 2XE4A 1SQ9A 3FGBA 1P22A 3PXWD 4NSXA 5GMKn 1JV2A 3JPXA 4J8GA 4ERQA 2I0RA 3O4GA 5M61A 2P9SC 3EMHA 3DWLC 2J55H 4A0AA 3SFZA 2H6KA 1VZ2A 4CZYA 4GM9A 5HQGA 2B4EA 5FKSA 3K72A 1OLZA 2AGLA 3V7DB 3OW8A 3J81g 3ZDYA 4LGNA 5HE3B 1XHMA 3PVUB 4A09A 1I2MB 2IUPA 3IKOA 4IA9A 5E6RA 5AMSA 1B9YA 3NVXA 4DNVA 2UZYB 5SXMA 3GC3B 1B9XA 4GGDA 3O4HA 4A08A 5M5VA 3FCUA 2HU5A 4GQ1A 2HYEA 5HE2B 3UVKA 3NVQA 5I5JA 1FWXA 2YB8B 4MK0B 1YFQA 2EIBA 4ZOZA 1UOPA 1K32A 4RE6A 5IGOA 4XYHA 4PNKB 4X3EA 3V4VA 4IMMA 3JZHA 3EI3B 3SLED 2BKLA 3IUNA 4ZOXA 3V5WB 5EALA 4BH6A 4ZN4A 2H68A 3O4IA 4ESGA 2XU7A 2VDNA 5AFU3 4G1MA 5EM2B 1QFMA 3PXSD 3JB9L 4GM3A 3PVWB 4I79A 4AN1A 4HDJA 4RE5A 4L1MA 4L3HD 5B4WA 2IURA 3SVWD 1C9IA 3CFVA 4MMXA 4IRZA 3SBRA 4X63B 4E54A 4G56B 2IWFA 3EU7A 3DDUA 3C99A 3K71A 3IUJA 3C9CA 3J80g 2EBSA 4WK0A 2GC4A 3DM0A 1JMZB 3JZGA 4CY3A 1U8CA 5HYNB 3PE7A 4XEIC 5FKTA 2H9NA 3I89A 4JHNA 5JWZA 3OKWA 3SN6B 2HJBA 2QZPA 3DXKC 3NIDA 2BCJB 1PBYB 2YNNA 1NR0A 3VA6A 4ERZA 3NVNA 4FA4D 3RRMC 4CC9A 4JSVC 4FA1D 5C86A 4J77A 4PSXB 2OVQB 2H9MA 4CI8A 4CI1A 5THAA 4X61B 5FQDA 3I2NA 1ERJA 1MG3A 1QFSA 3EQ8A 1U2VC 3C75H 4O02A 3ZE0A 2Z2OA 1MG2A 4NENA 4D9SA 5IT9g 1OMWB 3VI4A 3I7OA 4J79A 1JJUB 1R5MA 2YNOA 2VZ1A 3KCIA 1SQJA 3I8CA 2CO0C 3RN0D 3MVDK 3AL9A 2IUVA 3EG6A 4O45A 1VE6A 1M1XA 3FRXA 5FFGA 4FA9D 1T2XA 3IUMA 5GXIA 3GD1I 3UKUC 2H14A 2YNPA 3EI2B 4AOWA 1GOFA 4JT5C 5E6UA 4K3JB 2GC7A 3T3MA
chains in the Genus database with same CATH topology
5TDHB 3IIYA 4J73A 4PBZA 2HJ4A 5C2VB 3OL2B 4YVDA 4CZXA 2G9AA 3U4YA 4J81A 4GZ8A 3BWSA 4CY5A 4JSPC 4A0BB 2J56H 3BG0A 4J78A 5EMKB 1SHYB 3I7NA 4PC0A 2OVRB 1JMXB 4A2MA 3VGZA 5IJ8E 2IWKA 3MZKA 2UZXB 2QC5A 2CN3A 2H3XA 3SXTD 4CI2A 5GXHA 3PSLA 2AGWA 2Q7QA 3C5MA 4A0AB 3GFCA 4H5JA 3W15A 4Y5RD 5EMJB 1VYHC 4JXMA 3P4FA 3B7FA 4PSWB 5K19A 3OKYA 1MDAH 4FAND 4A09B 4U1EI 3JRPA 5CYKA 4J0WA 3ZWLB 4GQ2P 5C2WB 2TRCB 4A08B 4U7AA 4PBYA 2IAAA 3CFSB 5CXCA 3PXTD 1Q47A 3K27A 3BG1A 2H13A 5EMLB 2P9PC 1GXRA 4K3ID 4AEZA 2HKRA 2PM9A 3I7HA 2XL2A 4CI3A 5FLXg 3CIKB 1NEXB 2J57G 1U4CA 5IJ7E 4GQBB 4L3GD 2YMUA 3SHFA 5K1CC 2CNXA 2PBIB 2H9PA 2MTAH 5TEFA 2AGXA 3UKRC 2PM6B 3UVOA 1GG2B 3L4MD 3JZNA 3SJLD 3DXMC 3RN1D 3RMZD 3ODTA 3GREA 3SBQA 3RFHA 4E54B 4FA5D 3IJCA 2BBKH 4JD2C 2XYIA 5CXBA 4XYIA 4TZ4A 4KFMB 2P9UC 3SBPA 2QXVA 4FWWA 1RI6A 5I5MA 4OZUA 2CE9A 3PSCB 3AFCA 4E5ZA 2O9KA 3I7LA 3L4OD 5FXYA 4ZOVA 2I0TA 3MZLA 4UI9R 5EAPA 1QNIA 3RFGA 3F3GA 4FB1D 4O3UB 4QT8A 2HESX 5A2Qg 1N6DA 3I7KA 2IUQA 2AH1A 3I7PA 4D6VA 4GGCA 3UR4A 4A11A 2OJYA 3UVNA 3F3FA 2OK6A 1XIPA 4R7AB 3JROA 4EWRA 1TBGA 4Y7RA 4O1QD 3KRXB 1TYQC 3JAMg 3RSEC 2CE8A 2P9IC 5IC7A 3KRWB 4BUJC 5EARA 2B5MA 3I8EA 4A11B 4J0XA 5TEEA 3RLMD 4FAVD 5FKRA 4X60B 4N14A 3N0DA 3EWEA 2PM7B 1GOTB 2HKMA 3MKSB 4CY2A 4GGAA 3SCYA 5H14A 2H9LA 4J82A 3MXXA 2P9KC 5KDOB 3A0FA 4OWRA 2CO0A 3EI3A 2I3TA 1L0QA 4QL1A 4FHLA 3ULEC 4QQEA 3OKTA 2G99A 4GM8A 5FKQA 5EM2A 1JOFA 2I3SA 3K26A 2P9LC 2P9NC 3OKYB 2GNQA 2H6NA 1A0RB 3EI1A 1XKSA 3MMYA 4BL0A 4J8BA 4CY1A 3V9FA 5CYKB 1N6EA 3AH8B 4J84A 3F3PA 4D0KA 1N6FA 3DSMA 3ORVD 3UVLA 3OTTA 5H17A 4L1QD 4GMBA 5CXCB 2Z2PA 3UVMA 4LG9A 2OK4A 5HE1B 4JT6C 3EI1B 1K8KC 4QRJA 2Z2NA 5IGQA 2PM9B 4PXWA 2YBAA 5EAMA 1PI6A 4J87A 5C9ZB 5I5IA 3IJ0A 1S4UX 3FM0A 3EI4A 2I0SA 1PGUA 4LG8A 5FA5B 4L9OA 4A2LA 5TF2A 3HFQA 3AL8A 4O9DA 4O3TB 1GP2B 3E0CA 2XL3A 3IIWA 2CN2A 3MKQA 2W18A 2AGYA 2OVPB 4J86A 3EI2A 5CXBB 2AGZA 5GSAA 3EI4B 4ES0A 5AJAA 3SMRA 4H5IA 2B5NA 2AQ5A 5H1MA 3OL2A 2AH0A 2OIZA 5HE0B 4ZOYA 4JSXC 5EMMB 3AL8B 4JSNC 2H47A 3SWSD 4A0BA 3N0EA 4E5ZB 4Z8LA 3VH0A 1PEVA 2HXCA 4CZVA 2B5LA 2H6QA 4ERYA 4A7JA 3IJ1A 1SQ9A 3FGBA 1P22A 3PXWD 4NSXA 5GMKn 3JPXA 4J8GA 4ERQA 2I0RA 2P9SC 3EMHA 3DWLC 2J55H 4A0AA 3SFZA 2H6KA 4CZYA 4GM9A 5HQGA 2B4EA 5FKSA 1OLZA 2AGLA 3V7DB 3OW8A 3J81g 4LGNA 5HE3B 1XHMA 3PVUB 4A09A 2IUPA 3IKOA 4IA9A 5AMSA 1B9YA 3NVXA 2UZYB 5SXMA 1B9XA 4GGDA 4A08A 4GQ1A 2HYEA 5HE2B 3UVKA 3NVQA 5I5JA 1FWXA 2YB8B 4MK0B 1YFQA 4ZOZA 5IGOA 1K32A 4XYHA 4PNKB 4X3EA 4IMMA 3JZHA 3EI3B 3SLED 4ZOXA 3V5WB 5EALA 4BH6A 4ZN4A 2H68A 4ESGA 2XU7A 5AFU3 5EM2B 3PXSD 3JB9L 4GM3A 3PVWB 4I79A 4HDJA 4L3HD 5B4WA 2IURA 3SVWD 3CFVA 3SBRA 4X63B 4E54A 4G56B 2IWFA 3EU7A 3C99A 3C9CA 3J80g 2EBSA 2GC4A 3DM0A 1JMZB 3JZGA 4CY3A 5HYNB 3PE7A 4XEIC 5FKTA 2H9NA 3I89A 5JWZA 3OKWA 3SN6B 2HJBA 3DXKC 2BCJB 1PBYB 2YNNA 1NR0A 3VA6A 4ERZA 3NVNA 4FA4D 3RRMC 4CC9A 4JSVC 4FA1D 4J77A 4PSXB 2OVQB 2H9MA 4CI8A 4CI1A 5THAA 4X61B 5FQDA 3I2NA 1ERJA 1MG3A 1U2VC 3C75H 2Z2OA 1MG2A 5IT9g 1OMWB 3I7OA 4J79A 1JJUB 1R5MA 2YNOA 1SQJA 3I8CA 2CO0C 3RN0D 3AL9A 2IUVA 3EG6A 4O45A 3FRXA 4FA9D 5GXIA 3UKUC 2H14A 2YNPA 3EI2B 4AOWA 4JT5C 4K3JB 2GC7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TDH B;  3IIY A;  4J73 A;  4PBZ A;  2HJ4 A;  5C2V B;  3OL2 B;  4YVD A;  4CZX A;  2G9A A;  3U4Y A;  4J81 A;  4GZ8 A;  3BWS A;  4CY5 A;  4JSP C;  4A0B B;  2J56 H;  3BG0 A;  4J78 A;  5EMK B;  1SHY B;  3I7N A;  4PC0 A;  2OVR B;  1JMX B;  4A2M A;  3VGZ A;  5IJ8 E;  2IWK A;  3MZK A;  2UZX B;  2QC5 A;  2CN3 A;  2H3X A;  3SXT D;  4CI2 A;  5GXH A;  3PSL A;  2AGW A;  2Q7Q A;  3C5M A;  4A0A B;  3GFC A;  4H5J A;  3W15 A;  4Y5R D;  5EMJ B;  1VYH C;  4JXM A;  3P4F A;  3B7F A;  4PSW B;  5K19 A;  3OKY A;  1MDA H;  4FAN D;  4A09 B;  4U1E I;  3JRP A;  5CYK A;  4J0W A;  3ZWL B;  4GQ2 P;  5C2W B;  2TRC B;  4A08 B;  4U7A A;  4PBY A;  2IAA A;  3CFS B;  5CXC A;  3PXT D;  1Q47 A;  3K27 A;  3BG1 A;  2H13 A;  5EML B;  2P9P C;  1GXR A;  4K3I D;  4AEZ A;  2HKR A;  2PM9 A;  3I7H A;  2XL2 A;  4CI3 A;  5FLX g;  3CIK B;  1NEX B;  2J57 G;  1U4C A;  5IJ7 E;  4GQB B;  4L3G D;  2YMU A;  3SHF A;  5K1C C;  2CNX A;  2PBI B;  2H9P A;  2MTA H;  5TEF A;  2AGX A;  3UKR C;  2PM6 B;  3UVO A;  1GG2 B;  3L4M D;  3JZN A;  3SJL D;  3DXM C;  3RN1 D;  3RMZ D;  3ODT A;  3GRE A;  3SBQ A;  3RFH A;  4E54 B;  4FA5 D;  3IJC A;  2BBK H;  4JD2 C;  2XYI A;  5CXB A;  4XYI A;  4TZ4 A;  4KFM B;  2P9U C;  3SBP A;  2QXV A;  4FWW A;  1RI6 A;  5I5M A;  4OZU A;  2CE9 A;  3PSC B;  3AFC A;  4E5Z A;  2O9K A;  3I7L A;  3L4O D;  5FXY A;  4ZOV A;  2I0T A;  3MZL A;  4UI9 R;  5EAP A;  1QNI A;  3RFG A;  3F3G A;  4FB1 D;  4O3U B;  4QT8 A;  2HES X;  5A2Q g;  1N6D A;  3I7K A;  2IUQ A;  2AH1 A;  3I7P A;  4D6V A;  4GGC A;  3UR4 A;  4A11 A;  2OJY A;  3UVN A;  3F3F A;  2OK6 A;  1XIP A;  4R7A B;  3JRO A;  4EWR A;  1TBG A;  4Y7R A;  4O1Q D;  3KRX B;  1TYQ C;  3JAM g;  3RSE C;  2CE8 A;  2P9I C;  5IC7 A;  3KRW B;  4BUJ C;  5EAR A;  2B5M A;  3I8E A;  4A11 B;  4J0X A;  5TEE A;  3RLM D;  4FAV D;  5FKR A;  4X60 B;  4N14 A;  3N0D A;  3EWE A;  2PM7 B;  1GOT B;  2HKM A;  3MKS B;  4CY2 A;  4GGA A;  3SCY A;  5H14 A;  2H9L A;  4J82 A;  3MXX A;  2P9K C;  5KDO B;  3A0F A;  4OWR A;  2CO0 A;  3EI3 A;  2I3T A;  1L0Q A;  4QL1 A;  4FHL A;  3ULE C;  4QQE A;  3OKT A;  2G99 A;  4GM8 A;  5FKQ A;  5EM2 A;  1JOF A;  2I3S A;  3K26 A;  2P9L C;  2P9N C;  3OKY B;  2GNQ A;  2H6N A;  1A0R B;  3EI1 A;  1XKS A;  3MMY A;  4BL0 A;  4J8B A;  4CY1 A;  3V9F A;  5CYK B;  1N6E A;  3AH8 B;  4J84 A;  3F3P A;  4D0K A;  1N6F A;  3DSM A;  3ORV D;  3UVL A;  3OTT A;  5H17 A;  4L1Q D;  4GMB A;  5CXC B;  2Z2P A;  3UVM A;  4LG9 A;  2OK4 A;  5HE1 B;  4JT6 C;  3EI1 B;  1K8K C;  4QRJ A;  2Z2N A;  5IGQ A;  2PM9 B;  4PXW A;  2YBA A;  5EAM A;  1PI6 A;  4J87 A;  5C9Z B;  5I5I A;  3IJ0 A;  1S4U X;  3FM0 A;  3EI4 A;  2I0S A;  1PGU A;  4LG8 A;  5FA5 B;  4L9O A;  4A2L A;  5TF2 A;  3HFQ A;  3AL8 A;  4O9D A;  4O3T B;  1GP2 B;  3E0C A;  2XL3 A;  3IIW A;  2CN2 A;  3MKQ A;  2W18 A;  2AGY A;  2OVP B;  4J86 A;  3EI2 A;  5CXB B;  2AGZ A;  5GSA A;  3EI4 B;  4ES0 A;  5AJA A;  3SMR A;  4H5I A;  2B5N A;  2AQ5 A;  5H1M A;  3OL2 A;  2AH0 A;  2OIZ A;  5HE0 B;  4ZOY A;  4JSX C;  5EMM B;  3AL8 B;  4JSN C;  2H47 A;  3SWS D;  4A0B A;  3N0E A;  4E5Z B;  4Z8L A;  3VH0 A;  1PEV A;  2HXC A;  4CZV A;  2B5L A;  2H6Q A;  4ERY A;  4A7J A;  3IJ1 A;  1SQ9 A;  3FGB A;  1P22 A;  3PXW D;  4NSX A;  5GMK n;  3JPX A;  4J8G A;  4ERQ A;  2I0R A;  2P9S C;  3EMH A;  3DWL C;  2J55 H;  4A0A A;  3SFZ A;  2H6K A;  4CZY A;  4GM9 A;  5HQG A;  2B4E A;  5FKS A;  1OLZ A;  2AGL A;  3V7D B;  3OW8 A;  3J81 g;  4LGN A;  5HE3 B;  1XHM A;  3PVU B;  4A09 A;  2IUP A;  3IKO A;  4IA9 A;  5AMS A;  1B9Y A;  3NVX A;  2UZY B;  5SXM A;  1B9X A;  4GGD A;  4A08 A;  4GQ1 A;  2HYE A;  5HE2 B;  3UVK A;  3NVQ A;  5I5J A;  1FWX A;  2YB8 B;  4MK0 B;  1YFQ A;  4ZOZ A;  5IGO A;  1K32 A;  4XYH A;  4PNK B;  4X3E A;  4IMM A;  3JZH A;  3EI3 B;  3SLE D;  4ZOX A;  3V5W B;  5EAL A;  4BH6 A;  4ZN4 A;  2H68 A;  4ESG A;  2XU7 A;  5AFU 3;  5EM2 B;  3PXS D;  3JB9 L;  4GM3 A;  3PVW B;  4I79 A;  4HDJ A;  4L3H D;  5B4W A;  2IUR A;  3SVW D;  3CFV A;  3SBR A;  4X63 B;  4E54 A;  4G56 B;  2IWF A;  3EU7 A;  3C99 A;  3C9C A;  3J80 g;  2EBS A;  2GC4 A;  3DM0 A;  1JMZ B;  3JZG A;  4CY3 A;  5HYN B;  3PE7 A;  4XEI C;  5FKT A;  2H9N A;  3I89 A;  5JWZ A;  3OKW A;  3SN6 B;  2HJB A;  3DXK C;  2BCJ B;  1PBY B;  2YNN A;  1NR0 A;  3VA6 A;  4ERZ A;  3NVN A;  4FA4 D;  3RRM C;  4CC9 A;  4JSV C;  4FA1 D;  4J77 A;  4PSX B;  2OVQ B;  2H9M A;  4CI8 A;  4CI1 A;  5THA A;  4X61 B;  5FQD A;  3I2N A;  1ERJ A;  1MG3 A;  1U2V C;  3C75 H;  2Z2O A;  1MG2 A;  5IT9 g;  1OMW B;  3I7O A;  4J79 A;  1JJU B;  1R5M A;  2YNO A;  1SQJ A;  3I8C A;  2CO0 C;  3RN0 D;  3AL9 A;  2IUV A;  3EG6 A;  4O45 A;  3FRX A;  4FA9 D;  5GXI A;  3UKU C;  2H14 A;  2YNP A;  3EI2 B;  4AOW A;  4JT5 C;  4K3J B;  2GC7 A; 
#chains in the Genus database with same CATH topology
 5TDH B;  3IIY A;  4G55 A;  4J73 A;  4PBZ A;  2HJ4 A;  5C2V B;  3OL2 B;  4MMY A;  4YVD A;  4CZX A;  2G9A A;  3IUR A;  3U4Y A;  4J81 A;  4GZ8 A;  3BWS A;  4CY5 A;  4JSP C;  4WK2 A;  4A0B B;  2J56 H;  3BG0 A;  4J78 A;  3QI0 A;  1GOH A;  5EMK B;  1SHY B;  3I7N A;  4PC0 A;  2OVR B;  3ZE2 A;  2EIC A;  1JMX B;  4A2M A;  3VGZ A;  5IJ8 E;  5M5R A;  2IWK A;  3MZK A;  2UZX B;  2QC5 A;  3EQ9 A;  1E8N A;  2JKX A;  1C9L A;  2CN3 A;  3IUQ A;  2H3X A;  3SXT D;  4CI2 A;  5GXH A;  3PSL A;  2AGW A;  2Q7Q A;  3C5M A;  4A0A B;  3GFC A;  4H5J A;  3W15 A;  4BP9 A;  4Y5R D;  2VDP A;  5EMJ B;  1VYH C;  3QHY B;  2VDL A;  4JXM A;  3P4F A;  3B7F A;  4PSW B;  5K19 A;  4WJK A;  3OKY A;  1MDA H;  3NIF A;  4FAN D;  3IVM A;  4A09 B;  4U1E I;  3ZDX A;  3JRP A;  5CYK A;  4J0W A;  3ZWL B;  4AMY A;  1VZ3 A;  4GQ2 P;  5C2W B;  2EID A;  4UM9 A;  2TRC B;  4A08 B;  4U7A A;  4PBY A;  1K3I A;  2IAA A;  3CFS B;  5CXC A;  1JTD B;  3PXT D;  3O4J A;  1Q47 A;  3K27 A;  3BG1 A;  2H13 A;  5EML B;  2P9P C;  1GXR A;  4K3I D;  4QAM A;  4AEZ A;  2HKR A;  2PM9 A;  3I7H A;  2XL2 A;  4CI3 A;  5FLX g;  3CIK B;  1NEX B;  2J57 G;  1U4C A;  3MUN A;  5IJ7 E;  4Z7N A;  4GQB B;  4L3G D;  3EQ7 A;  2YMU A;  3SHF A;  1H2Y A;  5K1C C;  2CNX A;  2PBI B;  2H9P A;  2MTA H;  5TEF A;  2AGX A;  3NIG A;  2PM6 B;  3UKR C;  3UVO A;  1GG2 B;  3L4M D;  3JZN A;  3SJL D;  3K6S A;  3DXM C;  3RN1 D;  3RMZ D;  3ODT A;  3FCS A;  3GRE A;  1GOG A;  3SBQ A;  3RFH A;  4E54 B;  4FA5 D;  4WK4 A;  3IJC A;  4BCC A;  2BBK H;  4JD2 C;  2XYI A;  5CXB A;  4XYI A;  4TZ4 A;  4KFM B;  2P9U C;  4Z7O A;  3SBP A;  2QXV A;  4FWW A;  1RI6 A;  5I5M A;  4OZU A;  1VE7 A;  2CE9 A;  3PSC B;  3IUL A;  3AFC A;  1A12 A;  2HU8 A;  4E5Z A;  4BP8 A;  2O9K A;  3I7L A;  3L4O D;  5FXY A;  4ZOV A;  2I0T A;  1O6G A;  2VDR A;  3MZL A;  4O2W A;  4UI9 R;  5EAP A;  1QNI A;  3RFG A;  3F3G A;  4FB1 D;  4O3U B;  5M5U A;  1UOQ A;  4QT8 A;  2HES X;  5A2Q g;  1N6D A;  3I7K A;  2IUQ A;  2AH1 A;  3I7P A;  4D6V A;  4GGC A;  3UR4 A;  4A11 A;  2OJY A;  1H2W A;  1L5G A;  2QR5 A;  3UVN A;  3F3F A;  2OK6 A;  1XIP A;  1H2Z A;  4R7A B;  3JRO A;  4EWR A;  1TBG A;  4Y7R A;  4O1Q D;  3KRX B;  4NBM A;  1TYQ C;  3JAM g;  3RSE C;  2CE8 A;  5M5S A;  2P9I C;  5IC7 A;  3KRW B;  5FFO A;  4BUJ C;  5EAR A;  2B5M A;  2HU7 A;  4UM8 A;  3I8E A;  4A11 B;  4J0X A;  5TEE A;  3RLM D;  4FAV D;  5FKR A;  4X60 B;  4N14 A;  4AX4 A;  3N0D A;  1E8M A;  3EWE A;  2PM7 B;  1GOT B;  2HKM A;  3MKS B;  1O6F A;  4CY2 A;  4GGA A;  2XDW A;  3SCY A;  4NC4 A;  5H14 A;  2H9L A;  4J82 A;  4NAA A;  3MXX A;  2P9K C;  5KDO B;  3A0F A;  4OWR A;  2CO0 A;  3EI3 A;  2I3T A;  1L0Q A;  4QL1 A;  4FHL A;  3ULE C;  4QQE A;  4BCB A;  3OKT A;  4G1E A;  2G99 A;  4GM8 A;  5FKQ A;  5EM2 A;  1JOF A;  2I3S A;  4AN0 A;  3K26 A;  2P9L C;  2P9N C;  1YR2 A;  2GNQ A;  2H6N A;  3OKY B;  1A0R B;  3EI1 A;  1XKS A;  3MMY A;  4BL0 A;  3T3P A;  4J8B A;  4CY1 A;  3V9F A;  2VDK A;  1H2X A;  5CYK B;  1N6E A;  3AH8 B;  4J84 A;  3F3P A;  4D0K A;  1N6F A;  3DSM A;  3ORV D;  3UVL A;  3OTT A;  5H17 A;  4L1Q D;  4GMB A;  5CXC B;  2Z2P A;  3UVM A;  1UOO A;  4LG9 A;  2OK4 A;  3V4P A;  5HE1 B;  4JT6 C;  3EI1 B;  1K8K C;  1BPO A;  4QRJ A;  2Z2N A;  5E6S A;  5IGQ A;  2PM9 B;  4MMZ A;  4PXW A;  2YBA A;  5EAM A;  5C92 A;  1PI6 A;  4J87 A;  5C9Z B;  5I5I A;  3IJ0 A;  1S4U X;  4BCD A;  1E5T A;  3FM0 A;  3EI4 A;  2I0S A;  1PGU A;  5HDB A;  3ZDZ A;  4LG8 A;  4JHP C;  5M5T A;  1UTC A;  5FA5 B;  4L9O A;  4A2L A;  4DNU A;  3MUO A;  1TYE A;  3IJE A;  5TF2 A;  3HFQ A;  3AL8 A;  4O9D A;  4DNW A;  4O3T B;  1GP2 B;  4Z7Q A;  3E0C A;  2XL3 A;  3IIW A;  2CN2 A;  2XZG A;  3MKQ A;  2W18 A;  2AGY A;  3VI3 A;  2OVP B;  4J86 A;  3OF7 A;  3EI2 A;  5CXB B;  2AGZ A;  5GSA A;  3EI4 B;  4ES0 A;  5AJA A;  3SMR A;  2VDM A;  4H5I A;  2B5N A;  2AQ5 A;  2VDQ A;  2WQ8 A;  3ZE1 A;  4AMZ A;  5H1M A;  3OL2 A;  2AH0 A;  2OIZ A;  5HE0 B;  4ZOY A;  2VC2 A;  4JSX C;  5EMM B;  3AL8 B;  4JSN C;  2H47 A;  3SWS D;  4A0B A;  2VDO A;  3N0E A;  2EIE A;  4Z8L A;  4E5Z B;  1PEV A;  3VH0 A;  2HXC A;  4CZV A;  2B5L A;  2H6Q A;  4ERY A;  4A7J A;  3IJ1 A;  2VZ3 A;  2XE4 A;  1SQ9 A;  3FGB A;  1P22 A;  3PXW D;  4NSX A;  5GMK n;  1JV2 A;  3JPX A;  4J8G A;  4ERQ A;  2I0R A;  3O4G A;  5M61 A;  2P9S C;  3EMH A;  3DWL C;  2J55 H;  4A0A A;  3SFZ A;  2H6K A;  1VZ2 A;  4CZY A;  4GM9 A;  5HQG A;  2B4E A;  5FKS A;  3K72 A;  1OLZ A;  2AGL A;  3V7D B;  3OW8 A;  3J81 g;  3ZDY A;  4LGN A;  5HE3 B;  1XHM A;  3PVU B;  4A09 A;  1I2M B;  2IUP A;  3IKO A;  4IA9 A;  5E6R A;  5AMS A;  1B9Y A;  3NVX A;  4DNV A;  2UZY B;  5SXM A;  3GC3 B;  1B9X A;  4GGD A;  3O4H A;  4A08 A;  5M5V A;  3FCU A;  2HU5 A;  4GQ1 A;  2HYE A;  5HE2 B;  3UVK A;  3NVQ A;  5I5J A;  1FWX A;  2YB8 B;  4MK0 B;  1YFQ A;  2EIB A;  4ZOZ A;  1UOP A;  1K32 A;  4RE6 A;  5IGO A;  4XYH A;  4PNK B;  4X3E A;  3V4V A;  4IMM A;  3JZH A;  3EI3 B;  3SLE D;  2BKL A;  3IUN A;  4ZOX A;  3V5W B;  5EAL A;  4BH6 A;  4ZN4 A;  2H68 A;  3O4I A;  4ESG A;  2XU7 A;  2VDN A;  5AFU 3;  4G1M A;  5EM2 B;  1QFM A;  3PXS D;  3JB9 L;  4GM3 A;  3PVW B;  4I79 A;  4AN1 A;  4HDJ A;  4RE5 A;  4L1M A;  4L3H D;  5B4W A;  2IUR A;  3SVW D;  1C9I A;  3CFV A;  4MMX A;  4IRZ A;  3SBR A;  4X63 B;  4E54 A;  4G56 B;  2IWF A;  3EU7 A;  3DDU A;  3C99 A;  3K71 A;  3IUJ A;  3C9C A;  3J80 g;  2EBS A;  4WK0 A;  2GC4 A;  3DM0 A;  1JMZ B;  3JZG A;  4CY3 A;  1U8C A;  5HYN B;  3PE7 A;  4XEI C;  5FKT A;  2H9N A;  3I89 A;  4JHN A;  5JWZ A;  3OKW A;  3SN6 B;  2HJB A;  2QZP A;  3DXK C;  3NID A;  2BCJ B;  1PBY B;  2YNN A;  1NR0 A;  3VA6 A;  4ERZ A;  3NVN A;  4FA4 D;  3RRM C;  4CC9 A;  4JSV C;  4FA1 D;  5C86 A;  4J77 A;  4PSX B;  2OVQ B;  2H9M A;  4CI8 A;  4CI1 A;  5THA A;  4X61 B;  5FQD A;  3I2N A;  1ERJ A;  1MG3 A;  1QFS A;  3EQ8 A;  1U2V C;  3C75 H;  4O02 A;  3ZE0 A;  2Z2O A;  1MG2 A;  4NEN A;  4D9S A;  5IT9 g;  1OMW B;  3VI4 A;  3I7O A;  4J79 A;  1JJU B;  1R5M A;  2YNO A;  2VZ1 A;  3KCI A;  1SQJ A;  3I8C A;  2CO0 C;  3RN0 D;  3MVD K;  3AL9 A;  2IUV A;  3EG6 A;  4O45 A;  1VE6 A;  1M1X A;  3FRX A;  5FFG A;  4FA9 D;  1T2X A;  3IUM A;  5GXI A;  3GD1 I;  3UKU C;  2H14 A;  2YNP A;  3EI2 B;  4AOW A;  1GOF A;  4JT5 C;  5E6U A;  4K3J B;  2GC7 A;  3T3M A; 
#chains in the Genus database with same CATH homology
 5TDH B;  3IIY A;  4J73 A;  4PBZ A;  2HJ4 A;  5C2V B;  3OL2 B;  4YVD A;  4CZX A;  2G9A A;  3U4Y A;  4J81 A;  4GZ8 A;  3BWS A;  4CY5 A;  4JSP C;  4A0B B;  2J56 H;  3BG0 A;  4J78 A;  5EMK B;  1SHY B;  3I7N A;  4PC0 A;  2OVR B;  1JMX B;  4A2M A;  3VGZ A;  5IJ8 E;  2IWK A;  3MZK A;  2UZX B;  2QC5 A;  2CN3 A;  2H3X A;  3SXT D;  4CI2 A;  5GXH A;  3PSL A;  2AGW A;  2Q7Q A;  3C5M A;  4A0A B;  3GFC A;  4H5J A;  3W15 A;  4Y5R D;  5EMJ B;  1VYH C;  4JXM A;  3P4F A;  3B7F A;  4PSW B;  5K19 A;  3OKY A;  1MDA H;  4FAN D;  4A09 B;  4U1E I;  3JRP A;  5CYK A;  4J0W A;  3ZWL B;  4GQ2 P;  5C2W B;  2TRC B;  4A08 B;  4U7A A;  4PBY A;  2IAA A;  3CFS B;  5CXC A;  3PXT D;  1Q47 A;  3K27 A;  3BG1 A;  2H13 A;  5EML B;  2P9P C;  1GXR A;  4K3I D;  4AEZ A;  2HKR A;  2PM9 A;  3I7H A;  2XL2 A;  4CI3 A;  5FLX g;  3CIK B;  1NEX B;  2J57 G;  1U4C A;  5IJ7 E;  4GQB B;  4L3G D;  2YMU A;  3SHF A;  5K1C C;  2CNX A;  2PBI B;  2H9P A;  2MTA H;  5TEF A;  2AGX A;  3UKR C;  2PM6 B;  3UVO A;  1GG2 B;  3L4M D;  3JZN A;  3SJL D;  3DXM C;  3RN1 D;  3RMZ D;  3ODT A;  3GRE A;  3SBQ A;  3RFH A;  4E54 B;  4FA5 D;  3IJC A;  2BBK H;  4JD2 C;  2XYI A;  5CXB A;  4XYI A;  4TZ4 A;  4KFM B;  2P9U C;  3SBP A;  2QXV A;  4FWW A;  1RI6 A;  5I5M A;  4OZU A;  2CE9 A;  3PSC B;  3AFC A;  4E5Z A;  2O9K A;  3I7L A;  3L4O D;  5FXY A;  4ZOV A;  2I0T A;  3MZL A;  4UI9 R;  5EAP A;  1QNI A;  3RFG A;  3F3G A;  4FB1 D;  4O3U B;  4QT8 A;  2HES X;  5A2Q g;  1N6D A;  3I7K A;  2IUQ A;  2AH1 A;  3I7P A;  4D6V A;  4GGC A;  3UR4 A;  4A11 A;  2OJY A;  3UVN A;  3F3F A;  2OK6 A;  1XIP A;  4R7A B;  3JRO A;  4EWR A;  1TBG A;  4Y7R A;  4O1Q D;  3KRX B;  1TYQ C;  3JAM g;  3RSE C;  2CE8 A;  2P9I C;  5IC7 A;  3KRW B;  4BUJ C;  5EAR A;  2B5M A;  3I8E A;  4A11 B;  4J0X A;  5TEE A;  3RLM D;  4FAV D;  5FKR A;  4X60 B;  4N14 A;  3N0D A;  3EWE A;  2PM7 B;  1GOT B;  2HKM A;  3MKS B;  4CY2 A;  4GGA A;  3SCY A;  5H14 A;  2H9L A;  4J82 A;  3MXX A;  2P9K C;  5KDO B;  3A0F A;  4OWR A;  2CO0 A;  3EI3 A;  2I3T A;  1L0Q A;  4QL1 A;  4FHL A;  3ULE C;  4QQE A;  3OKT A;  2G99 A;  4GM8 A;  5FKQ A;  5EM2 A;  1JOF A;  2I3S A;  3K26 A;  2P9L C;  2P9N C;  3OKY B;  2GNQ A;  2H6N A;  1A0R B;  3EI1 A;  1XKS A;  3MMY A;  4BL0 A;  4J8B A;  4CY1 A;  3V9F A;  5CYK B;  1N6E A;  3AH8 B;  4J84 A;  3F3P A;  4D0K A;  1N6F A;  3DSM A;  3ORV D;  3UVL A;  3OTT A;  5H17 A;  4L1Q D;  4GMB A;  5CXC B;  2Z2P A;  3UVM A;  4LG9 A;  2OK4 A;  5HE1 B;  4JT6 C;  3EI1 B;  1K8K C;  4QRJ A;  2Z2N A;  5IGQ A;  2PM9 B;  4PXW A;  2YBA A;  5EAM A;  1PI6 A;  4J87 A;  5C9Z B;  5I5I A;  3IJ0 A;  1S4U X;  3FM0 A;  3EI4 A;  2I0S A;  1PGU A;  4LG8 A;  5FA5 B;  4L9O A;  4A2L A;  5TF2 A;  3HFQ A;  3AL8 A;  4O9D A;  4O3T B;  1GP2 B;  3E0C A;  2XL3 A;  3IIW A;  2CN2 A;  3MKQ A;  2W18 A;  2AGY A;  2OVP B;  4J86 A;  3EI2 A;  5CXB B;  2AGZ A;  5GSA A;  3EI4 B;  4ES0 A;  5AJA A;  3SMR A;  4H5I A;  2B5N A;  2AQ5 A;  5H1M A;  3OL2 A;  2AH0 A;  2OIZ A;  5HE0 B;  4ZOY A;  4JSX C;  5EMM B;  3AL8 B;  4JSN C;  2H47 A;  3SWS D;  4A0B A;  3N0E A;  4E5Z B;  4Z8L A;  3VH0 A;  1PEV A;  2HXC A;  4CZV A;  2B5L A;  2H6Q A;  4ERY A;  4A7J A;  3IJ1 A;  1SQ9 A;  3FGB A;  1P22 A;  3PXW D;  4NSX A;  5GMK n;  3JPX A;  4J8G A;  4ERQ A;  2I0R A;  2P9S C;  3EMH A;  3DWL C;  2J55 H;  4A0A A;  3SFZ A;  2H6K A;  4CZY A;  4GM9 A;  5HQG A;  2B4E A;  5FKS A;  1OLZ A;  2AGL A;  3V7D B;  3OW8 A;  3J81 g;  4LGN A;  5HE3 B;  1XHM A;  3PVU B;  4A09 A;  2IUP A;  3IKO A;  4IA9 A;  5AMS A;  1B9Y A;  3NVX A;  2UZY B;  5SXM A;  1B9X A;  4GGD A;  4A08 A;  4GQ1 A;  2HYE A;  5HE2 B;  3UVK A;  3NVQ A;  5I5J A;  1FWX A;  2YB8 B;  4MK0 B;  1YFQ A;  4ZOZ A;  5IGO A;  1K32 A;  4XYH A;  4PNK B;  4X3E A;  4IMM A;  3JZH A;  3EI3 B;  3SLE D;  4ZOX A;  3V5W B;  5EAL A;  4BH6 A;  4ZN4 A;  2H68 A;  4ESG A;  2XU7 A;  5AFU 3;  5EM2 B;  3PXS D;  3JB9 L;  4GM3 A;  3PVW B;  4I79 A;  4HDJ A;  4L3H D;  5B4W A;  2IUR A;  3SVW D;  3CFV A;  3SBR A;  4X63 B;  4E54 A;  4G56 B;  2IWF A;  3EU7 A;  3C99 A;  3C9C A;  3J80 g;  2EBS A;  2GC4 A;  3DM0 A;  1JMZ B;  3JZG A;  4CY3 A;  5HYN B;  3PE7 A;  4XEI C;  5FKT A;  2H9N A;  3I89 A;  5JWZ A;  3OKW A;  3SN6 B;  2HJB A;  3DXK C;  2BCJ B;  1PBY B;  2YNN A;  1NR0 A;  3VA6 A;  4ERZ A;  3NVN A;  4FA4 D;  3RRM C;  4CC9 A;  4JSV C;  4FA1 D;  4J77 A;  4PSX B;  2OVQ B;  2H9M A;  4CI8 A;  4CI1 A;  5THA A;  4X61 B;  5FQD A;  3I2N A;  1ERJ A;  1MG3 A;  1U2V C;  3C75 H;  2Z2O A;  1MG2 A;  5IT9 g;  1OMW B;  3I7O A;  4J79 A;  1JJU B;  1R5M A;  2YNO A;  1SQJ A;  3I8C A;  2CO0 C;  3RN0 D;  3AL9 A;  2IUV A;  3EG6 A;  4O45 A;  3FRX A;  4FA9 D;  5GXI A;  3UKU C;  2H14 A;  2YNP A;  3EI2 B;  4AOW A;  4JT5 C;  4K3J B;  2GC7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...