3SBRA

Pseudomonas stutzeri nitrous oxide reductase, p1 crystal form with substrate
Total Genus 174
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
174
sequence length
581
structure length
581
Chain Sequence
QKIHVGPGELDDYYGFWSGGHQGEVRVLGVPSMRELMRIPVFNVDSATGWGLTNESRHIMGDSAKFLNGDCHHPHISMTDGKYDGKYLFINDKANSRVARIRLDIMKCDKMITVPNVQAIHGLRLQKVPHTKYVFANAEFIIPHPNDGKVFDLQDENSYTMYNAIDAETMEMAFQVIVDGNLDNTDADYTGRFAAATCYNSEKAFDLGGMMRNERDWVVVFDIHAVEAAVKAGDFITLGDSKTPVLDGRKKDGKDSKFTRYVPVPKNPHGCNTSSDGKYFIAAGKLSPTCSMIAIDKLPDLFAGKLADPRDVIVGEPELGLGPLHTTFDGRGNAYTTLFIDSQVVKWNMEEAVRAYKGEKVNYIKQKLDVHYQPGHLHASLCETNEADGKWLVALSKFSKDRFLPVGPLHPENDQLIDISGDEMKLVHDGPTFAEPHDCIMARRDQIKTKKIWDRNDPFFAPTVEMAKKDGINLDTDNKVIRDGNKVRVYMTSMAPAFGVQEFTVKQGDEVTVTITNIDQIEDVSHGFVVVNHGVSMEISPQQTSSITFVADKPGLHWYYCSWFCHALHMEMVGRMMVEPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title N2O binding at a [4Cu:2S] copper-sulphur cluster in nitrous oxide reductase.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Nitrous-oxide reductase
total genus 174
structure length 581
sequence length 581
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.7.2.4: Nitrous-oxide reductase.
pdb deposition date 2011-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
A PF18764 nos_propeller Nitrous oxide reductase propeller repeat
A PF18793 nos_propeller_2 Nitrous oxide reductase propeller repeat 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3sbrA02
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3sbrA01
3WNIA 2OCCB 2PP9A 4ENZA 4JXMA 1JZJA 3L45A 2I7OA 1ILUA 3H4HA 3NYKA 2H47C 5B1KA 3GDCA 3OKWA 5EAMA 3AG4B 4QLWA 2XYIA 5EM2A 5TK4A 2YAPA 3X1GA 4CC9A 2YNPA 3S3CB 5A7EA 4CI1A 1YLBB 2PLTA 4GGCA 3T6ZA 3NJIA 2YAMA 4KOCA 4F2EA 4AZUA 1JMZB 2XV3A 1OCCB 4J73A 3C99A 4AEZA 1W8EA 1RI6A 2HLEB 4KNSA 1NICA 1IKOP 2XLLA 3FS9A 4HHWA 4M4RB 4E9VA 5I28A 3TA4D 2LLNA 1PCSA 3ORVD 4DP1X 4ERZA 4J87A 3EH3B 3UVMA 4TXVB 3PVUB 1SHXA 3SBRA 1PLAA 1MDAH 4JSNC 3EI4B 3ZX1A 4W1TA 3QPKA 2X88A 3S8FB 1GW0A 4KOBA 3T6WA 2CBPA 1PLBA 1PMYA 3TBCA 1XKSA 4CI2A 4GZ8A 2I7SA 2XX0A 2XXGA 2P9IC 1IUZA 2YAOA 4ZOYA 4E5ZA 3MKQA 2QT6A 1KV7A 3F3FA 5CXBB 2YAQA 2AH0A 3OKYA 2VSMB 2BP0B 1L9SA 2BP8A 2W8CA 2YNNA 1XIPA 3FSAA 3NSDA 4PAZA 3EH4B 2O9KA 3UR4A 3I89A 3NVXA 3SXTD 3FPYA 4QT8A 3X1EA 2CN2A 1N6DA 1W6WA 2GBAA 3QJVB 1NZRA 4BXVA 3IJ1A 5I5IA 3PSLA 5IT9g 1NPJA 1CURA 1SF5A 3RN1D 2JXMA 2AFNA 2RACA 3DKHA 1CC3A 1JZGA 2XWZA 3IE9A 3QQXA 1U4CA 2HJBA 1TEGA 4DP4X 2MTAH 4ZOZA 5H17A 3S8GB 1PZCA 3ABLB 1M57B 2HX8A 4ZN4A 3ABKB 4ZOXA 4IMMA 4E9RA 4A08B 5IJ7E 5I26A 1AACA 4NSXA 4CSZA 5AFAA 2EBSA 4MFHA 2AGWA 2IWEA 3ZBMA 1OE3A 2AVFA 2XUWA 4GQBB 3PXWD 4AOWA 5I5JA 4AKPA 3SLED 2PM6B 4GMBA 2B5LA 4LG9A 1HAUA 4Y7RA 4YVNA 1JOFA 2BWDA 2YNOA 3OMNB 3IKOA 3MZKA 2PCFA 1SNRA 2ZOOA 4A2HA 2OVQB 1NINA 3MX0B 3CFSB 5HE0B 5D4HA 2VN3A 4P5SA 2XU9A 1EZLA 4WKXA 4DP5X 4X61B 4AKOA 2IDUA 4E9YA 2QXVA 5C9ZB 1L9OA 1WS7A 1JZFA 4YSOA 5E9NA 3I7PA 3J81g 1JZHA 1MDAA 3BG0A 1P22A 4BDVA 5CYKA 2HZHA 3EI4A 4HCFA 5IGOA 1MG2C 1M56B 2CJ3A 3NJLA 3WIAA 1AG6A 4YSQA 3NJHA 2UZXB 1TEFA 3WG7B 1GG2B 2XU7A 3IN2A 3MXXA 2VW6A 4PSWB 4PXWA 2I85A 4DPCX 1L9TA 5CXBA 3ULEC 2VM3A 4KO9A 3FQ1A 4YVUA 3JAMg 4WTQA 4DP8X 1AOZA 2HRHA 1MG3A 5I6OA 3QJQB 2OV0A 2QPEB 1OCZB 1AZCA 2B3IA 2N0MA 4GP5B 2CNXA 1PF3A 2HKRA 1PBYB 4JSVC 3RRMC 4QQEA 3RFHA 4L3HD 4MK0B 1ILSA 1U2VC 5AJAA 4O45A 4PBZA 2BW4A 2FQGA 2VW4A 8PAZA 3DWLC 4GP8B 1KGYE 3AW5A 3EMHA 5I5MA 2GIMA 4J81A 4X3EA 4L1QD 4X63B 4IA9A 2AGYA 3EI1A 3WKPA 2VM4A 1AZRA 4KO5A 5EALA 4N4YB 2AANA 2G99A 2JFCA 2YXWA 1PZAA 4HIPA 3L4OD 3NVNA 2BWIA 1DZ0A 5IJ8E 4YSCA 2AZUA 4PC0A 4FA5D 1XHMA 2QPDB 1HAWA 3NJJA 3SWSD 2H5UA 4ES0A 3AL8B 4GM3A 1OOWA 4L9OA 5FXYA 4D6VA 2PP8A 3RSEC 1ERJA 2QC5A 5PAZA 3RMZD 1XB3A 1NIBA 4K9JA 5B1AB 5C2VB 2GHZA 3JTBA 4YSUA 5HYNB 1OV8A 2GI0A 2EIMB 1ZIAA 4DPAX 1V54B 1XB8A 3E0CA 3UVKA 3IN0A 4CZXA 4YSPA 5FKSA 1NTDA 4FHLA 4A11B 2BHFA 2MRYA 1BQ5A 2P80D 1R1CA 1E5ZA 4KNTA 4UAHA 2OVPB 4BL0A 2PPDA 3FSZA 5B1BB 1SQ9A 4XEIC 3KRXB 1X9RA 2YAFA 3BQVA 2H3XA 3V9FA 1L9PA 4E54B 2UXGA 5K1CC 4FA4D 3GYRA 1N68A 2W18A 3JZHA 1GY2A 3BG1A 2Z2PA 4LG8A 1ZV2A 2HESX 5B1JC 1B9XA 4PCYA 1OLZA 3OKYB 2YAHA 1ASPA 2P9SC 4A66A 2P9NC 3F3PA 1FFTB 1A8ZA 4CI3A 4J0WA 4JT5C 3X1NA 1ET7A 5FKRA 4PBYA 1AS8A 1EHKB 3QJTB 4HCIA 2DWTA 2B5MA 9PCYA 4G7QB 1KBWA 4W9ZA 3IIYA 2GSMB 1GXRA 1SHWA 4GM9A 5GXHA 2E86A 3ZWLB 2A3TA 3I8EA 3RN0D 1IBZA 1RZPA 4UI9R 2HX9A 5B7FA 4CY2A 2IDFA 3GXUB 5TEEA 3C5MA 2EINB 3NJGA 3F3GA 3PVWB 3NJMA 2OVRB 4XYIA 3V7DB 3UKRC 1AIZA 2YB8B 4XYHA 4U1EI 4G7RB 3QJRB 2WO3B 2PPCA 3NT0A 3ABGA 3SBQA 2TSBA 4A11A 3SFZA 4AX3A 3KW8A 4DP2X 5GSAA 3NJNA 1GS8A 1N70A 3L4MD 3OW8A 5CYKB 5JWZA 1AQ8A 3FYEB 4GXFA 4A0AB 5HQGA 2HXAA 2P80A 1AZNA 3OD3A 1KCWA 1ID2A 5B4WA 5EARA 5GMKn 2FJSA 1JZIA 2XXFA 4Z8LA 3OQRA 4CY3A 3AL9A 2H9MA 5K19A 4QRJA 2MTAA 3I7LA 3X1BA 3RFGA 3OM3B 4DP7X 1OF0A 3NVQA 3V9CA 4GM8A 4E5ZB 3WI9A 3FGBA 4HCGA 5A2Qg 1JOIA 3U4YA 1ADWA 2VMJA 4O9DA 3PPSA 1Q47A 2DYSB 4NB7A 2GNQA 3CFVA 4DP9X 1GP2B 1MG2A 2P9PC 2WO2B 2FQFA 4F7KA 3UKUC 1BAWA 2B4EA 3PE7A 4GYBA 3JB9L 1BYPA 1WA1X 2YAEA 3K27A 3SN6B 2Q7QA 2TRCB 1NWOA 5D4JA 1A65A 3C9CA 5EMLB 3CIKB 3PXSD 2UXFA 3NJKA 2IAAA 4YSAA 7PCYA 3I7KA 4JHUA 1NIFA 4RH4A 4A2FA 2J55H 4ERQA 1PEVA 5TEFA 3VH0A 3BWSA 2QDVA 1A3ZA 2B5NA 2CO0C 2I0TA 3ERXA 1NR0A 1PI6A 2CAKA 1YFQA 4FAAB 1OMWB 2IUQA 3OMIB 1AZUA 1B3IA 1QNIA 2AZAA 2J56H 2BZCA 3EI3A 1ZDQA 4H5IA 4L3GD 2DWSA 1MZYA 2H68A 5EMKB 3BVDB 4G71B 1NIEA 1GY1A 1TBGA 2AGLA 3SCYA 2IH9A 2HYEA 3CG8A 4BH6A 5GXIA 2Z2NA 3AZUA 3JRPA 2GC4C 1J5CA 4HALA 3B7FA 3ASNB 4OWRA 4FA1D 3H4FA 2BO0A 4QKTA 4QL1A 4KFMB 2PP7A 2EIJB 1AS6A 2IWFA 3AH8B 6PAZA 2UX6A 3JROA 3RLMD 2AH1A 1K8KC 2BBKH 1XB6A 2XX1A 3FU7A 4A68A 1N6EA 3HFQA 3N0EA 1SDDA 5FQDA 5TDHB 1FWXA 1ZPUA 3NSCA 4JT6C 4CY5A 3FSVA 2UZYB 3DIVA 4A2GA 5HE2B 4ESGA 1NIAA 2GC7A 1NWPA 1PY0A 5I6PA 2PPAA 3ZIYA 3J80g 3DXMC 4NAJA 4R7AB 2YXVA 4A2DA 4BXSV 4LGNA 2H6QA 3MZLA 3UVOA 5FLXg 1SQJA 3AG3B 3IBOA 3VGZA 5AFU3 2DYRB 5H1MA 2AQ5A 1KDIA 5FC9A 2J56A 2CE8A 4FWWA 4E54A 1KYAA 2UXTA 4OZUA 5ANHA 1A4AA 2EILB 2HRGA 2HX7A 3OL2B 2J55A 1UATA 2I3SA 2CE9A 4GP4B 4YSEA 1J9RA 2IWKA 5SXMA 4Q8BA 5FKQA 1FA4A 2ZONA 4UF7C 4BWTA 1PNCA 1M9WA 3NSYA 5FA5B 4E9SA 1E67A 1PZBA 5THAA 4YSRA 3TU6A 3A0FA 3DXKC 4GY4A 4FA7B 5AMSA 1L9QA 4GGDA 1NIDA 1ZIBA 2VW7A 4BWUA 4X4KA 3G5WA 3AL8A 4I79A 3N2JA 3UVNA 4O1QD 2I0RA 1GOTB 2BP8B 4YSSA 3UABA 4YVDA 4BK5C 5I6LA 4A2LA 2BP0A 4G7SB 1PAZA 2PPFA 2AGXA 4EWRA 1NPNA 3NP3A 2OJYA 3OTTA 1L0QA 1ASQA 1I53A 3IJCA 1J5DA 3PAUA 1MG3C 5HE1B 1PNDA 4A67A 1S4UX 2PM9A 1JXGA 5I6KA 2GB2A 2YMUA 1IC0A 3FSWA 2CN3A 1BXAA 3W15A 1BXVA 3PLYA 1RZQA 4A0BB 4U7AA 2H6NA 1SFHA 4A08A 4A7JA 3WNJA 5KDOB 5AZUA 5HE3B 3N0DA 4JSXC 2PM9B 3EI1B 4FAND 4KO7A 5AKRA 3X2QB 1E65A 2Q5BA 1J9SA 1GS7A 1SHYB 2IAAC 6PCYA 3IIWA 5C2WB 1BEXA 1GS6X 4E9TA 1T5KA 2FQDA 1JMXB 3UVLA 4BWWA 4A2MA 4F2FA 4K3ID 4A0BA 1KBVA 3T9WA 3EU7A 1URIA 2WSDA 3FT0A 2HKMA 2I3TA 5B7EA 3JZGA 3S3DB 2IUVA 2UX7A 1ET5A 1SFDA 2BW5A 4G70B 4J8BA 4FAVD 1AAJA 1HFUA 4TZ4A 5LDUA 4N8UA 1BQKA 2XVBA 3SQRA 1E30A 2B08A 1F56A 2FNWA 4O3UB 1WS8A 2W88A 4AKQA 2Z2OA 3CVBA 3T6XA 2CALA 3P4FA 3V5WB 1QHQA 3EHBB 1PLCA 4E9QA 1ETJA 5IY5B 2BCJB 2H13A 4N14A 3JPXA 2DY2A 4ERYA 3AY2A 4BDVB 3KW7A 2XL3A 1OCRB 3I7NA 2H3XC 5EMJB 3NP4A 3CDZA 5EMMB 5I6MA 2PCYA 1B9YA 1BXUA 2H9NA 2IH8A 3FU9A 4PNKB 1J9TA 3FU7B 4YSTA 1A0RB 2HJ4A 3EI2A 1SJMA 4D0KA 3FU8A 3CVCA 1X9UA 3MKSB 4J79A 2I0SA 3QJUB 2ZXWB 3OL2A 2YBAA 4Y5RD 1IBYA 2R7EB 4CZVA 5EM2B 3RYMA 3TASA 2GC4A 1QLEB 5CXCB 2P9LC 3DM0A 5D4IA 2YQBA 1VLXA 3GFCA 2IDQA 2JKWA 3TBBA 3UADA 1BYOA 4GQ2P 1GR7A 1KCBA 3UAEA 3OKTA 3PAVA 1JXDA 1ASOA 4HDJA 3I2NA 3I7OA 4A09B 3SJLD 2R7EA 4P5RA 3GREA 5EAPA 3UGEA 2H6KA 1GSKA 1AG0A 2DV6A 3FQYA 3SBPA 4Q89A 3FM0A 4ZOVA 1OE2A 2Y69B 4KNUA 1JERA 1BQRA 3KRWB 3K26A 2CUAA 1VYHC 4UANA 4E9XA 2XV2A 2H47A 2OK4A 4BUJC 4J77A 1RKRA 1SF3A 2X87A 2QDWA 3T6VA 4CSPA 3PXTD 2OJ1A 4HAKA 4GGAA 3FRXA 1DYZA 2FQEA 2IDTA 1A4CA 4J78A 1OE1A 1SDDB 3MMYA 4G56B 2H9PA 2NRDA 1MZZA 3OMAB 4JSPC 1AS7A 5B3SB 5EHFA 2FTAA 3C75H 2PPEA 3U25A 2Y1AA 5FKTA 2EIKB 1A4BA 4HHGA 3I8CA 3ODTA 4JHVA 4M3HA 4EF3A 3AFCA 5F7AA 3PAZA 1E5YA 2J5WA 4JD2C 4PSXB 1CUOA 1JJUB 3S3BB 1CYWA 3ABMB 2VSKB 3UAAA 1J9QA 2YARA 3SMRA 2UXVA 1V55B 3DSMA 3EI3B 2BZ7A 3JZNA 1AR1B 4CY1A 3PCYA 4YSDA 2Q9OA 3AG1B 4L0PB 2FWLB 5IC7A 1V10A 3AG2B 4X60B 4A0AA 1AANA 2GC7C 3EG6A 4JKNA 4AI7A 4FA9D 5TK2A 3X1FA 5IGQA 5TF2A 1L9RA 4G72B 3FYIB 4DP0X 1NEXB 2XYBA 1PGUA 3EWEA 4H5JA 2IDSA 1JZEA 2CCWA 2PM7B 2G9AA 3I7HA 3ZDWA 4J8GA 1GYCA 1JVLA 4CZYA 1JXFA 3EF4A 1RCYA 3JT2A 3WKQA 2TSAA 4E9WA 1R5MA 2P9KC 4CI8A 1OCOB 3VA6A 4NERA 3N55A 1TKWA 5B7MA 4K3JB 3C75A 5F7BA 4DPBX 5PCYA 1W6LA 4J82A 3SHFA 1ZDSA 4A09A 2P9UC 1N6FA 2OK6A 3IJ0A 3T71A 2CO0A 5B1JA 2J57G 2AGZA 3FPXA 3IEAA 3NSFA 3MBWB 3V9EA 1ET8A 4O3TB 2HXCA 3CVDA 3PXLA 3H56A 4ZK8A 5I6NA 3DTUB 2XL2A 4J0XA 1TU2A 4J84A 1CYXA 2J57A 4GQ1A 1JVOA 3HEIB 7PAZA 4YL4A 2IURA 3FQ2A 3PSCB 1AZBA 3EH5B 3NJFA 4DP6X 1TYQC 3D12B 2OIZA 4FB1D 5CXCA 3SVWD 1WA2X 4J86A 3CDZB 3UACA 4A2EA 2FT6A 2PBIB 1WAEA 2XV0A 2ZWNA 2IUPA 1NDTA 4KO6A 2H9LA 5H14A 3HB3B 3ASOB 1WA0X 2FT7A 3CZUB 2FT8A 1XMEB 2H14A 1KDJA 4HZ1A 1K32A 3EI2B 3QJSB
chains in the Genus database with same CATH superfamily
1KIRB 2OYMA 2PP9A 3H2QA 2F1EA 4J2XA 1HK6A 2G30A 3FB5B 5FO7A 3APMA 4JCMA 1H2YA 2MH4A 4HULB 3NOIA 1KN2H 5EU4A 4FXLA 2LLGA 3LNFA 3EFDL 3AXLA 5KS9F 1WWCA 4X5LA 5D7JA 4QXWA 5H37H 2XV3A 4ZQKB 4J73A 2H4EA 3EOYG 3MRPB 4LDOB 4CMMA 4AEZA 4AX4A 2V3EA 5DJXB 2MHAA 2IAND 2ZKWA 3KBPA 1NMBH 3GB7B 4BM7A 4A38A 2XBZA 1NAKH 4P2OD 5F9OH 1P7KB 2VLME 1OP5H 3QPKA 4FFZA 3PXJA 4KK5C 2X4NB 5HI4D 1WIPA 3UP6A 1A9VA 4LMQI 3M45A 2XX0A 2AAAA 4O2EA 4AVIA 2NXYC 3GNMH 3FQXA 2C5DC 2XCMC 3NZUA 2IBZX 2XA8L 3H42H 3GINA 5IM7B 1J8KA 3I89A 2FIRT 2WCPA 5HHQA 1II4E 3UFIA 2CZNA 4LEEA 3WJJA 4JRXB 3TEXA 2GK2A 2ZT9C 1U3JA 4RETB 4EZLA 2HJKA 3IE9A 1C9SA 2XWZA 2OMVA 1JK8A 4EUPH 2HJBA 4RGMC 5BRPA 3B56A 3SPGA 1MFMA 5ITBH 1OPOA 2CGRL 3DHJA 3BLKA 5K1NA 3BZ5A 5EIIB 1EEYA 4KKLD 1U8LB 2AGWA 5D6DA 5BRZD 4TF4A 4WWNA 1VZGA 2DLGA 3EQ8A 1KPVA 4YVNA 5T5FH 3VB9A 4E42B 1N6QL 3IKOA 1TVHA 4GW5A 2HTKD 4X0NA 1XFPA 4U1NB 3BXNA 4ODVH 3MLUL 4DP5X 1QFWM 4OZGF 1ZA6B 4AKOA 3S3JA 3WJLA 1L9OA 5J5EA 1L7IL 3TYFA 4W6WB 3T0VA 1G9NC 2FGWH 2GBTA 3PP4L 3HAEA 3BPLC 3OG6B 2NSMA 3WIAA 5ERWA 2Y1ZA 1RUAL 2JNZA 1FORL 2FX8H 5E2VH 3SYCA 1DBML 3A6BH 3IU3B 1E40A 1DFBH 2VDQA 4WTQA 1PY4A 2OMYB 3QS3A 3UYRL 4BFGA 3NA9L 3NH7H 4GP5B 4OUUA 5IG7A 2N0MA 1FVCB 2CUHA 2ZOUA 2ZX9A 5HPMB 2AS5M 1XGQA 4MJIE 3VFUA 3I2CH 3IS1X 3BKJH 4U31A 5AD0B 1E3XA 4H8WH 2FX9H 4AMYA 5DHVA 2Z31A 4B5ZA 4X63B 4OZGB 2FJUB 1F90H 4XCYA 4KQ0A 3BDXA 4PWIA 5DRZB 1RZKC 1PG7H 2EADA 5GS0L 4UILH 5DJ2B 3L4UA 1BSIA 3O0RL 1SM3L 2VKWA 5K39B 2WLJA 4K2UH 5KBMA 3ULVL 3ECUA 1MPAL 4JRXE 4UUJA 5FB8A 3S5YA 3CN4A 2IG2H 3WELA 3ULUH 2DEYX 3GKWL 4MJHA 1FIGH 1OV8A 1RV6X 5D7EA 1V54B 4KDTC 3T09A 3IN0A 3WE1A 3U7YH 1MN4A 1G6RL 3QR1A 4DUXA 4ZUVA 1W0WA 2QQNL 2Q86A 4BL0A 4KI5F 1SQ9A 3C12A 2CKBA 1C8QA 2RGSA 4CVUA 4TTDC 4WU7A 3GBMH 2D3VA 3KPSB 2NOYA 2V9TA 3QIBA 4L5FL 2WTPA 4FNQA 4QHMB 5FKPA 1N5YL 3BG1A 2AJZB 4AJVA 1RZJC 1J1OH 3AWFA 3DK2A 3EYQD 1OLZA 3PWPA 2JKJA 2AQNA 4ORZC 5DHMC 4HGMA 2F53A 1JGLL 2WBKA 1PPIA 3EJPA 2OPCA 2BXYA 2IOMA 2VKXA 2DWTA 3FCGA 3RFZB 2VE6B 2B5MA 4IJ3C 1JPST 5ISZA 1OW0C 2KH2B 1QSZA 3GRWA 1K8IA 3MNMA 3HC0B 3ENEA 3GZOA 4LIQL 4BV1A 1V3LA 5DJYA 4BJLA 5HVWA 1J5OL 2W9DH 1NCDH 2PPCA 4Z7NE 2W92A 5BOPA 4DO5A 4OZHB 4M8VA 4XP6L 5J13C 3UC2A 2OJEA 3ABZA 4JJOA 1SY6A 4K5NA 1UVQA 5E94A 3OD3A 4JZJC 3WFEL 1ZLSL 1TO5A 4JREB 3L4YA 4QRQA 4RMWA 3SDYL 4N2FA 1E43A 5E4EB 3CVHB 4PGEB 4FTDA 2EDMA 1JUFB 4IRZL 4W70A 4GAYB 2X1PA 3JV6B 4F5CA 4M00A 1KXVA 2Z4QB 5E6ID 2X4UB 4R7XA 4XE5B 3ALXA 1Q47A 4NB7A 3KWXA 5K39A 2WO2B 4JFEB 1E4KA 2JMRA 4UQ3B 3S2CA 1KBKA 3L16A 2XG4B 4G80A 3VXUB 2B4EA 3F5WA 1FAIH 1FNEB 4LOEA 4WW2A 3EJQA 1D9KC 2DQGL 2YKLL 5I1LA 2A9CA 4JHUA 4A2FA 4DCQB 3L5HA 1UCBH 4BH7A 3U4AA 3KL0A 5C2UB 3V55A 3D4CA 4NBMA 3TPUA 2AZAA 4DW2L 4XWOC 1XL4A 3IDMB 3CZGA 1J8HE 4LFHD 3VCLB 2IAMB 4PLOB 1LL1A 4JPVL 3AZUA 5IHLB 3B7FA 1YO4A 3UJJH 1M7XA 3SE4C 4QL1A 1F2XK 4JO4H 2A9ML 1E9PB 4GW5B 2CR3A 2P42B 1QEWA 2VABA 2V3DA 4XPTH 5I76A 2NX5D 1OGAD 4LVHC 3PV6B 3V4PB 3HI5L 4A2GA 5C0DB 3ATAA 3MR9B 1T22A 4XX1E 4APQC 5FO2A 1SJXA 1XZ0A 2J8UA 3OGCA 2ZYHA 3IURA 4LLUA 4TQEL 5IF0B 2CO6B 2AJUH 3D34A 2DYRB 2Y5TA 4QRBA 1NCCL 2BJML 4HUMB 5CINH 3UROR 3BKCL 4AVKA 2EVHA 2DYPB 4G8FA 3GM8A 4BZ1A 3CZNA 2XNAA 2WQWA 4YSEA 2IWKA 1UB6B 4Q8BA 1ACYL 4FEIA 2COQA 3IFLL 5KSVA 5HY9A 3DC0A 4GY4A 4KZCA 5E6UB 1KJ2B 1YEKH 1OAUH 2Q1EA 2APVA 1IM3D 2HKFH 2VZUA 2ZAIA 4FYQA 5HDQL 1EPFA 4OJFL 2CA4A 2LAAA 3U79A 4TS6A 2QL1A 4U05A 3PJSB 2WB1A 1U8LA 3U1SL 2FD6H 4Z95H 4JANA 2ARJQ 3FHQA 3VUAA 3CFEB 2NY3C 1KENH 1DVFC 4OH2A 2IPUG 2MCMA 4POZC 3UBXB 4Z3EA 1ADQL 1BXVA 3WN6A 1KLGB 3FO0H 4A08A 3LMJL 1ZS8A 3U1SH 1K4CB 5EF2A 3CIQA 3TPKA 1EGJL 1NGWA 1WD9A 2CKBL 4GIOA 4UT7H 1BEXA 4W6XB 5IGXL 3RJOA 2DEWX 5TFSH 4BKLB 3N0PB 4OJYA 2AK1L 2G2PA 5F1IB 3FT0A 5AYTA 4ZBJA 1FN4A 1Q90A 3UTOA 1LEKA 2HLAA 1ET5A 2NXZC 1NC2A 2BW5A 3BJLA 4K7PX 4Y5XA 4F8NA 1XGUB 4AIXA 3HE6B 4M93C 1MDTA 3CHPA 4ZW6A 2NCMA 3BVNA 1DBBL 4P5TA 4O3UB 4DNWA 5BMFH 1KGCE 2ATKA 1UB6A 3BAIA 4AUYA 1A0QH 3QNZB 3I7NA 3MUGA 3UBGA 1NCUA 3O3EB 4LSPL 4PHZA 4NYLA 2MNJB 3QIWA 2GJZB 3CVHH 3FQTA 5EEUA 5I6MA 2D7QA 3PXHA 5I75C 4NKIH 1A0RB 3H3PH 4OLWL 3ZHFA 3CN1A 4Y8AA 2FSDA 2ED7A 1RZIB 3OWRA 4D8PB 3QUGA 4Y4HD 4Q9RL 2ZXWB 2B77A 2W95A 2QV4A 3TASA 4NJ9L 4F15B 4AYID 5CR1A 2O93L 4XAWL 4BUQA 2F5AH 2WYIA 4JB9H 4FMVA 5F7LB 5IHUL 2XN9A 4OJEH 3WHXA 4X6DE 3GSOA 5FW6A 3SDAA 3SJLD 4P5RA 5KS9E 5EAPA 4PR5A 2W65A 2H6KA 1KXVC 3ZO9A 1GZQB 3GI8L 2WNGA 5C0RH 3BH4A 1TMCB 5CJOH 5C09E 2NY0B 4HV8B 2HJKB 5IJKA 4HJSA 4WWKC 4UANA 4PJFA 5DT1L 3SHSA 4KFMA 4KVCH 1KCUL 5D2LA 5IBUB 4WI8A 2YD1A 3MNWB 1DYZA 4LPTA 1HS6A 3CFCL 3B3IB 4XCCH 4MA7H 4ZS7H 2R69H 4IOIB 3WEBA 3WAJA 1INDL 3C5JB 2AK4B 5HVFB 4JD2C 2EIZB 1CD1B 2VSKB 1SRDA 3NCFB 4MTMA 1P7KA 4K4KA 1TQVA 3O6FB 3TWCH 2BZ7A 3ILEA 4QHUA 4WK0B 5IMLB 1GOGA 1AR1B 1EHLH 2ROYA 3SCMD 4Z3GA 2WKOF 5FIEA 3F58L 3D85B 4FKEA 4L0PB 3A6OA 4ES8A 5IC7A 1X5LA 3TT3H 1CBVL 4NC0B 1SJVA 2X0WA 3AG2B 4KWUA 2BINA 4X6CF 3BWZA 3WJMA 3EG6A 2AITA 5TF2A 5DVMA 4YEFA 1T03L 4H5JA 2IDSA 1JZEA 1MCNA 1Z0NA 2P5EB 5JHLA 4XNAA 4NDMB 5DRXA 4MMZB 1DLHA 2CIKA 3B7TA 4TLUA 5F7FA 4R8WL 1Z3RA 3KPNB 3BSZA 3VVVA 3RNKB 5M5SA 2BP5M 3ARBB 1BPLB 3FPXA 2O6EA 2QADC 1SXZA 2HXCA 4OV5A 2XL2A 1KUMA 3K1KC 4R26H 4Y1AB 5DJZA 1S7WB 3HG1E 3DSNB 2ITEA 2VCOA 2XKUA 3MJ9H 4Y4FD 4X99B 2O4EA 3UIZA 5MP6L 1ED3B 1NM9A 3O3BA 1EFXA 4LHUD 1OB0A 1OIOA 3O8XA 1WAEA 4M7JL 1HXYA 1I2MB 2Q10A 4OLUL 1N8OE 4OBSA 3VCLA 3HB3D 5J3HD 2YD5A 5I1GL 2XYIA 5L8KB 4ODHH 1C08A 4CY5A 4FQJH 1HOCA 2Y25A 3WMQA 1DL7L 4FQXC 5EAMA 1D5ZB 3H3BC 3LZLA 2IFFL 3DJSA 4BH8A 4CI1A 1FI8C 1OB1A 3A6CH 4KKRA 3V4PL 5BJTB 4B5EA 4P57B 5ALCL 2N01B 5I19L 4HUVA 1KXQA 3RTQD 5HPMA 3NDZE 2OL3L 4PJ7F 3CFKB 1J5IA 2RIKA 3MI6A 1WFMA 1VEOA 4XP9H 5DK3A 2WLIA 3UG5A 4CZVA 5D5ME 4E9VA 3V7AE 4Q9BA 2OYLA 3CZSA 3IJHA 1KXTB 1XF3A 2VLJA 3LRSB 4MB3A 4ZX5A 4NO0D 5EZOH 4IBVA 4U3CA 3VFTB 3ZKMD 4I48B 4AV5A 1JGEB 2CLRA 4H0IA 4UTAA 3FTGB 2AERT 2J88L 4Y9EA 1KJVB 2NXYD 4X9YA 4QRSB 4MJ2A 4FZ8L 2PR4H 5IB3A 4NWUH 2XDWA 2CDEA 3GD1C 4H5SA 4O51A 1A7OH 3QWOB 3WFBL 4WUKL 4LLMB 4ODWA 1T5XA 4OLXH 4FJZA 4LCWB 2E75C 3MGAA 2YPLD 2G3XA 4RZCA 4GKZB 3W9EA 2W0FA 2Z4TA 1RHHB 4PREA 5A3IC 3MRIA 4M6AA 1H3VA 1U6AL 4YDIL 1ORQB 1NAMH 1CZ8H 2AJXL 2EC9T 5JA9A 2JXMA 1CC3A 1EZVX 4EI0A 1QFWL 1S5HB 2VLKB 4NT6A 3WXWH 1IGTB 2WVVA 1UYWL 4UIMA 1BFOA 3SE3C 5CEZH 4DGYH 5DD3L 3WFCL 4A08B 5IJ7E 4FXGA 1C5CH 1QTPA 4NSXA 4IK7A 4RFNC 3ZBMA 3G5YA 3D39B 4UIKL 2Y22A 4FFVC 3MX0A 3VI4F 1P7QB 1T20A 1K9TA 1DVTA 1GAFH 4Y5YB 2GSGB 3ARGC 1NBVH 1SJEA 3A21A 4XO4A 4YHKL 4U6TA 1FCGA 4YUEL 3QWQB 4BZ2L 5FUZL 4L4VB 2KS0A 3F7LA 4L4VD 4A2HA 4AMXA 3MUOA 4XHJD 4XHJC 3QUYA 3ILPB 4WKXA 3I50L 3GRWH 5BO1H 3TTYA 2QXVA 2ZF9A 2QPSA 5B8CB 3QXDA 2D31B 1M1SA 1J0ZA 1NDMB 1F1GA 3ULUC 1TEFA 1XGQB 5HI3C 3ATDA 4UWQB 4F80A 3ZK0A 1B2YA 2I85A 2J1YA 2OULB 1OCWL 4KO9A 3ORJA 5MI0C 1JPSL 4OBRA 1BFVL 3LZNA 3DPBA 1KLUA 3KPLA 1ZA3A 2Q3XA 2CO6A 4JSVC 2ITCA 2XTJD 3NEEA 3QIUC 3UJIL 4I2XA 2FQGA 1AY1L 3SPVB 4TNEA 5FHBH 4RAVB 1RUKL 3X11A 3QDGD 3E6FB 3SKOB 3C9NA 2MJWA 4IU3B 4QHKJ 1NLBH 4TLSA 1DBKL 5AZ2L 4BK5A 5JYMA 5C70A 4G83A 4JFWA 1S3KH 2Z31B 3AREC 4BCBA 1UXSA 4HWBH 1NMCC 1D3CA 5TTRA 4KK8C 3THML 4ZMYA 2AXGB 1QMUA 1H8LA 2PXYA 3K2UH 4HF5L 4ETQB 4G3YL 2D7NA 3VNYA 2PP8A 2YK1H 5C2VB 2DLTA 1PD0A 5KVGH 2ISDA 1RK0B 1FHNA 1Q1JH 4PJAA 2WQVA 3BEWB 3LN4A 4Y2DA 4I5BB 2QSCL 3IFPA 4HKJB 2DQUL 3LOWA 2X4PA 3CVIL 3QYCA 3GYRA 1EJFA 2ZYSA 2BWQA 2Z2PA 1XGTB 4LG8A 2X6UA 4OM0H 5B1JC 1R24A 3FMGH 1N12A 3IMUA 4AYDC 1BZ7A 5DRWB 3M46A 3L3KB 1TU2B 4H1LA 4PRHA 3HI6L 4IKLA 3FH5A 3CFIC 3T77A 1ZV9A 4X7TB 5HYJE 5IEHA 1LYQA 4FULA 2UZIL 1AIFB 5E8DL 3HNSH 1JV5A 1OD7A 4V2CB 1QTSA 1MFDL 2OR9L 5E6UA 3ZY7A 1ITBB 4XYHA 3EG9A 1F42A 3NN8B 4NO2A 5FM8A 1U21A 3EJZC 5AOMA 4GRLA 5FUOL 3QZMA 4NFCA 4AX3A 4DKEH 2D7TH 5B38G 3R19A 3VFNB 4RMRA 2R4RL 1MREH 3Q5OA 1UTCA 1CBJA 4UDUA 1Z9OA 5E6IA 1KJ2A 5IZ7A 5FKAA 5IEKA 3QG6A 5HYQB 2FBJH 5FB8B 4NFBA 2UY6B 1OZTG 5D1XD 2C3GA 3PFUA 1RL1A 5K19A 4KV5E 4AE1A 1W72B 3U0PA 3OJDA 4HKZB 4FKKA 3RPIB 4AVJA 4WJKA 1JFQH 4PGZA 5FHAL 4ACPA 4AEHH 2WQ8A 4WFHD 2X4OB 5C09A 2LHAA 4N6RA 1YEHH 2AEPH 2X40A 2ZSWA 2XVGA 1RUAH 3N85H 4X80H 3S4SG 4C8XA 4Z7NF 3ML8A 1WEJL 3KLQA 1PS3A 2OSLA 2BFGA 1QFSA 4LDEB 4B60A 43C9A 2TRCB 3O2DH 2BPBA 4QOKE 1A65A 2EO7A 5IBLC 2EDRA 3VTAA 4X0KB 2PYEB 1TZAA 1UWFA 2B5NA 2CO0C 3PHQA 2CAKA 3EI3A 4E41A 1VIWA 2V37A 1FV1B 1HCYA 1XIWA 2K6WA 2DEXX 2ZXQA 2AGLA 5EU5A 2BRQA 2FZ3A 3F7YA 5KTEH 4FA8A 5E56A 1JZDC 2NY4D 4LCYA 5E2UL 2IWFA 4C47A 5E5RB 4L8SA 2AH1A 1RLWA 1QFHA 3MBXL 4JFYB 1FWXA 2Q8BL 2UZYB 1RU9L 3LQAL 1HNFA 2DRUA 5LXVA 4ABVA 3LEXB 2A6KB 1UADC 1J1OL 3KYMB 5HPOA 2YEZB 3MZLA 3K72B 2YA0A 4HIIA 1NDMA 2FJFB 2W91A 4YZFE 3FT2A 1BLNB 3UPAA 2WLHA 3IGAB 4LBAA 4MYPA 3U7WL 2IPUK 1FYTA 4H1LG 3GGWA 3GSNB 4GP4B 2BXZA 4KRLB 5TQ2H 1F3RB 3SKJL 4G7YH 1LO2H 4WEBL 3UIYA 1MF2L 2P49B 4NUGL 3RY6C 4DZBB 1PEZA 3EGXB 1V05A 1P6WA 1RZFL 4I4WB 1GOTB 3WJJC 3VSQA 1LO5B 4YVDA 1FSKC 3P3RA 4BK5C 5EF1A 5C0BD 2OJYA 2A9MH 3OTTA 3RWCB 4AJWA 1RHHA 1YJDL 3GMLB 4P4KD 5E9AA 2AXFA 2EE6A 2QLYA 3L3HB 4KKCC 3MRQB 4APQA 5TGBB 3T2QA 2HVJB 3KYOB 1RHFA 1W80A 4G6AD 3W15A 1RZQA 3QDME 4N2MA 2DLEA 3JWNG 4PJ5E 2HN7B 4JPKL 4EDXA 1I1AC 5DQJA 5C2WB 3H7BA 1OGPA 2ENPA 1GS6X 2ALWA 4OQTH 1TJMA 3BHBB 3D4YA 1NMCB 3NTCH 1OAQL 1KCVH 5CGTA 1DBMH 3ARQA 2HKMA 1SDYA 3H6JA 5HHME 1DFBL 1IFGA 4LCUB 4J4PC 2GCYA 3QHZH 2WM0A 4LE8A 3K5SA 2WUBH 4N87A 4X9BA 2FJFA 5LDUA 3CDGB 1IJ9A 1WS8A 1MFNA 2WMPA 4JPWL 4APXB 3CVHL 3EHBB 5TDNA 4E9QA 5IY5B 3PGFH 1FPTH 4V11A 3F3HA 1QG3A 4PTTB 4RISH 4MDIB 5AZEH 2F7RA 5EMJB 3AWEA 3O8XD 2ITDA 5FGCB 1GTNA 2JCCB 4IOFD 4MS8D 3MRGA 3OSVA 2NY5C 2W60B 1A1MA 5DRZA 2FIKB 1IKNA 4JPVH 1R5WA 1DLFH 4K8RD 4R2GC 3W0WA 4K3EH 3E80A 3EXJA 3CE1A 2BVOB 5TFSL 1DVYA 4F57L 1SN2A 1CD9B 1FNLA 1FYTD 4WUUB 4PVBA 5L6YH 1UWXH 2R7EA 2XA3A 5EOCH 4HWBA 3CXHK 1FAIL 5KZCD 3FQYA 3DI3B 2Y69B 5C2BH 1NUGA 3P4MA 1RUKH 4PRPA 4H8QA 2H47A 3POCA 2OK4A 2FO4B 4LCCC 3RJDA 2ZSWB 3PY9A 3T4AC 4KRPB 1THCA 3L08A 4NI3A 3FRXA 4OF3A 4NZUH 1OE1A 1CL7I 2GCYB 4R4FH 3FUIA 1Q4NX 1NGPL 3C5XA 3VWJA 2Q8AL 4PS3A 3T3MF 4MYWB 2CGZA 3E6HA 2HT4D 3ECBA 4AL8L 1KTKE 4GB9A 3ZT5A 3UC0H 2PYEA 2F58H 4GSXA 4EF3A 1VFBB 1WFUA 5D2NC 4AENB 5DD1L 1ZLSH 3BUYA 3IMTA 2UUDK 2KC0A 2J6WA 4KU1A 4RFEA 1HVXA 1ZA6A 4HD9A 1BZ8A 1CL7L 3FO0L 2FD6L 3EZJB 3JZNA 1XX9C 1TCRA 2FL5A 4X5RA 2E0PA 4ZPVB 5KW9L 1KENL 3VRJA 1SHSA 3ROOB 1KNOA 2P8PB 5AW4B 3QNXB 4FFYA 3SKUD 3KR3H 4FA9D 4APXA 3BSZL 1DE4A 4NEHB 1RURL 4NQCE 4UOW0 4WWKA 3T3MB 5E8OB 3W9DB 2Q7AA 1CD0A 3UTPE 4HT1H 5ANME 3C8KA 3N41B 3HS0A 1WUNT 3N55A 4M02A 4U33A 4OCYL 4DPBX 4HIEA 1WO2A 2J57G 5GGQH 4LLYA 3OKKA 1SVZA 1KC5L 3GGWB 1MIML 1MFEL 1KTDB 2EXWC 4XVJL 1A22B 5CFAA 3RY6A 3DTUB 3QDJB 2OX5A 4TVUA 1NCWH 5GRUL 2DF3A 5FWRA 2Q3ZA 1LQBC 5CUSH 4F3FB 2C4FU 4YL4A 1G0YR 4IRSC 3VD7A 3MUHL 4FNSA 2GQHA 2NNXA 2OZ4A 3PSCB 4DP6X 3VWJB 3WNKA 3EGDB 4B0MM 3QCUH 4G1MA 4N0YH 1C9LA 1KULA 3NFNA 3CDZB 1CN4A 5F9JA 3WMSA 4D0CA 5L4JA 2WYZA 2E8YA 3BI9X 2FT7A 4EN2A 2FT8A 3JTTB 5I1CL 5GS0H 3BEWA 5ESVB 3R7RA 1U8HA 3PQYA 1TZ8A 5ICUA 1BDYA 2WLNA 3K4DA 3AG4B 1T7VA 4L5FE 3LKSB 4U49A 3HVNA 1DVXA 2EDBA 3L4TA 2JJUA 5IHUH 4CMMB 4GGCA 3ARBC 4U1HB 2BIHA 4XP9L 4AZUA 3ULAB 3G5XA 2YWYA 3QA3A 4MKTA 4ATTA 5E8DH 3GXNA 3MV7D 1DL7H 2J8UB 3OGCB 3U82B 5CZKA 3WAKA 3PL6C 4J4PA 1QSFD 4HHWA 4B9JA 1UD3A 2LLNA 1T83A 4GKNA 3WDHA 5J8OA 4FL4C 4PJ9D 5F1IA 2YOAA 1SHXA 4NKIL 1F4YL 3BIKB 4HLZH 5ESAB 3Q05A 4RGNC 1F3DH 1UXMA 4R7NA 1KIUA 1T1XB 1TG8A 3EJSA 1ZVSB 4J3XA 1JGDB 1Y0LA 3ZDYA 1PMYA 3B9EA 1CTNA 2ZAHA 3X11B 2HFFB 1IUZA 1LLAA 4K07A 4BFEA 2VDRH 4OQTA 4QTHA 5DYOA 4AL8C 1EZSA 3QEHB 2YNNA 2W8CA 3N43B 2DJ4A 3O6FC 3S37X 2PR4L 1WHOA 3HG1D 4PAZA 3QG6B 3IXTA 3DVGA 1H3PH 3MJGX 5HYQA 2BH0A 5F89B 4LPYA 3T65A 1MJUL 3QJVB 5DUML 4PGEA 3L3OA 5I5IA 1OZUA 2NUPA 4S1SL 5GRYA 4YHMH 1DR9A 1TYEB 2VLLA 3II3A 3PGDA 4O58H 4YZWA 1MNUL 4MCMA 4EN3A 4BGDA 2V33A 1MIEL 3ABLB 5ECJE 2BSRA 3LCYA 2GSGA 1XR9B 2DH2A 1R19A 2DQTH 3F01A 4DVBB 3LZQA 1GYVA 3NCXA 3B5TA 1CF1A 2AVFA 3MREA 2B5IC 5JHLH 1CT8A 1JTPA 3QFJB 3HB3C 3N43F 3MRNB 1NEZB 1S7XA 3MV8B 3QPXL 2AQTA 1S9XB 1SNRA 1H9DA 4Y19E 1PG7L 2WXJA 4CKQA 4FHKA 3MX0B 5LVEA 4F33A 1G7QA 2RQ8A 5D4HA 3L5XH 3FU3A 3X14A 2ZD0A 4OCLC 5ENWB 5C0CB 4TULH 3BVUA 1Q94A 4R84A 2QQQA 5C9ZB 1JZFA 3A4EA 4Y5XC 3CHSA 3VI4A 4IIQA 3GKWH 2HZHA 1JGEA 2CLRB 3ZUCA 1M56B 3EQ9A 3GTVA 2ADIA 4X4MA 1CXFA 3IN2A 5EN2B 5BO1L 2AGJH 3JAMg 1IAIL 1AGDA 3PGFL 3PGCA 3RBSA 1SQMA 1FORH 1PQZA 1RJLB 1D7DA 4JMXA 4KTGA 3ZE0A 2KHAA 4GKZA 1QLRB 4PWFA 5I5RA 1ILSA 3K80A 4YHNB 4BD4A 4KC3B 3QW9A 4B9PA 1T2QL 2MFNA 3BW9B 1CTMA 3GSRA 4OGAC 3U46A 3E2HC 3AS3A 4N4YB 2AANA 4QF1B 3JWDL 3RX7A 5IR1A 4IW4C 1S8DA 5FR3A 5MERA 1MH5B 1SBSH 4HIPA 2WB7A 1E8NA 4S1QL 1B4RA 1KTLB 1YNTB 4X6FB 4TYUA 4HJGA 3JV0A 3W5MA 1ONQB 3B9KB 4FNLL 4IMLA 1KCKA 3SDDA 4CVXA 2FH6A 2WD0A 1MCPL 2QC5A 2HLFD 4I0PC 3LD8B 4JO1L 4CSSA 3V6OC 2X3AA 3RUGA 1GPOH 3DX0A 1OK0A 1ZIAA 1UQSA 3QULA 5F2FA 3E0CA 5FCUL 3G08A 4F8TA 2R2BA 2XZGA 5GSVB 5KG9B 1U8QB 4TQEH 2HFGL 5EOTA 3RLSA 3UJTH 4GFTB 5AVTB 1UC6A 3H9HA 4XWOD 3WFBH 4FA4D 3D18B 5DS8B 3HNVH 3RWGB 2GIXA 3MV8E 1AGFA 4MD4A 1RMFL 1H5BA 2V5TA 4G6FB 3U9UA 1YNTF 3WIHH 4A6YB 2V17L 2J88H 1BMGA 3RNQA 2VRAA 3RKDD 2M83A 3MUGB 1OY3B 4M9PA 3H7LA 3FU0A 4P2RD 2LT9A 3DMMB 4Q9QH 3DX3A 1JWSA 3D06A 4M3KB 3ZZSA 3MV9E 4HPHA 2V9RA 2PUQT 4UQIM 2EZ0D 5HHOD 2G60L 3P77A 4XOCA 2IXQA 3ZE2E 3NBNA 3DV6B 4OD2A 4Z7OF 3VD9A 3BIBX 1MCCA 4B9IA 4PV1C 5IW6B 1E5CA 2H3NB 3CH1A 1A9EB 3QJHA 1SOKA 1A02N 5CYKB 3FQUA 1AFVH 5JWZA 5C0FA 4LVHB 5JXAL 4OCRH 1MFBH 5B3NA 3KS0H 3SIKA 2FLRT 4PSPA 4MAYB 5C97A 4JO8A 4H0GA 2JIXD 2BIQA 4JZNA 4ZRGA 5IB5B 1HTYA 3F7QA 2C9XA 3FC8A 5E95B 1HL9A 1GIGL 3RFGA 1ZMYA 4WSJA 1JYVA 2Z8VC 3HHRB 1AO7A 2OJZL 1YVLA 4TSCL 5D71L 5D2LB 2NW2A 2YEQA 4YXHH 4AYGA 5T3ZH 5BW7A 3BO8A 1HI6B 3FONB 3N3EA 4GYBA 4BCZA 3Q2LA 4GW4A 4WLCA 3RWDA 2H45A 4OQ1A 3K27A 4HKXB 3FDWA 1GZQA 3C9CA 5IVZA 3RI5F 3JWNH 3QDGB 1KLFA 3BUIA 5BZWB 3I7KA 5IHZB 2EIZA 1WEJH 4TSCH 5D71H 5FYLL 1PEVA 4EN3B 2JXMB 1JL8A 2QDVA 4FN0A 2LOEA 4R8WH 1NR0A 4FMKA 3QCVL 4LCYB 3N0AA 5F6HI 4QRTB 4GO8A 3BVDB 5H8DA 1XVSA 4JL1A 5F88A 3BD3A 3CZFB 4OWRA 1C5DB 1PJ9A 1LM8V 1G7JB 2EIJB 4IRJB 1W9XA 3MSPA 1XZ0B 3HAEB 4XRCA 4QJ4B 2OK0L 2DWEB 3N0EA 3GXMA 3LX9A 4DZ8A 5D1XE 2RR3A 4L4JA 4PRIA 2OYKA 2CRYA 1U6AH 2EIEA 1NIAA 3AQXA 3B9VA 3FTGA 1H6FA 1C8PA 3DETC 2GC7A 1OANA 3FBKA 3ZN6A 5AB0A 5IJCC 4NAJA 5FLXg 4PWHA 3VFOA 5D7HA 2QGEA 4WEEA 1D5BA 3MC0A 1INDH 2NLJB 2YPVH 3KPRA 5JLZB 1D6VL 1KDIA 3QK0A 2UY7B 2WWKO 2CE8A 3ARDD 3C60C 2ATPA 4K5OA 3OPZH 3P11L 3QWNA 4U1IB 3MJ7B 3UAJD 1PX3A 2H6PA 1EO8H 1FFRA 3ARED 1OP5K 5DUBB 5L0QC 5HJBA 2F8OA 2X7LA 3TU6A 5MENE 3DXKC 3DPBB 3FBQA 2R1WB 3IDNB 4Z7VE 2PO6D 1CQKA 3AL8A 1LHZA 4HG4J 5KN5B 1FC1A 5DVLA 1S78C 2ZKHH 3Q1SH 5EN3A 2PPFA 1MRFH 1JCVA 2IMNA 4TQ8A 4K3JH 3RHWK 4Z3TA 3C5ZB 3SGDI 3V52H 1L9NA 4GKSB 4GIPD 2R23B 2X05A 4RIRB 2FVNA 3QIWD 4Y5VB 2BNRE 5AL8A 4N2KA 1KJMA 4GMSL 2D3NA 2IC2A 4TSBL 3RQ3A 4Z23A 4ZO9A 5AENA 5I6KA 3B6SA 4P48A 4ANKA 4UINL 3EGDA 2HP4A 3MYZA 5D1ZD 4N8VG 1INQB 3SY0A 4N2CA 1P9MA 2FJGA 4A7JA 4JY6B 2X6CA 5IHZA 5IMKB 2X0VA 3VYOA 1WRFA 4C83B 1E65A 4KROD 1J9SA 3QORD 4I85A 4NRXA 4ZAKD 3TBSB 4BFNA 5I73B 4R9HA 2NW3B 5EUOA 3VGAB 5KYYA 4JHPC 2PABA 1EDHA 5B21A 1A7BA 1LO3H 3MCYA 1N7ML 3ZE0F 2DLFH 4Z3FA 2FDBP 4J8BA 15C8H 1K4DA 2ZCKH 4XX5A 1O5PA 1ZEAL 5D1QA 4DKFH 2RA1A 2DDQH 3RVVC 1UJ3A 1HZHH 3BPNC 1EO7A 4ERYA 2XL3A 4BDVB 4HXBH 5BMFL 5E2TL 5KVGL 4HCRA 2HJLB 4XN8A 1LQSR 2BFVH 2R1WA 2P5WD 1LNUA 3KVPA 3X3FL 4YAQA 5CFHA 2EVGA 3MNVB 3O4LD 4QHLA 3VD0A 1X9UA 3IPEA 4FXKB 1FSKB 2OL3H 3ZQXA 4P3DA 4U1IA 1U58A 3PDGA 2DQIH 2R7EB 2NZ9D 1N0XH 2GC4A 4Y4KC 3JWOH 5CGBA 2DLHA 3ZYOA 5LQBL 4NO3A 1UTDA 1WD8A 3VYPA 1MPAH 4S0TD 3SCMA 1BYOA 5E5UB 1EHLL 1HHGB 1YAIA 3BP4B 4M1GH 3HMXL 5CSZA 4A09B 1J10A 4OM1L 3GREA 1I8MB 4TKWA 2BNQB 4PJ8A 4ZOVA 4HJJL 4GI6A 4Y7OC 1BOGB 4S2SB 3BPNB 4WUUA 1KTLA 1BVLA 1YNTA 1TZHB 1G4RA 3LAFA 5BW7C 2N7BA 1HJBC 5F6IC 4DGUA 2OZNA 1W16A 5E8NB 2VDKA 3MRKB 5GGUB 1W0YT 5T33H 2PPEA 1I7TB 2Y1AA 4Z7QA 2EYTA 2BX5A 3D7PA 3V4VB 2BZDA 2QQKH 2XBTA 4WW1A 4ABQA 3LKRA 2VLJE 4U7MA 3O3UN 3HAEH 2K7PA 5DRNB 4JGMA 1BG1A 1JJUB 2GK0B 3L7EA 1V55B 3EI3B 3MRHA 2BVUA 4UTBH 2NYKA 4TM9A 3PWJB 3B2UD 1YEGL 4XVSL 3QZPA 2J1WA 5F1OB 1YNKL 1T03H 3ZTCC 4EXPX 4RMBA 2LTQC 4OQTL 4RQQB 3S96A 1CL7H 3UZEC 4PW4A 4JVWA 5T5FA 3TT1H 5GSRA 2EXTA 4IDJL 3TV3H 5L9DH 3KWUA 4JZNB 5IB5A 1R5MA 2AEQH 3BP7B 2HJLA 3T4AA 5DJYB 3O4LE 2G2RB 4HWNA 4XCEB 3VA6A 2MMXA 4YLCA 3TURA 2R69A 3WS6A 2Q8AH 3GS4A 2X1QA 1T80A 4D8OA 5JW5A 3QUMB 2BKLA 1OGAB 3MV01 1CD1A 2UZIH 2NY3D 4UTCA 2FHFA 3R4RA 3KLHD 4P5MA 3B7RL 5CZXD 2CMRL 4FEMA 1MAKA 2AJZA 3M88A 4Z8FL 4HK3N 4LVOB 3N9GL 3N6YA 1M6OB 4PUBL 3CFUA 4NENB 4EIGB 3ASOB 3C5ZA 3CZUB 2MCG1 3NSXA 2F53B 4PRBB 4JM2F 1T2XA 3QUXD 4OZ4B 2ZUWA 3ZE1B 3TH4T 3WNIA 1I3RA 5AYUH 5FDWB 5B1KA 1JP5A 1NA8A 2ED9A 5C6PB 2LU3A 1ZHLA 3FCUB 4HK0A 3MA7A 3KLSA 5B4MC 2J8UE 3HS0C 4XBEL 5FGSA 3PNRB 2VLRB 1HQRA 3D39D 2H0EA 2H3KA 1DO6A 2B3RA 3GB7A 3EOAA 3MLXL 4Y0GA 1NJ9B 1NICA 2UY7A 1AJ7L 4M4RB 4NRYB 4PRPE 4Z18A 4ZJ9A 5GIRB 1OAXL 2FYYB 2WZAA 1YYMH 1FRGH 2DTSA 3UVMA 1PFCA 4TXVB 3PVUB 4XXDA 4X99A 3SBRA 1TJIH 1PZ2A 1R5VB 3UG4A 1UJ3C 4JSNC 3VYNA 1GC1H 2WLLB 1JWMA 1BFTA 3NSJA 1XGYL 3VRIB 4HS3B 3TBCA 4ZFGL 4PJIE 4DUWA 3SDAB 2YAOA 3L6FA 3FTZA 5DC0A 1KIUB 3VFOB 1HINL 1IEBB 2BP0B 2BP8A 4QXVA 1N9PA 2NY7L 5BOZG 4PLKD 3NZSA 1X5JA 1IC5H 2IOIA 2ATPB 3QUHA 2DQHL 4G7VH 4JX0A 5L2KE 3L1OH 5CLXA 4HIXH 5IJVB 4EKJA 4WFFE 5KBNC 3VH8A 3OG4B 2B1AH 3PSLA 2G75B 2O30A 1YEDA 3RN1D 1CXIA 3IMRA 4DCQA 4QHNA 3FRUA 2ED6A 3ZL4L 1H3TA 3QI9A 2VZ1A 3N41F 3QQ4A 5FYJD 2IANB 4DN4H 4DNVA 2B59A 3RZCD 1KYOK 3T3PF 5BV7C 3D2TA 4G8EA 4HIXL 1F45A 2CHXA 3MCG1 3SLED 4U1NA 3QQNA 5E7FA 3QDGA 1PZ3A 3R4DA 4PS4H 4KTDH 4WEBH 1JNLL 3O4HA 2AK4A 5E03A 2J2ZA 2XXCB 4YIQA 6FABL 4M48L 1INEH 1AVAA 4Z7VA 1MCRA 2F8IA 1UT2A 3AWGA 3BAEH 1O6TA 3CLFL 4N25A 4X61B 2MNWA 2R0KL 4JE4B 1N26A 5E9NA 3D25A 1U42A 4NRXB 2PWHA 4F24A 1ZGLA 3MJWA 5CYKA 4OGZA 2ADJB 3EI4A 2ZP8A 2HWZH 3GSUA 3KPPB 3FQNA 5EA0H 2XU7A 5ICYB 3R18A 4PSWB 3MLUH 3SEPA 2A77L 1B0IA 3FUEA 1BFOB 1AZCA 1PBYB 1ZHKB 4G6FD 2DQEH 1YECH 3GK8H 3QUZC 3DWLC 1XWVA 3QH3A 3EMHA 2MQ0A 1OAQH 2H2SD 3E2HB 3ROOA 3WNOA 3HN3A 4IBTA 5I23A 2AGYA 2VM4A 4IA9A 3V4UH 3OKEA 2YK1L 3QRGL 1CFBA 1IEBA 2Y7QA 1AHWA 5FAAA 2X1WL 3V52L 3UERA 1YECL 3L9RA 5DD0L 3QAZB 2G9KA 5T3ZD 1MFAH 4D9RD 4Z7QF 3IFPB 2A0LD 4J3VA 3RWGA 2MIZA 3C8DA 2V6HA 4KNTA 4WGKA 4HXAL 5EIIG 1SXAA 2EE0A 3SGDH 4U2YA 3RWIA 2ZTBA 1RMFH 1FN4B 2QQLH 2R2BB 3DX8B 4D9QE 3RVXC 3T4YA 3K6NA 2HESX 4K8RH 2BHUA 3KBEA 2PKDA 4KKQA 1SY6H 3D69A 5IK3A 2A74C 2MKWA 3U7YL 4KVNH 4CI3A 2X89A 5DEGA 1TVHB 1WFNA 3C9NB 1AD0A 1ZT1B 3VI3F 1A7NH 3GTTA 4PJGA 3BGAA 1KV3A 5FDWA 4G7QB 2B5IB 4GXUN 2BHYA 1KJ3H 3K1DA 1QUNA 4ABWA 2HCZX 3ROLA 3PS6A 1NMAH 4L0ZA 5CEYA 3ZE0B 4P9HH 1S4IA 1V7NH 3MU3A 4O4YL 3RGBA 5GJTL 3SDDD 3SDDC 2XDHA 4V1DA 1I3GH 4LEBA 2VR4A 4YL9A 4FFYL 5CMAA 2IVFC 2UVEA 3VQ2C 1K5NA 1F3JB 4OV6F 12E8L 3X12A 2V7NA 3UCRA 4PJ9A 1N70A 5HVGB 4MJID 4P9HL 1IEHA 1OGAA 3QUML 1TEYA 2E9GA 5E2JA 3V8OA 2VLKA 5CUSL 3DOSB 4ZT1A 1B9KA 1ID2A 3D0VB 4IHBA 5A16B 3RTLA 4CY3A 2EEBA 4IM8A 4PGCB 4ALAL 3H2PA 2X4TA 1NPUA 4IKKA 2C7UA 3KD4A 4KKLC 1JI1A 3VX0A 5HDRA 1QSEE 3LB6D 5A2Qg 1X5GA 4NS0A 3PPSA 4UIMB 3BRFA 1SYVA 3CTTA 1GP2B 4FXTA 1RZ7H 1U3NA 2AQRA 4QRRD 1AGBA 4CDHA 1FO0A 1RUML 2VZVA 4XPAL 4Z7UB 4JPQA 4FYTA 5D4JA 3GXPA 3CC1A 4FTVA 3NPSC 3T0XA 3MJ6A 2OFQA 5FOJA 5AUMB 3IMBA 1OGTA 3K2MC 4LRIC 4N8CH 2F9BT 2NXZB 3PQYD 2CKNA 1D5XA 3O6LH 3PGDB 1TYEA 3ERXA 3KGRA 5EUOB 5DO2D 4BQ8A 4RA0C 1N0XL 3V0FA 1GL4B 4G9FD 3O0RH 3ULVH 5EOCL 5CLWA 2JKLA 2FATH 1DN0A 4C4UA 3KJ6L 1R9FA 1B9ZA 4K5MA 5I76B 3O11B 3ZKXB 1HSBB 4Z7QB 3IRZA 2A6JA 4K71C 1CT8B 3QFJA 2WUCL 3BMVA 2YEZA 4KXAA 1F3JA 3PDDA 3CQPA 3HFQA 1SDDA 4BH8B 1AD0B 1ZT1A 2PCFB 2GK0A 1LDPL 2X4NA 1Q9WA 3AJ7A 1T1XA 3VRIA 4R4FL 5I6PA 2VQ4A 4FKHA 1O6VA 4FG4A 3CFKA 4L8SB 3BAXA 4PB0H 5IFAL 1BM7A 1W72L 4CBZA 4BFRA 1T66D 3ZVVA 2QR0A 1DANT 2A5UA 2MHAB 3PWLA 4X5QA 4NNPL 2HJFB 1DCLA 3V5HB 4OZUA 4O00A 2BS8A 4ZD3H 2Z1KA 1GGYA 2F61A 1J9RA 5AAPA 2BVEA 2YPVL 5GISL 2P7TB 2WXRA 3NSYA 3QO0A 4GQ9L 1XT5A 3HG2A 5IJVA 4UQ3A 1P2CB 3A0FA 5SWSA 1RJLA 4XX1G 4L29B 1V3JA 1QFMA 1WV7T 1G7IB 2G3NA 4JFFE 3OGOE 4ONHA 1EFXB 3BP5A 5EU3B 1F6AB 1DDTA 2EKSB 3JV5A 5LXGH 1TZHA 3LIZH 3ETSA 4K23L 1UUSA 2E76C 5E9DB 5CKAA 4UINH 4M29A 3VXUE 5JIMA 1UB5B 4Z0BH 3K46A 2AC0A 1ZVYA 5I1JH 4XNZB 3BT2H 1KYDA 2PTVA 3FSWA 4LQFL 5K1VA 5BUGA 4DN4L 2QSVA 4YDZA 1C9IA 4XNUL 4QI3A 4NNXB 2YQGA 4WQOA 4RLDA 2Q2LA 3DOHA 5L88H 3CXHJ 2BLFA 2Q76A 2PM9B 1YY9C 3DUSA 4QO1A 3X2QB 1OD9A 2GABA 3WKNA 1L0PA 2BIOA 2XZZA 3I85A 4HFWB 1RJCA 3PYCA 2K3TA 4K3ID 3PWUA 2G5RA 2SEBA 2Z34A 5D1ZI 5TDOB 5B7EA 4U7SA 1CLZH 4WK4B 1OAJA 3GJFH 4HOWA 2ODHA 1PTZA 1BVKA 2VDOB 3T4AB 4RRPA 1E5AA 1GZHC 1N8ZA 4LNVA 2HB0A 1LK3H 3H9ZA 3T6XA 2E7BA 4UM8B 4A63A 4FG2A 2CBQA 4MJ6A 4N14A 1KBPA 5FGCE 2UY6A 4JRFA 4HZLA 5IIEB 2CDFA 1P5UC 5H37A 3OC5A 4Q9CA 3NP4A 4AGNA 2CBOA 4JPIA 3O4IA 4UDUB 2YLHA 2DDQL 3NCEB 1CFSB 3QQ3B 3CZEA 1AZVA 5IOPA 4MWFB 3FU8A 3CSBA 4PD4K 1BQSA 2JCCE 5AKTA 5CJOL 4PY7A 2EUZA 2D7MA 1VRSA 3ULUE 3DM0A 1ZT7B 5IW6A 4UAOB 2E7LA 2C3VB 2Z91A 5GGSY 4PJ6A 2YWZA 4NJAH 4H13C 3I7OA 4DJMA 2KZKA 2WKOA 4W9LC 4XO9A 1GSKA 4XODA 2FEDD 4PJEB 3HS9A 2LU4A 3MBWA 2W9EL 1SOQA 2AXGA 2XWDA 1LP9E 2HG0A 2IQAA 5CIPA 3OR7B 5ERWB 5GS1B 5F0PB 2R56H 4G6MH 4J1UA 4Z7OA 5F3FA 3VGFA 3TEWA 4Y9CA 3EO0A 3ARRA 1GOFA 1UB5A 4OFQA 1I3UA 2AP2A 2YKKA 3DV4A 3CFMA 1DTUA 1YEWA 5DF0A 1MZZA 5E99H 1S7UA 1JDDA 4GUOA 3LN4B 4Y2DB 2V4LA 1L6ZA 2FTAA 1QW9A 4L3CA 4E41D 4EZJA 1GC1C 5J6SA 1KSRA 4QRPE 4BHUI 2RALA 4L37A 2B16A 4WVRA 1ECZA 5FECB 3MLRL 3DMMD 1T6VN 4LBEB 4DVRH 1EEZB 3LN9A 3PQYE 4ZTOH 4P0DA 1CGUA 4WO4C 4W9GC 3B1UA 1C5DA 2XN0A 4JVUA 5LO7A 1LEIB 5BUAA 4JKNA 4QNPF 2NQCA 3ULVD 3MNDA 4L1TA 1Y07A 1MH5A 1OK8A 5DHEA 4XXWA 3I7HA 1BEYH 2KDYA 4YGVB 3OF6A 4XCNA 4PJHE 3L7FA 1EJOH 3Q5YA 4NERA 5EORL 1PLGL 5D72H 4Y1SA 1JVKA 3RL1B 3SGKC 3BP4A 1KTDA 5JIQA 4R97B 4HYTB 3FFDA 4GAFB 5FGBA 4LIQH 4PQXA 5IMMB 3DSNA 3EGSA 1JV2B 1L7TL 4R4BA 1AQDA 1MF2H 4E36A 4N0FB 2P8MA 5GGQL 1XF1A 5CF3A 1Z9MA 3FQ4A 3DDFA 2XWTA 4N8PA 5C08A 3ZKNC 2JH2A 2V2TA 1KTRL 2EJ1A 3NCCB 1AKJB 3O2WL 2CDGB 3EKCA 1CGSL 4N2GA 3ZE1A 3F6JA 1P69B 5DJAA 5DJ0A 2CSPA 1UOKA 2OLDA 3M1CA 4G8IB 4YBLB 2XV0A 4I2XE 2HN7A 3M8OL 3AM8A 1NKGA 4N86A 4JGNA 1KDJA 3QE5A 4P46D 3VB8A 5J6HA 4OI9A 5C0AD 2OK0H 3T2LA 4OF7A 4AIEA 5KEZA 1U0QA 5EO9A 1D5IH 1EHXA 2VLRE 3OAZH 2WLYA 3I75A 4HC1L 5C1MB 5FO8B 1MEXL 3QJFB 4NCDA 2DQDH 3P40A 4AV0A 3OKDB 4HFUH 4YK4B 4O58L 1OCCB 3VG9B 3WTSA 4X9GA 5L8LB 4KNSA 3F3PA 4XBEH 1FDLL 2WPGA 4Y1AD 1QFUH 3QARA 4QHPA 3L95B 5JNYA 1F6FB 1Q72H 5IQ9A 2E3VA 4GW1A 1PLAA 2Z31C 3MA9H 3QXTA 5INCA 1SZNA 5FA4A 1AQHA 2P3YA 4R97C 4W1TA 4FLQA 3VFWB 4DOHE 2Z7YA 4QJ3B 3FQRB 2XQYK 1IC4H 1RJYB 1U8JA 4NLHA 3TJPA 4XPHL 1YN6A 2APTA 5LBSA 2WVUA 3J07A 4O9HL 3NK4A 3OKYA 5E4OA 1MSPA 3GRGA 1DQJA 4XNXL 1FGNH 1B88A 5EU3A 1HYSC 4K9EC 1EZVY 3BP5B 4ERSL 4AK2A 1F4HA 2WNKA 5TE6L 2J5LB 3FPYA 4EE2A 4NUJA 1LWJA 1BF2A 2G60H 4WO4B 3IJ1A 3OAZK 1K2DB 3WEXB 1CLCA 4WU5B 1F18A 3OSKA 3KLHC 3CHQA 4ZOZA 2WTRB 4FQ2H 3SWSD 5L6YL 1EHAA 1PZCA 4JHZA 4D94A 2NY6B 1R6VA 3U6XA 4OCSL 4QMEA 3BYTA 1DFXA 3PABA 3Q2VA 3RWDB 2JCWA 1QD0A 1E4WL 1OARL 2PWFA 1I1FA 4HXBL 2HKFL 5HDQH 5I5JA 1PSKL 3BPLB 1UJTA 4Y19B 1PX8A 1YNKH 1ZOXA 3QORB 3ARDB 2E9BA 4DKFL 3MZKA 3QFJE 3OJMB 1SBSL 1ZE3H 4N9GA 1UM4H 2XU9A 5GS1C 4OF8A 2IDUA 4Y89A 5FDYA 1OM9A 1XBDA 5GRZA 3BG0A 3W1ZA 2E9JA 2EEAA 2NNAA 4HBCH 5EA0L 3CFDB 4QRRE 4BDVA 2HYMA 4YHKH 2CJ3A 4BZ2H 4YSQA 1U4FA 2VM9A 3K0YA 2ZX8A 1A6TA 3D0VA 5CXBA 4TUJB 1NUFA 1Q0YH 2O5YL 5AKVA 2NPLX 3HRZB 3HHSB 3QEQA 4R3SB 2HRHA 3VI4B 5GGRA 2NR6A 3C08L 3FTWA 4UQ9A 2W0FB 1MOEA 1OAYH 4BKSC 2L7UA 4N2BA 1EAQA 2XZQL 4L3ED 5KUMA 4CU8A 4QJ5B 3MREB 2BCKA 4JRXA 3ARTA 1H2WA 4XXWC 5E4AA 2HPTA 1KIQA 2CDEB 5K9QI 1T1YA 1JTOA 2XOTA 2ZKYA 2JFCA 1G7LB 3CFNA 3CLEH 4L4TA 5E8PA 2F8XC 2UWEB 1RP9A 1M2VB 2QTEA 3IJYA 5EDSA 3AS1A 2QPDB 3QVAA 3AL8B 3Q48A 4YFEA 3GMOB 1AY1H 2MCAA 2VXQH 4D7BA 4BFOA 5TQ0H 4I5BA 2GHZA 5A2BA 3FU6A 1MJ7L 1G6RB 2FR4B 3SDAD 3UTSE 1IC7H 5HD8C 1AP2B 2P80D 1MHCB 4JZOB 1EDQA 4LSQH 5DJDA 3U1PA 4PGBA 4JDZB 4LHUG 1NGPH 3V9FA 3UMNA 3VFVA 2OL3B 4MGXA 1QBML 2DLIA 5DUJA 5EZJA 2RQEA 4MZ3A 2QTVA 4PWEA 4E5XB 4PJCB 4JY5L 4QTIL 1IAII 1ASPA 2X4SA 4HIHA 4A66A 4Y5YC 2GTZB 3PDOB 4NHUA 2OMYA 3TZVD 5K93A 1ZVSA 4YXHL 1AJ7H 2GITA 3C6LB 1AGFB 4MD4B 4IKNA 2ZX7A 4GM9A 1L0YA 2XN9B 3KPQB 4FZEL 3IWUA 2J43A 3IYLW 3NEOA 3I8EA 3BD4A 3PWPE 5KYXA 5TEEA 12E8H 1HH6A 2EINB 3CSTA 2YB8B 1U4EA 4XMUA 2BIIA 5DZLA 1G9MC 1MUJA 3TA3D 4Y4HA 5TF0A 4BQCA 1J11A 4LU5H 4JG1H 5AWNL 1RIHH 5H37G 2HU7A 5JIDA 5A2JH 2R0LL 4A55A 1KPRA 3B1TA 3C87A 4NQXB 1QA9B 2N1KA 2D8KA 4OF5A 4U0RC 1MRFL 5FO9A 3ULSA 1I7ZB 4WJKB 5GMKn 1WITA 2HMIC 2D03L 1E3FA 3LY6A 3LNEA 2OSYA 3O2DL 3SN6N 2VDKH 3KL3A 3A0OA 4XBGA 4EIUA 1ESOA 3OM3B 5HYSB 3NVQA 3V9CA 5E2TH 4HCGA 1ADWA 5BRZE 2HWZL 2HT2C 4PP2B 3QDJD 2DYSB 3RTQA 1TVBB 1BJMA 4I89A 2EQDA 4F7CB 3BUPA 1AR1C 2GJPA 1I8LC 2C1OA 4N2IA 4LARH 3UTTB 3MBED 3VJ6B 2CIIB 2VXQA 1PLGH 3NRFA 3HPJB 4K71B 3VXPA 4I3GA 1D6VH 2P5WA 1GKOA 3NIDE 1AO7D 3WKMH 3WNMA 5EUOE 3OPZL 1NIFA 2V8MA 4JW3A 2FBRA 4GW4B 4XN2A 1SMDA 1OMWB 4HFWA 3HUJE 4ISVB 3EH2A 5JUEH 3HW7A 4YNYA 3S4SB 3DO3A 1JF5A 3VA2C 4YPGA 1BMWA 3LJ3A 1MVYA 1ZY9A 3GXDA 4ONFH 1VACB 5GGSA 4OIAA 5D1ZB 4AQEB 3IETB 4LASH 3DBSA 1ZPUA 1R3KA 4JFPB 3SE3A 2J2ZB 4YIQB 3J2PA 4J7RA 5HHPB 5KVDE 5GRWA 3EJUA 3BP7A 4I0PA 5A2CA 3ZIYA 1BZQK 3UO1L 2VN6A 1NSNL 1R5IA 2WNXA 2J6EA 4PB9H 3KPQA 4M6NH 5DU7A 3VO0A 4HC1H 1I9EA 3VXOA 3CMOL 1U91B 2YXVA 3CUPA 1GVIA 1NH6A 2OS7A 3L6FB 2H6PB 2WLKA 4J6RH 4KJWD 4MLSA 1BF5A 3ARGA 4X6CB 3RU8H 3V5KB 3PUUA 2EILB 2WBJD 3QYMA 4EI5A 1CVRA 2YRLA 3FUDA 3HZMA 3BH9A 3INOA 3VI3B 3VFTA 3DVNB 4NKDA 1D5BB 4DEPB 3KCPA 4LIQE 4NQDE 4ICWA 4XVUD 3RIFF 3OZKA 5THAA 2WCGA 1F3DJ 3G6AA 5C3LD 4M48H 4X4KA 3SDDB 4AUJA 4G9FE 1U8QA 4J3SA 3F5WB 2J1KA 5EG6C 1D9KD 4MAZA 5MENB 3FTVA 4LSTH 1Q9KA 1XQ4A 2A0LC 3U4EB 4ZMPA 2DKUA 2VDMA 3NP3A 3OR7A 3V0EA 3AB0B 2BS9A 1ADQA 1OTTC 2JLLA 4UNTA 2FB4L 4JFDD 4XP4H 2IAMA 1GJWA 4CJ0A 4MJJA 4QOKB 5TE4L 4XE0A 1UM6L 3HNTL 1H3XA 3HIZA 1DSFH 3ULUD 2XPYA 3EJRA 4HGKC 5MEQA 4LZKA 2ZP9A 1E28A 1F4WH 4JFXB 1BAGA 1G6RA 5BJTA 4TTGA 3UZQA 4LRNL 2OJEB 2YD4A 3P02A 1JYXA 6PCYA 4ZFZA 1D5MB 2W81C 2JQMA 5HYSG 1F1DA 3TYGL 2AK4E 1F4XH 3IB4A 4AT6B 4A0BA 3H9SD 2CUIA 3QIUA 4GBXD 4MNGB 1OP4A 1O7DC 3T9WA 4ZX4A 3EO9L 1I9IH 5BQ7A 4LPVA 3ZXAC 3QAZC 3VWKA 1TQCC 3C09B 3IDYB 4PTTA 2B08A 5C0CA 2N59A 4H1LH 3SE4A 1UHVA 3DIFB 1A4KA 1YSOA 2B2XH 1YEFL 2CALA 2BCJB 1X6NA 4JFHD 1H6UA 2YFOA 4IIQB 3T08A 5GS2H 4AH2A 1QYGL 2H3XC 4BELD 3TO2A 1KIPB 1ES0A 2P48B 4Z7OE 1NLDL 5L7XL 3MLWH 3BUTA 1UJ3B 1KWGA 1A6TB 1E4XH 3G7TA 1FFNB 1KZQA 1X7QA 2ENJA 2XJLA 2P8LA 3SPCA 1AXSA 5B38B 1OVZA 3OHMB 1AFVL 4YWGL 2CO7B 2GHWB 2YBAA 4PM1A 3GIZL 3ZSSA 3WS3A 3AC0A 4KQ4H 1G9ML 5K9JL 4NQDD 3ZPDA 4N26A 4LAQL 4UZGA 2ZCLH 3BP6A 2IDQA 3Q43A 1U93B 1KCBA 4APQB 4Q9RH 1ASOA 1KB3A 4E2OA 4AITA 3JYCA 5T5NG 4X7FC 1AG0A 1M53A 1MHEB 5C0BE 3RGVA 3CC5A 1JERA 3TCXA 1AGCA 3FNKA 1AYOA 4MD0A 2A38A 2JCCF 4XAKE 5DTFB 1CIUA 4NWUL 4BUJC 4YHOH 1EH9A 1SF3A 5EMYA 3W81A 4U1LA 1OAZH 5HYFA 1G1YA 3ZYIA 4KXZI 3L3KA 4MMXB 3C60A 1HNYA 4FDWA 5BQ7B 2QLVB 2K3HA 2KUTA 4GSDL 2XPGB 3GLEA 5EZOL 5KG9A 5MEQB 1EVTC 3AFLA 1I8KB 3HE7C 4PJHA 4PRAA 4AYEC 1GCFA 3Q8CA 4Q6KA 3VQ1C 1CGYA 2J5LC 2VISB 1MVUB 3M86A 3MACH 2C1PA 3N1MC 5I9QB 4MCNA 3BQUA 2EYTB 2VXTL 2YLKA 1QATA 1UWGH 3MLYH 2ROXA 3GSWA 5JNYB 2GJRA 3IGFA 1IILE 4X8CA 5KSAD 3AG1B 3MOAH 5HP5A 3IGUA 2O6DA 4PJ8B 4W9HC 3H1ZA 5FW8A 4NQXA 3FQRA 2A4ZA 2BY2A 2FUTA 1S7RA 4K7PH 3UBXI 3ZL4H 1X9QA 4P46B 4PJ7A 1K3IA 5I8OL 3A5VA 3RPBA 4J8GA 1JXFA 4PRNA 1X7TA 2XG5A 4M43H 5M95B 2Y07L 4OUUB 3AMLA 5H35A 2G5UA 4FHBD 1PX4A 5A6MA 3SHFA 2WQRA 5IW1A 4YK4C 5BS0E 4NZRH 4U1MA 4P2AA 5EIIA 4HBQA 3MBWB 2OI9C 3KCWA 2VUKA 1NAMA 1NMAL 3IPBA 2DKMA 2HLAB 4GNKB 4JKPH 2YRBA 4B9CA 5IB2A 1SPDA 3HEIB 4FHJA 5DLLA 2AEOA 5F7DA 5C71A 4HIQA 4DFHA 4I3RH 3HI1A 1WIOA 1P84K 4ACTA 1OQXA 5JPMC 2Z1PA 3GWJA 2CH8A 3QORC 4JQIH 2CR0A 2FJGB 1ZPLA 4LRIA 3S4SA 2H9LA 3QHFL 1CDGA 4Q58C 1LMIA 4XMLH 1J12A 5F6IB 2VITA 5DJAB 3LPFA 3C2SA 1ZSHA 2P5PA 2PW1B 2WO4A 4GRLB 3HC4H 4GAJH 3VFRA 5D1ZA 5ES4B 5IGXH 5IMLA 4WK0A 3NYKA 4PRIE 4K73A 4ZMQA 4UCFA 5CLYA 2XQYG 3S9DB 4L8BB 3E3QC 5JHAA 4TRPL 1JXJA 1AD9A 2OMUB 1XAKA 5D72L 2X6VA 3T6ZA 4MJ5B 3WFHA 3DJ9A 3L4ZA 4PJCF 3IKCB 3KVDD 5C2BL 2ZZUT 5EIVA 2Z3FA 2GW5A 4JFDE 4BCXA 4KKBC 2FE0A 5KBKA 3BUYB 1JZ5A 3C99A 4M7KL 2HLEB 4QUOA 3QEQB 2J44A 3LVTA 2SEBB 3V6OE 1NFKA 2BC4B 3C2AL 3F2LA 4QXUL 4WI5A 3WUWB 1VENA 1GMIA 2ZKXA 2GSIB 4QTHB 1H3PL 3DRTB 4DGIL 1OAUL 4L48A 5FYJL 2JTYA 4H88L 3TCLB 2DM4A 1UXWB 5JPNB 4CI2A 1CXEA 3BE1L 5C3TA 5KSAA 1MAML 3D2UA 1JZ3A 2O5XL 3IGKA 4H44C 5E4EC 2X53A 1T5WA 3IDJB 2J8OA 3IJEA 3SDXF 5H35B 4CILA 3MJ7A 4HS3A 2O72A 4M6OL 4CSTA 1UT1A 2HTLC 3CFJA 2YGPA 2ICWB 4PLJD 2LTQB 3UMTA 2OMWB 2UVFA 5C0RL 1BD2B 5ADOL 1CURA 4WF7A 3TIDA 3ZTDC 5D2NE 1I9RL 2CK0L 4RGOL 4Y2DC 3L5JA 2C9AA 4XTRC 3TVMB 5BVPH 2VMEA 4UQEA 5EWIH 3VSVA 3ZTJG 1NDGB 5I73C 5DMKB 1H2XA 5DS1A 3UZQB 4ZOXA 3J27A 5AWNH 4JFXA 3PWPD 1O7SA 2AJXH 2DM7A 4G80B 3VXUA 6FABH 1MLBB 3HNSL 1OE3A 5EBMB 2H0PA 4ZTPH 4WFFD 4JY4A 2GITB 1SGKA 1PZSA 1VEPA 2CK0H 3C6LA 1SOSA 5HHOB 1S7QA 2J25A 3WXVL 1RPUA 4ABUA 1WBYA 2CA3A 3O8XC 4PRIB 5LKNA 1X3DA 2Y06H 2ZOOA 3K6SA 3MYJA 2DPKA 3GRBA 3ALWA 4DQOL 1MHHB 1ZLDA 3QR0A 3DX6B 4P5SA 3K81A 1XH1A 5D96B 1BZOA 3R8BB 3MUJA 5JMRA 3MJ8B 4KY1H 2X4UA 4YSOA 3QCUL 3EO9H 5AAWC 4HZLB 1KCRH 4HCFA 2BSCA 4PY8J 1N64H 3MNZB 4AIZB 3JZYA 1RFDL 5J4MA 2QPUA 4F9PA 2Y9RT 3PJLA 5IOPB 1P0SE 4N0RA 3FB7B 1IEAB 2ORBH 3HTLX 4RRPG 1KFAL 2XHNA 5B38A 2OV0A 3W57A 1HDMB 4OCSH 3LPGA 3NFSH 1THAA 3RFHA 3L3JA 1A9BB 4QYOB 3T2PA 3OLIA 1T7ZA 4L3AA 2WOBA 1ES0B 2KLTA 4HQQH 2DQFA 4P5TC 2WVVB 3C6LD 5CZXC 1HQ4B 3FO9B 3GEWB 4MX7A 5KSVB 2YMXL 5KVEH 4GG6A 2D4FA 4O02A 3GTNA 4FTVE 5KANI 2XZCL 4OKVA 4J8RA 4P5MB 5DJ6A 4FQJL 3ZO0A 2VL4A 3AT9A 3V4PA 2PWGA 3RSEC 3WS3B 3QFGA 2OMXA 1I1AD 4B6ZA 4I0PD 3VXRE 1GRWA 3VXNA 4KZEH 1G1OA 2EKSA 2KQNA 2PMZA 3HZYB 5FKSA 2ZJSH 5DS8A 3QT2A 1QLEH 2O6FA 2PWEA 4UAHA 3FSZA 1FJ1B 4B50A 4XEIC 4J4PD 3V0GA 2YAFA 2AJVH 3U6RA 4QTIH 1R46A 1Y7VA 3DJZA 3OXRA 2IPKA 3N1GC 5IMOA 5ID1B 3AY4C 2VZ3A 1F58L 4NXKA 3MNZA 4AIZA 1U36A 2YD2A 4GUCA 3QDMA 4TNWF 3VXMB 5HHVH 3RL2A 2BK8A 4ZNEE 3M1BA 2HAZA 3JUYA 2ADFL 3DX6A 4HIHB 2YGVA 2VLLB 9CGTA 4UAOC 3BPCA 2WLZA 2R0WL 1KYOJ 1P6AB 2NYYD 4XXDB 5CLZA 5DEJA 3T0AA 5B3JE 1KEGL 5EZLB 2YIHA 2BP3A 2PO6B 2X6MA 1YYLL 2D0GA 2NDGA 4QRUB 2WO3B 5D7IA 3O0LA 3ROLB 3BX7C 4JM4L 3TGXA 5MENA 1R4XA 4TOYH 1GS8A 3OW8A 1PQZB 4B3EA 1JNNH 5I30H 2I07B 2Q6WA 4ETQA 1AZNA 2XFGB 3CWGA 4RDBA 3V6ZB 5CBAB 2DIJA 4HJ0C 5K9OB 5FA4B 3SGEI 2KLSA 1QWHA 2EC8A 3MLRH 3NZHH 1HL4A 3NA9H 3NH7L 3QUYB 2F8VA 4AMWA 5IB4A 4Y9FA 2GAZB 3DURB 4HDIA 1YN6B 1JOIA 1AI1L 3ES6A 4FTVB 1H6EA 4IRZH 1WPCA 1T83C 4NAQA 1IIKA 1EERB 4A7GA 3ECQA 1BIIA 3KHQA 2B1HH 4PBXA 3GLZA 5EN2A 4WI7A 1DQDH 5CS7A 2VDNL 4C4KT 2NDFA 4DK6A 2IH1B 1DQQA 4HPOL 4KHTH 3P3UA 2B39A 3U9WA 2YUVA 2WOYA 3A6CL 1IGFL 2V2WA 2AV1A 4X9FA 3EOTH 4UI2A 1F6LL 4J3OC 1P1ZA 4R90L 4I18A 2QHRH 4ZMOA 3L13A 4ENEC 2H68A 3LRMA 1XCTA 1NIEA 2Q7YB 2IH9A 4FNUA 4LAQH 4QEGA 1EUTA 1VFOA 5F7HA 3Q06A 3D1MC 4TRPH 3VD1A 1G87A 2Z93B 1M3IA 4HIEB 1Y6NR 2UX6A 2BC4A 4B0MB 3DIFA 4HW6A 2ICWJ 3BDYH 5FQDA 2KKQA 1EXGA 3NSCA 3QFDA 3CJJA 3ILQD 5KTEL 1JRHI 1EHNA 1S9YB 5LN8A 4NP4L 5CU9A 1KJVA 3QHYB 2VUOA 3EFFB 4XZ4A 1FFQA 5DYOB 4LGNA 1O9VA 1IKNC 1N6VA 1I1CA 2R56L 2AQ5A 4FQQA 4ZMAT 5ANHA 5F71A 2HX7A 5J56B 2I3SA 4KZDH 2PETA 5CINL 1D2PA 4Z3IA 4J12A 5E8EB 3UO8B 1XGTA 3HR5B 2GT9B 4PBWD 2BM3A 1QRNA 4HMDA 4X50A 1WBXB 2AQ1A 1B0GA 3GI9H 4O1QD 2A74B 4FCAA 3RWFB 2IEPA 2BP8B 4QPEA 3FOMB 4YH6A 5K9KB 3QZWB 5DO8A 3MOAL 3QEHA 5M5RA 2B1OA 4LHJB 3VE0A 4EWRA 4L0YA 1NPNA 3ZKXC 1ADQH 4KJYA 1ETZA 2ICWA 1NFAA 1EGJA 2FBJL 3EYSH 4RVBA 2PM9A 1BJ8A 5EU5B 1WCQA 3OVUB 1CBVH 1M2OA 1TR7A 4Z95L 1ED3A 3D50A 1OCWH 3BIKA 3KXFD 4UT6L 1J7VR 3PLYA 4UYPA 3ZRFC 1TZIB 3SZ6A 2KPWA 2PNDA 3IDYC 3WNJA 4TNVK 3N0DA 2GTWB 5IFJB 1LEKB 5AKRA 1Q9OA 2AQ3A 2R1YB 1GS7A 2OR9H 1J8SA 1LDSA 1KCSH 1VFMA 3MRMB 1T5KA 3HJEA 3CFBB 5F7WC 3VVWA 4JFED 3U0TB 2K9UA 4N20A 3JZGA 1XF4B 4N2AA 3LD8C 4FAVD 2X9YA 2JELH 5DWUH 5E7BA 1HFUA 5TPWH 1XGRB 4GEIA 4NDMA 2OP4H 4ZXBC 2H2SC 3L2NA 4FP8L 4WO4D 1PZ5B 1VPOH 2DIBA 3AXIA 3BO8B 3CVBA 5HI5D 5JA8B 4MMYA 1SXSA