3SBRA

Pseudomonas stutzeri nitrous oxide reductase, p1 crystal form with substrate
Total Genus 174
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
174
sequence length
581
structure length
581
Chain Sequence
b'QKIHVGPGELDDYYGFWSGGHQGEVRVLGVPSMRELMRIPVFNVDSATGWGLTNESRHIMGDSAKFLNGDCHHPHISMTDGKYDGKYLFINDKANSRVARIRLDIMKCDKMITVPNVQAIHGLRLQKVPHTKYVFANAEFIIPHPNDGKVFDLQDENSYTMYNAIDAETMEMAFQVIVDGNLDNTDADYTGRFAAATCYNSEKAFDLGGMMRNERDWVVVFDIHAVEAAVKAGDFITLGDSKTPVLDGRKKDGKDSKFTRYVPVPKNPHGCNTSSDGKYFIAAGKLSPTCSMIAIDKLPDLFAGKLADPRDVIVGEPELGLGPLHTTFDGRGNAYTTLFIDSQVVKWNMEEAVRAYKGEKVNYIKQKLDVHYQPGHLHASLCETNEADGKWLVALSKFSKDRFLPVGPLHPENDQLIDISGDEMKLVHDGPTFAEPHDCIMARRDQIKTKKIWDRNDPFFAPTVEMAKKDGINLDTDNKVIRDGNKVRVYMTSMAPAFGVQEFTVKQGDEVTVTITNIDQIEDVSHGFVVVNHGVSMEISPQQTSSITFVADKPGLHWYYCSWFCHALHMEMVGRMMVEPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Nitrous-oxide reductase
publication title N2O binding at a [4Cu:2S] copper-sulphur cluster in nitrous oxide reductase.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 174
structure length 581
sequence length 581
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.7.2.4: Nitrous-oxide reductase.
pdb deposition date 2011-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
A PF18764 nos_propeller Nitrous oxide reductase propeller repeat
A PF18793 nos_propeller_2 Nitrous oxide reductase propeller repeat 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3sbrA02
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3sbrA01
1EHKB 1CUOA 3NYKA 2H6KA 5TK4A 1A4AA 2BZCA 3AG1B 4ZK8A 3NSYA 1HAWA 2IDFA 3QJQB 4YSRA 2H3XA 4YSPA 5B7FA 1OF0A 1FA4A 4CI3A 3PAZA 1KYAA 2BP8A 4A0BB 3RSEC 2IWEA 1E65A 4KO6A 1YFQA 1PLBA 2CALA 2GNQA 2HESX 1GR7A 1J5DA 1E5YA 3KW7A 3UR4A 3JT2A 1XIPA 2IUPA 4A08B 3QQXA 4QL1A 3I8CA 3PXSD 2YQBA 4A7JA 2AFNA 3E0CA 4H5JA 3FQ1A 3IJCA 5FA5B 4J86A 4L0PB 3OD3A 1K32A 2B5LA 4PC0A 3D12B 3ORVD 4YSSA 4BWWA 3RMZD 1GY1A 1NWOA 2I3TA 4CZVA 3H4FA 1E5ZA 1IC0A 2NRDA 4XYIA 4LG9A 3SJLD 2J57G 3TASA 1N6FA 4CY1A 3G5WA 4JKNA 4F2FA 1HAUA 3FSAA 3CDZA 3PVWB 4DP4X 3DSMA 4GQ2P 2WO3B 2XWZA 4A11B 4FA5D 3UAAA 1WS8A 2YAPA 3ZIYA 2MTAA 4BWUA 4EF3A 2TSBA 1W8EA 2JFCA 1J5CA 2UZXB 4JSNC 3U4YA 2PPFA 1AZCA 1FWXA 2DYSB 2XV3A 4G7QB 3WNIA 4AKPA 1SF3A 2BP0B 2I0RA 2Q7QA 3DM0A 2OVQB 4A2HA 4A0BA 2VMJA 3T71A 1DZ0A 2IAAC 5JWZA 5B3SB 5D4JA 1NIBA 2VSMB 4I79A 2CBPA 2QDVA 2OIZA 1GP2B 4BXVA 4TZ4A 4Y5RD 2AVFA 2EILB 2HX9A 3EH5B 3X2QB 4Y7RA 1JXGA 1NTDA 2XX0A 2P9KC 4U1EI 4A09A 5B7EA 3OMIB 2TRCB 5HE0B 4GM3A 4Q89A 4WTQA 2J55H 2GC4C 4YVNA 3MZKA 4FA9D 1OV8A 3JZGA 3FPXA 2XL2A 3F3GA 3SFZA 1PAZA 2HRHA 2VW7A 1MG2A 1AANA 2CE8A 2Z2PA 1N68A 1ZPUA 2YAMA 1N6DA 4O3TB 3ZWLB 5C2VB 1U2VC 1U4CA 1AOZA 2VW4A 2H3XC 1IKOP 3N0EA 4GXFA 3EH4B 1KBWA 4KNSA 5I6KA 3F3FA 3NVNA 1M9WA 1L9TA 1AZUA 1GY2A 7PCYA 3ZDWA 1P22A 2AH1A 3IN2A 3QJTB 2H47A 2PPCA 2PCYA 3FU9A 2UXGA 4DPCX 2BP0A 3EF4A 3NSDA 1R5MA 4X63B 2ZXWB 4KNUA 3UVLA 4KO5A 2HKMA 4GGAA 4PSWB 2XYIA 3V5WB 3IN0A 2YAQA 3DWLC 1XB6A 2YNOA 1CURA 2B5NA 4QRJA 1F56A 1JZFA 1BEXA 4AKQA 3S3DB 3JRPA 3KRXB 3OKYB 2HYEA 1PNCA 1NIFA 3ULEC 1AG6A 4HCFA 3T6WA 4J8BA 2O9KA 2AGZA 4DPAX 3L4MD 3V9CA 5H1MA 3RLMD 5FXYA 4AX3A 1TEFA 2I0SA 3AL9A 4J84A 2IH8A 5ANHA 4NAJA 1W6LA 5FQDA 2XLLA 4FHLA 4GM9A 1BXVA 4JXMA 1V10A 2FQGA 1J9RA 1JMXB 1AS6A 1KV7A 1RCYA 2BP8B 2FJSA 3ABLB 2H9MA 4HDJA 4J8GA 1JZGA 5GXHA 3IE9A 1ILSA 1OCCB 1SFHA 3HEIB 3FSWA 4G7SB 2P9UC 4CY2A 4IMMA 2BO0A 3PXTD 4A68A 1A8ZA 3UGEA 2B3IA 3RN0D 4HHGA 3I7HA 2HXCA 3DTUB 3EI2A 3FU7B 3FSVA 3IKOA 1HFUA 3UABA 4L3HD 5I5IA 1KBVA 2FT6A 1PZBA 1SDDA 1T5KA 1V54B 2PM9B 3SMRA 4PBZA 5IGQA 4A67A 1BQRA 1OE1A 1RZPA 3OKYA 3PVUB 2LLNA 3RFHA 2VM3A 3H56A 3AFCA 2XU7A 2J55A 3QPKA 1Q47A 2Z2OA 1FFTB 3MXXA 2IH9A 3OW8A 2AGXA 5FKSA 4HCGA 2EBSA 3CDZB 3FYEB 4F7KA 2H47C 1JVOA 4A0AB 2FT7A 3NJIA 1VLXA 3OMNB 2P9LC 4G7RB 2PPEA 1TKWA 3UACA 3ZBMA 1JOFA 2I7OA 2I7SA 3L45A 2OK4A 1AQ8A 3V9FA 1X9UA 2OVRB 3SWSD 4FAND 1IUZA 4X4KA 3NT0A 4GM8A 2UXFA 4DP1X 4ENZA 5I6OA 4GGCA 6PCYA 2EIMB 1KGYE 3T6XA 4H5IA 5EARA 2P80D 4ERQA 5C2WB 4AOWA 1YLBB 4UANA 3OTTA 3CVCA 3UVMA 2AGLA 3SBPA 3PE7A 3JTBA 3U25A 3VA6A 1OCOB 3JB9L 4A09B 3AL8B 3FU7A 1L9SA 1W6WA 2EIJB 4L9OA 4O1QD 5EMLB 4J0XA 5HQGA 1EZLA 3RFGA 4ZN4A 3SQRA 2H6QA 2PM9A 3CFSB 2IURA 3HFQA 3UKRC 1DYZA 3X1NA 4KO9A 4DP2X 3PSLA 1AR1B 4YSCA 4CSPA 4IA9A 1E30A 3WNJA 1JXFA 4JT5C 3GXUB 1SHXA 3EH3B 2IWKA 3X1EA 2N0MA 4CSZA 2H9NA 1PZCA 3NJJA 3WIAA 1QHQA 3GREA 4A0AA 2IDTA 2R7EA 3OKTA 1RZQA 4E5ZB 3FPYA 3I7OA 1ASOA 1A4BA 2OV0A 5I5JA 2IDQA 1BXAA 2FNWA 3X1FA 3CVDA 3SBRA 4CZYA 1ET8A 3B7FA 2BWIA 3OL2B 3BG0A 3EI3A 1N70A 1PZAA 3T6VA 2HXAA 4E9XA 3N55A 4GMBA 4L3GD 1NPNA 3TBBA 3ERXA 1PMYA 2HKRA 3VGZA 5FLXg 1MZZA 3NJHA 2BZ7A 1XB8A 4QLWA 5EM2B 1ET5A 5K19A 4JHUA 4E9RA 1SNRA 4WKXA 3AL8A 1ET7A 1WA0X 4HAKA 1A0RB 4GYBA 2W18A 2AZAA 3IJ1A 4J79A 2JXMA 5B1AB 4AKOA 3RYMA 3EHBB 3NJMA 2GBAA 3EI1A 3AG4B 1ASPA 3EU7A 1OCRB 2E86A 5HE1B 5I26A 5EMJB 4E54A 2DWSA 3GDCA 4M3HA 5AFAA 5I6MA 2YXWA 3AH8B 4GY4A 3C9CA 1AIZA 3NJKA 1KCBA 1TEGA 2EINB 4DP5X 5THAA 2PCFA 3S8FB 2YAEA 2X87A 5H14A 4UF7C 4KNTA 4W1TA 1M57B 2CUAA 2YXVA 4J78A 4JHVA 2UZYB 4E5ZA 4J82A 2P9NC 1JMZB 4DP0X 4FWWA 1BAWA 4YSQA 1AZNA 3IBOA 3TA4D 8PAZA 2DYRB 5EALA 2ZWNA 4N14A 2GIMA 2I85A 1PGUA 4A2LA 4FA4D 1JZHA 1XB3A 2PBIB 2CAKA 3AY2A 3DKHA 1SHWA 2QC5A 3OL2A 2FQEA 3SCYA 4ES0A 3JPXA 4CY3A 2VSKB 3EI2B 1S4UX 2GI0A 3RN1D 3ABKB 4BH6A 1ETJA 5I5MA 2VN3A 2H13A 3I7LA 5AJAA 3MKSB 2Q5BA 1SQJA 5EM2A 4A2FA 2PPDA 3FT0A 4GZ8A 5EAMA 1SDDB 1IBYA 1PY0A 4FAAB 5I28A 2Y69B 5FC9A 4YSTA 3EI4B 3CFVA 2BW5A 1WA2X 3BG1A 3CVBA 2IDUA 2B5MA 2H6NA 2YMUA 4YSUA 1RKRA 2GC7A 1J9TA 3BVDB 1TBGA 3FQ2A 4CI1A 4X60B 4R7AB 4FB1D 4BL0A 1QNIA 1URIA 2OCCB 3BQVA 3JROA 1MDAH 2H5UA 1E67A 2HRGA 1R1CA 4LG8A 3GYRA 2YAFA 3PAVA 4BXSV 4ERYA 2WSDA 3FRXA 3OM3B 5CXCB 2WO2B 3FYIB 3OQRA 1BXUA 4JSVC 4OWRA 4PSXB 3JAMg 1PNDA 3FSZA 5IY5B 2AGWA 3J81g 3FU8A 4K3JB 2YBAA 5EMMB 3I8EA 4GQBB 4J87A 4X3EA 2G99A 2ZONA 1A4CA 4HZ1A 2HZHA 1SHYB 1SQ9A 1ZDQA 1IBZA 4GQ1A 4J77A 2J56A 4XYHA 4A2GA 4OZUA 4DP6X 5C9ZB 4P5RA 1MG2C 2PP7A 3EI4A 2Z2NA 1GG2B 4QKTA 1ADWA 2JKWA 4MFHA 3NJNA 2PM7B 1NIAA 2IUVA 2PP9A 4EWRA 5IT9g 2DV6A 3MX0B 2XV2A 1MG3A 2AQ5A 3HB3B 1BYPA 2UX6A 3NJGA 4DP9X 4DPBX 2YAHA 4W9ZA 4JD2C 3V7DB 2FWLB 2UXVA 1OOWA 2XVBA 3SHFA 3P4FA 4ERZA 3I7NA 2R7EB 1ZDSA 2EIKB 4XEIC 1AZRA 1BYOA 2XXGA 4YVUA 3QJSB 4A2EA 2AGYA 3NVQA 3C75H 2J5WA 3SBQA 1M56B 4YSAA 1TU2A 4U7AA 3SXTD 2FT8A 2PP8A 3PPSA 1A65A 4GP8B 3UADA 3EI3B 4J0WA 5HE2B 5CXCA 5IJ7E 4A66A 1AG0A 4Q8BA 2P9PC 5EMKB 1J9SA 2CE9A 2B4EA 3C99A 1PF3A 3K27A 3SLED 5TF2A 3AG3B 2BWDA 5FKRA 4MK0B 5B1JA 5CXBB 5CYKA 1JXDA 5AZUA 4CC9A 4KOCA 3ZX1A 1JZEA 3H4HA 3CG8A 5E9NA 3PCYA 2FQDA 2XV0A 3V9EA 1XKSA 3GFCA 3I7PA 3UVKA 3QJRB 4KOBA 5GSAA 3MBWB 3QJUB 4Z8LA 2RACA 4O45A 4N4YB 2FQFA 2GC7C 1KCWA 5TK2A 3RRMC 4E9TA 3SVWD 2H9LA 2I0TA 2OVPB 4E54B 3QJVB 3DXMC 2XUWA 4JSPC 1AZBA 4DP8X 4RH4A 2CCWA 4YSOA 5I6NA 3EMHA 2XX1A 1L9RA 3TU6A 4AZUA 1OE3A 3FGBA 5H17A 4ZOYA 1GS6X 3L4OD 7PAZA 3JZHA 2YB8B 4YVDA 2Q9OA 3J80g 1JERA 4JSXC 3ASNB 4N8UA 1GW0A 1JOIA 4ZOZA 4A2MA 4UAHA 1GSKA 1ID2A 3MZLA 2FTAA 5HYNB 1KDIA 1PEVA 5KDOB 5EAPA 2H14A 1MDAA 1AS8A 2B08A 2CN2A 3UVNA 3OMAB 4BUJC 3EG6A 2P9IC 3CZUB 2J56H 3MMYA 1ZV2A 1L9PA 3WG7B 1AAJA 3KW8A 4BK5C 2AH0A 2HJBA 2IWFA 2H9PA 1WA1X 4G72B 2PM6B 3PXWD 5CXBA 5K1CC 3PAUA 1NDTA 2QXVA 5F7AA 2UXTA 4YSDA 4UI9R 1MG3C 4YL4A 1ASQA 2OK6A 4PXWA 4NB7A 4P5SA 4L1QD 3UVOA 2CO0A 4K3ID 1VYHC 5AKRA 1OCZB 2BBKH 3MKQA 1NR0A 4PNKB 4CY5A 3PXLA 1PLCA 3N2JA 4PAZA 4DP7X 5IC7A 5B1BB 2HLEB 1KDJA 1NICA 2AANA 1CC3A 1JZIA 1B3IA 4HHWA 9PCYA 2XL3A 4J81A 5EHFA 3T9WA 2PLTA 2QPEB 1BQ5A 3ABGA 5PCYA 2DWTA 1ZIBA 1PBYB 3NJFA 1PI6A 1TYQC 4G70B 2YNPA 3EWEA 4QT8A 4ESGA 5IJ8E 4BDVB 1NIEA 2OJYA 4E9VA 2GB2A 5FKQA 5B1JC 5GXIA 2QDWA 4X61B 3C75A 2TSAA 1PLAA 3FS9A 1OLZA 4FA7B 2I3SA 2X88A 2YAOA 5FKTA 1GOTB 5TEFA 2YARA 1AS7A 4JT6C 3UKUC 4D6VA 2HX7A 1WS7A 3X1GA 3I2NA 3KRWB 2Y1AA 1V55B 3N0DA 4ZOXA 2P9SC 3S3BB 4AI7A 4PCYA 1CYXA 5D4IA 4LGNA 2DY2A 4GP4B 5I6LA 4NERA 3NVXA 2QT6A 3C5MA 4K9JA 3ABMB 4A11A 4GP5B 3BWSA 1NPJA 3PLYA 1NWPA 5PAZA 5GMKn 5I6PA 1K8KC 2CNXA 5AFU3 1GS8A 4CZXA 1XHMA 4E9WA 4J73A 3S3CB 2VW6A 5B4WA 2IDSA 6PAZA 3NP3A 3PSCB 2QPDB 4CI2A 3IJ0A 4E9QA 3NSCA 1SJMA 2A3TA 3F3PA 2ZOOA 3WKQA 3SN6B 2BW4A 5A2Qg 4ZOVA 3I7KA 4NSXA 2OJ1A 4QQEA 4D0KA 3IIWA 4CI8A 2CJ3A 2MRYA 2BCJB 5F7BA 2W8CA 5HE3B 4BDVA 1GXRA 1QLEB 1A3ZA 1XMEB 1L9QA 3S8GB 1N6EA 4FAVD 1PCSA 3A0FA 3NSFA 1L0QA 2GSMB 2PPAA 3NJLA 1NINA 1NZRA 3JZNA 1JVLA 1ZIAA 4HIPA 5CYKB 5AMSA 3DIVA 3ODTA 1SFDA 3CIKB 3ASOB 2P80A 2MTAH 2CO0C 4YSEA 4FA1D 1NIDA 1ERJA 3AG2B 5LDUA 3K26A 1CYWA 4KFMB 4G71B 3DXKC 2W88A 1OE2A 3AW5A 1RI6A 4AEZA 1I53A 3EI1B 1SF5A 2YNNA 2XU9A 3IEAA 2XYBA 4PBYA 5B7MA 5A7EA 4GGDA 2G9AA 3NP4A 1X9RA 4KO7A 5TDHB 2HJ4A 3FM0A 3UAEA 1B9XA 1OMWB 3T6ZA 1J9QA 3FQYA 3TBCA 2IAAA 1GS7A 2XXFA 4O9DA 2AZUA 4BWTA 1L9OA 3IIYA 2BHFA 5TEEA 4E9YA 1GYCA 1JZJA 4A2DA 4G56B 3VH0A 4F2EA 1WAEA 3W15A 2HX8A 3OKWA 4HCIA 5D4HA 4E9SA 1ILUA 2IUQA 3I89A 5IGOA 1MZYA 2UX7A 1UATA 1BQKA 3WKPA 1AACA 1JJUB 4TXVB 5SXMA 1B9YA 5B1KA 2GHZA 3WI9A 3AZUA 2J57A 1NEXB 2GC4A 4O3UB 4M4RB 4A08A 2VM4A 3X1BA 2CN3A 4HALA 2H68A
chains in the Genus database with same CATH superfamily
3GC3B 2H6KA 4KFMA 4MXVE 3ETBF 2BZCA 3UC0L 4L4VA 5HDBA 2H3XA 2E4FA 4ZO7A 4JRXB 2J8OA 2DS4A 2FX9H 3GJFK 4KDTC 4NQQA 4NBYB 3M1BA 3KW7A 2DMHA 4JFFD 3FT3A 4AL8L 1PY4A 1EXUA 4TNWF 2C3GA 4R90L 4DFHA 5CMAB 5G5DB 3V0IA 4BZ2L 2QKIC 5D5MB 2ZKYA 4PRAA 3VXTA 4RISH 1WG3A 3IJEB 3MFGB 4YSSA 2K9UA 1ETZA 4GKOA 4LLWB 1RP8A 4J2XA 2Z7ZA 1JBJA 2DQIL 1THAA 2OCFD 3B9DA 5AYTA 1MCCA 2VMCA 1DQQB 2VLLA 4P3CH 4OLYL 4IMLA 4LO9A 3GXDA 1OP3K 3GZPA 4EF3A 1MW0A 1J8HB 4OFVA 3JVGC 1C12A 5C2BH 1CGUA 4K73A 4FCAA 1JNJA 2VMJA 2WQ8A 4N2MA 1EEYB 4PM1A 4PV1C 1ADQH 4UQCA 4ALAH 2A74B 2AVFA 2X10A 3CVHH 4PBXA 2OL3L 3WKYA 3EQ8A 5KVFE 4AH2A 2BFVL 4D8PA 2R56H 4KK8D 4WTWA 3POHA 4N2CA 3MZKA 4QRSB 5EO9B 1FPTH 4OH2A 4FZ8L 4L29B 4WW1A 5KVMC 1NMCC 1AE6L 4L0ZA 3MV9B 1YUHA 4JKKA 2DYPB 3NESA 2DEWX 4OZFB 2EYTB 4EKJA 4JFZL 2XI9A 3EYUH 5C2VB 2DLTA 1LE9B 1FNSH 4LP8A 1KWGA 4HAFA 4TKWA 2HJLB 3LH2L 3RNQA 4XP6H 3P4MB 1AHMA 5G4OA 2V2TB 5DJYB 1U8MB 3O11A 3QK0A 4LLQB 4L3FA 5AKSA 4YHLL 4GSQA 3PV7A 5J6GB 4KNUA 1SJVA 3JZ7A 4PRHA 4D9SA 1EO8L 1E4XH 1NQBA 1DVFB 5I15L 3COOA 4WNQB 4ABQA 3B7RL 3DDGA 2H45A 2WWOA 1GC1L 5AKVA 3O6ML 1PNCA 1NIFA 3VG0H 2B9BA 4PS4H 4PJ7B 5F7UA 2WOYA 1RUMH 2OXGA 2QV4A 4KDVA 2JWYA 4RSYA 3ZE2E 4C54A 1XBRA 1AGEA 2A6IB 4Y5XC 5B39B 2D31B 1HJBC 2IMMA 2DBLL 2Z1PA 5LBSL 4MNGB 4ADIA 5IKCB 1P4LB 4P4RB 2A4CA 3JTSA 5GGTH 4K8RH 3CSYB 1BXVA 2R1WB 1AMXA 1PGRB 1PEWA 3WN5A 4Z7WB 2BHZA 1G9MC 3EGSA 3PWUA 1SFHA 2YN5A 2XWJB 4XX1G 1KXTA 4JZOA 1A8ZA 1L0PA 5GISL 1GVIA 4N0YL 5KBPA 5G4MA 3OB8A 3F5WA 1SUHA 1SJHA 3BSZA 5HI3D 3WY1A 4DQAA 4HK3J 3MI6A 5EIQA 4EDXA 4GG8B 4RFEB 3VXUB 1G7IB 2R69L 5C8JB 3W1ZA 1FVCB 1TCMA 4GT7A 3BVTA 2IH9A 2NZ9C 4PJIB 4WHCA 3EFDH 3RFZC 3KPRD 3OSVA 2F08A 4HF5L 3ZBMA 5AYUL 2DQGL 4MMZA 1ZTXL 5MEOA 3L45A 3C5SB 3WFEL 4PRNB 1BQUA 5ITBH 1IJ9A 3Q01A 3JYCA 4G59C 3VTTA 3UZEC 1JHTA 2YD9A 4ERSH 1Q9KB 3OKDB 2YRBA 4K94C 5C2WB 3RU8L 3KR3L 2HWZL 5A6MA 1YEHL 4M7LL 4QTHA 1KJ3L 2G0KA 3LB6D 1A6UH 1EJOH 2NY4D 3U25A 4B53A 1KENL 5EIIB 3B8YA 5AVVB 5DJAB 1JS4A 5KW9L 2XN9D 4NO0D 2H6QA 5I8KH 1AQDB 1GGIL 1GZQA 1BXXA 3D85A 3N41B 1SY6A 4HK0A 1AQMA 4ZUWA 2NX5D 2H9NA 3GK8H 1HHJA 4FNLL 5C0JB 4JDEA 3SDXB 3QBTB 3QGVA 4FXGB 4HC1L 4PJGB 1IFRA 5DJZA 4A0AA 2HTLC 4M5YL 3GI9H 1BEYL 3B7UX 3SDAC 1F90H 3AWEA 3Q8CA 4FNTA 5C0ND 5FDWB 5FO8A 2VDPA 2FNWA 5FA4A 5T1LA 2H6OA 2VJ8A 4ZMQA 4OZGA 1CBVH 3EI3A 5B3JF 4EWRA 4JFWA 3LXUX 3PGDB 2HKRA 4DAGH 4FADA 1JZ4A 3INUL 3QE5A 1KFAH 5IHZA 2XPZA 4XCNA 4CSPA 3MR9B 4E9RA 4Q97A 4DKEH 1FAKT 4KJWC 3RTQA 5DRXB 5GS1A 5FW8A 3HI6L 2E75C 4U0QB 3MRJB 4XBEH 1PJ9A 1JGEB 1U8LB 1DP0A 5HY9B 4A6YL 3AG4B 4WNSA 2VXQH 2A73A 3FDWA 1JK8A 2XNAA 1LJMA 2M8XA 4GSRA 4QXWA 4XCEA 1A7OH 3MAWA 1W0VB 4TQ8A 5JIKA 2XVLA 2H41A 4OZHB 4Y1TA 5E8EB 2H6UA 1L7IL 5J3HD 2VIRB 4H13C 3QQ9C 3JWOH 3M7FB 1XCXA 4LCCB 4BELD 4FG2A 4L05A 3FHEA 1EANA 5K39A 3VWJD 5IUCA 3EJPA 4Z8FH 4HKXB 4UT7L 4PVLA 5DGRA 5I18L 1J7VR 2VAJA 2IPTL 4ES0A 1DVYA 1VZ3A 4B9YA 3ABKB 1KB9J 1KIQB 2Y24A 2VUKA 3BUDA 3T0BA 5EBLB 5HDBF 2G30A 3GBDA 4ZFZA 1QHPA 2Y36L 2EDDA 3QYCA 3EYOB 1G6VK 1SLVA 3LZPA 3MUHL 1NBYB 5AW2B 4X8JA 5ANMA 1J1OH 1UEYA 1FZKA 1M1XA 2EXYC 4X7DC 1RKRA 5GS3A 1WT5C 4QGTA 2E9BA 2H3NB 3O2DL 3WUWG 2YPKB 3O9WB 3OXRA 3TA3A 4JB9L 4TRPL 2VR3A 3PAVA 5F1KC 2CM6A 4BXSV 2GJZA 1VFAB 3OM3B 3O6KL 5FUZL 2A6KB 4I9XA 4NRZB 3WS3B 3KLKA 1QSFB 4GQBB 5BOPA 5KSBA 1U8CA 3V4VL 1TFPA 1SQ9A 4ONGH 1IBZA 1NJ9B 1PSKH 1T3FB 4YLBA 1JPSL 2DI7A 2W07A 3LNIA 4ZXBD 5C9ZB 2PP7A 5AD0A 2LGNA 1NAKH 2Q20A 2L7UA 2WLMA 3CHSA 3F7KA 4XO3A 4ZFGL 4ZFOA 4WK4A 4HWZA 3PHOB 4UM9B 5ISZD 2AQ5A 2VN5A 1DL7H 2ATKB 4NNYB 3BXNA 1G7HB 2BX5A 2WIIA 1JTDB 1XGYH 3B2VH 3WSQL 3VDCA 2WKOA 5IJVA 1X4XA 4UQ3A 3NVQA 4QHMA 1A0QL 4KHXL 1UB6A 5FOJA 5L6YL 4FLQA 3CIAA 3DGGA 4NO5A 4U7AA 3SXTD 5IF0B 3PPSA 5GGQL 4M62H 1R75A 2VABA 4WSGA 4B60A 3T4AC 3K27A 1ROWA 3OAYK 2CHDA 1G7MA 4MHHI 5JQ6H 2OMZB 4U6XB 4ZUVB 3IPFA 1LP9E 5KVFH 2G9HB 4AM0B 5T1KB 4F7PA 1VRSA 1XD0A 2ZCHH 5K33A 3QFJA 1P84K 3FHAA 3K6DA 2UY7A 2UY6A 4GXVL 4LQFH 1KEGL 2QVFB 4F8NA 4JFYA 4ZAKB 4KVNL 5J11B 4FQHA 1YO4A 1EDQA 1HU8A 2W1NA 3GSQA 4KH9A 4FNRA 3TBVB 2Z31A 4MA3B 4ONFL 1OAQL 4H88L 4LSPL 3DX9B 4ZOZA 2X70A 4FLSA 2J25A 2F58L 2DLGA 1Q0XL 5EAPA 4NNPL 4JG9A 1QFMA 3LRGA 1DSFH 4PWJA 3MZGB 1TF4A 3BD4A 3VFMB 1EVTC 3PP4L 2AGJL 2RGSA 3U7YL 5KAQF 2J56H 1EFXA 4HJIA 5BZZA 4YX2H 3I9GL 1L9PA 1IKFL 4HZAA 4BBWA 3QUGA 2QELA 1CMOA 4PXWA 4YDKH 2FHFA 2VDKH 1A21A 2Y2TA 4UUJA 3CSGA 2DWDB 2FZ3B 2R39A 2WLHA 3HR5B 2YRLA 1SXCA 1RZJC 1HKLH 1FLRL 1YYLL 2D0GA 1A3RH 4NC0B 4PAZA 4C4UA 2X6MA 2AANA 1CC3A 4HIJB 2QV2A 3DVNB 4XPHH 1A1OA 3NMEA 5AB2A 1TLMA 1ZWIA 4YLCA 2XDHA 2Q8BL 2V5TA 3SBWA 2AQNA 2F53E 2ZP8A 1M53A 3Q9QA 4RIRA 5FKAA 5J56B 2DWXA 1D5XB 1PLAA 4UQIM 3FSOA 3MZTA 1BVNP 5SWZB 1KN4H 1OGAE 4ISVB 1X6NA 4MSWA 2LT9A 3X1GA 4C56A 3T04D 1V55B 5EC1B 3LPOA 3W11D 3ARXA 1R5WB 1RK0A 3QIWD 3NCEB 4HXAH 4Z7UA 3L2LA 4JO4H 1HK6A 5DFAA 4PBVC 4YPJA 2Y22A 1NWPA 5IQNA 5IMMB 3HS8A 2ITEA 5KYYA 4ZMPA 4AEHH 2ZCKL 4FYQA 3KWUA 3D18B 4E9QA 2XWBB 5MENE 3NN8A 3GSNB 4CJ0A 1ETB1 4K9EC 5A2Qg 3D25B 1NC2D 3ZE0A 1UD4A 3NSXA 4CW1A 3VXOB 1TDQA 2DTSA 3BSZL 1LO0H 3SDDB 2I5YH 5HE3B 2BHUA 5C9JA 5BVPH 1Z5LB 3IDMB 1JZ8A 5HYJB 2GSMB 5EFIA 1D2PA 1JVLA 5FFGA 4WK0B 3DRTA 5ITFB 5BXFA 3CZFA 3VXRD 3HG1D 3UTQA 1FFOA 2P9RA 1E4KC 2VERN 4NFDA 3MXVH 3SKUD 5C08B 1N0LB 3DNKA 4OZGF 43C9B 1NFDF 1NAMH 4DETA 1RUPL 3D2UA 1NCDL 4DK5A 2YO3A 4PJAE 1UZ6F 3AY4A 1X5JA 1T2QH 4XPBL 4AMZA 2ZUQB 3ZKXC 3I2CL 5KVEL 2FX8L 4OJEH 4WFGE 3PWNB 4Y1AE 2X4TA 4OGQC 2HJ4A 5TFSL 4UDUB 3UAEA 1AO7B 3ORJA 4IGBA 2AXGB 3MBEC 4KPHH 5BV7C 1J9QA 1MFCH 5CF3A 2XZQH 2TRHA 2M83A 3ARED 3ZE1A 4ZJ9A 5A2JH 5ADPH 1SY6L 1A6TA 3EG9B 4P2CG 4Z0XB 2OX5B 3EJYC 1TTFA 3QHFL 4ZMNA 1CFNA 1MRCH 3IWUA 4D9RD 1UTCA 4Y5XB 3KM2A 4U6VL 2VDPL 1JGVL 3ZQ9A 4WCYH 1DLFH 3K4DA 1WEJL 5ENWB 3S37L 4QKXB 5BS0A 1XF2B 4FI6A 2BP8A 3QZPA 3RIAK 1LVEA 1LK2A 1S78C 3QZLA 4OVVA 3HC0B 2IUPA 2QGBA 1RVFH 4NDMB 1QRKA 3PQYA 2ADIA 2YQBA 4NUJA 5SV3A 4ESKA 2EDTA 2NT0A 4WO0A 2R8SL 3L81A 5JPNA 1LD9B 4H8WL 4PC0A 3TYFA 4UU9A 4CSSA 4XP1L 2K45A 1FF5A 1E5ZA 1OW0A 3QRGL 4JFUA 2DL2A 3D0VA 4QAWA 1M42A 1CFVL 1F2XK 3IFLL 4MJIA 3AM8C 1J0JA 1HAUA 2GABA 4GFTB 5T8IA 5H37H 5K9KA 3RFZB 2Q76A 4LCWD 3TS8A 1T4WA 1MJUH 1ZT1A 4GKLA 2DYSB 4G7QB 3RVTD 3QFDA 3ULUC 5C09B 1DUZB 4FDWA 4FXTA 5KSBF 2BNQA 2VDMA 3NAAH 1XBDA 4DCQB 3L9YA 2XZAL 3ZDYE 2VITB 4D3CL 4XMUA 1WF5A 2HFFB 2NXZC 2CBPA 4KMQA 4YDJB 2GFBB 2Z93A 4N9GB 1MCPH 4R5VA 3W81A 1XEUA 1KBGL 2Z92B 2WZPA 1S7TA 2XKUA 4EVNB 1ECYA 3U0WL 3EDFA 5M5SA 3JTTA 4HIIB 1PD6A 4JANA 4MCMA 4EBQL 2WKOF 4DW2L 5T1MA 4K5OA 2BY3A 1KCSH 4LLVB 1WISA 1I8IA 2VXTL 3HR6A 1BQHB 3KLDA 3H9ZA 3OGOE 4P07A 4FABL 2BMKB 5AAMA 5I16B 1SYVA 3PWJB 3KPMA 3ZDWA 3IN2A 4IU2A 3ARFA 2VZSA 3BZDA 4W9KC 1G5GA 4JM2C 4Y89A 3CZSA 3SDAB 4LOEA 4QD2E 4D0DA 2KBGA 3LY6A 4LEBA 4UIKH 1A02N 1SDYA 4GXUN 2YRPA 3P77B 4NRYA 4QOKE 1XGRA 1L0YA 4FL4C 3ATEA 4PCTA 2GSGA 4MD5B 3ZT6A 4L3EA 4YXLL 4QXUL 2X12A 4ZFOL 1QFWL 1HKFA 3QUMB 4LGSB 5D1XC 5CJ8A 3T6WA 1SMOA 2ZF8A 3AU1A 3FCSA 4KJPD 4J3TA 4OAWB 4Y4FA 2GTWA 3MV8A 5AG8A 2EDFA 4MJ5B 1F3DH 5HHME 3WELA 1R3JB 4U0RC 2C9RA 3Q8FA 2DH3A 2IH8A 1YRKA 4AC2A 1JZ6A 1QNZH 4ENED 3HBQA 1KB9K 1D7CA 2OMNA 3T3PB 5IQLA 1HL4A 3L16A 1AH1A 3JV5A 5IB5A 4IIQC 5IFAL 4P04A 1EAPB 3FQTA 4Q9BA 1BGXH 1AGFB 3TPUA 2WLIB 3LVTA 3H85A 4N24A 2DM3A 5JR1L 4A68A 1OAYH 1VACA 3I7HA 1ZLWH 3DTUB 1CLVA 1S7XA 3FSVA 4MNHA 3IKOA 1KBVA 4MAYD 1PZBA 3TTYA 3RPIA 1T5KA 3EH1A 2FUQA 3UPCA 1OE1A 1CS6A 3QIBD 1C5BL 1ZXKA 1QEWA 1EZSA 2J55A 4LSQL 1KEML 4TSBL 2VDRH 2P8LA 3FMGL 4PR5A 1OPGL 2NQ3A 5TDPA 3MOQA 5E95B 1MFBL 1TKWA 1W2KT 5LAXA 4H8UA 4N2AA 3QJOA 5K69A 2NXYC 5DQDH 4Z5RA 1RPKA 3RVUD 3VUAA 5HYSB 4Z9KB 2OVRB 2JKRM 2NOYA 3WCYA 3NT0A 2HKHH 2UXFA 4IOIB 3IJHB 2WWNA 2EIMB 2BCMA 2OJZL 2P80D 3OTTA 2XDWA 2QPFA 4HJEA 3VXPB 1HYRC 1RURH 1WBYB 3PUCA 4Z7UF 1EIBA 1Q1JH 4P23B 3PGFL 1DLHA 3S48A 1L5GA 2E9WA 2HG5A 3BIKA 2JB6B 2AK4D 2DWEB 4U1GC 5IHWA 3MCYA 2BSSB 2IURA 4Y4KA 5E4AA 5AAPA 5B8CA 1JG9A 2W0FB 1ZJAA 1HCVA 3HUJE 4LASL 3NCYP 3NACL 1M6OA 4KMLB 4OD2A 3VD5A 3BRFA 2B4CC 2SODB 3GXUB 5EU3B 5E0FA 2EDNA 1JN6A 1OT4A 5F7DA 3ZE0F 4WEMB 3QI9A 3UTPD 2PTVA 3JQOB 5BRZD 2OW6A 2JTYA 5FKPB 4MB4A 2ATAA 1OP4A 1TLKA 4ES9A 5IQ7L 5CUSL 2Z8RA 3Q6FA 3Q5TA 3X1FA 3TH2T 4LAQL 5HVFB 5JMRA 1A6ZB 5E9DB 3BG0A 2JI3A 1F42A 2BVPB 3N04A 2APTA 1T89C 5FLXg 1COBA 5TF1L 2BZ7A 2X4SB 4U6TA 4WUUB 3VSUA 1CDBA 3SQBA 3T4AB 1KGIA 1TPXC 1X5HA 3AL8A 3CHQA 2CCLA 3IJ1A 5IG7B 1J11A 4ZMVA 1HXYB 4QYAA 3SKOB 2OTPA 1ASPA 4JN1L 3GDCA 5HGHA 4GSDH 3UAJC 2EXWD 4TVSa 4DNLA 3AT8A 3LMJH 4GY4A 2XG5A 4ZW8A 2FATL 4YUEH 2YAEA 4KKQA 3LDBC 3ZE1F 2DIAA 1KPUB 3UJTL 1EHXA 4MCZB 1BAWA 2NMSA 1AZNA 4YSQA 4OF3A 5I1DB 5GQBA 4X42A 2BIPA 4NOFA 1TQSA 2HLAB 3WNMA 3HE6D 1VKXB 2VSKB 5J6HA 1XGZA 1BVKB 4WI5A 3HS9A 3BP4B 1UQSB 2G3MA 4J3UA 3VB8A 2HRPL 4FQXD 4XBGA 1I1FA 1Z9SA 3T0DA 1KSRA 1U8QA 4HDIA 4L4TD 3V0VA 2BW5A 3EI4B 3D6GA 4Q4EA 5DRWB 4HZLA 5TE4L 4LCVA 1FGVH 1NUGA 2AJSL 2JI1A 3MRGB 3ZZLA 4HCRA 2QVTA 2WUBL 1FJ1B 3OVUB 1BVOA 4LCUB 4JFEE 1EH9A 4X5PA 5IVZA 1JNNH 3BQVA 4Z3TA 2OMYB 1TTGA 2RTTA 3ECBA 3G6JA 4J3OG 3CFBA 5I1IL 1K5NA 1QTSA 4LG8A 1QABA 1EXHA 3CK0H 3LZQA 4OGXH 1AR1D 2WQVA 3BQUD 4P57A 4JLRB 5C0BD 4U1JB 1E2ZA 5AEAA 8CGTA 2FR4A 2E8YA 2AMUA 2HB0A 2X4QA 3KE0A 4Y88A 5JIMA 1XF5B 3V0FA 3ZW3A 1GCYA 2ESVB 3GUTA 2CHWA 1LQBC 1AHWA 4A2GA 4OZUA 2VLRD 1NLDH 4O02B 2QBWA 3FN9A 4NWUH 2DQHH 3QEGH 2ITCB 2EEBA 2PP9A 2VDLH 1I8KA 4FXKA 4FEMA 5D1QC 2XV2A 5HGBB 2UX6A 3HC3L 1ZA3A 2VLJA 4F8PA 1INDL 2DEXX 1S5HB 4TLTA 1OY3B 4NUQA 1QQDA 4OLXL 2R7EB 2YGNA 4RGMB 5F9AC 3G5ZA 1AZRA 4Q6KA 4TQHA 2DLIA 4YVUA 1NLBL 4PG9A 2SEBB 1M56B 2JCWA 4LNVA 3RWEB 4E41E 1QSVA 1HIML 3CDYA 4Y19A 5IGXL 5HE2B 3MU3A 4LSTL 3N42B 1I1YA 4NNXB 1QO3A 3B9KD 2A9BA 3TEUA 5MP6L 1U8JA 4X2UA 1AZZC 2Z0UA 1R5VA 1RZGA 1FFNB 3B2PA 4I89A 5KSAC 3APFA 2JJWA 1CB4A 1Q1PA 3L3JA 4Z7NE 2OMTB 3Q5OA 3MUGA 3X11B 2ZKHH 1N8ZA 4XHQA 2V2WA 2H9LA 2VDML 1P5UC 2OMXB 1ZVYA 4PJDE 4Y16C 4CMMA 5I30H 3RDTD 3MJ8B 5EF2A 4JO1H 5IHUH 1UCBH 2XVKA 1FH5H 2JCCE 3SOBL 4N5ED 3HZKA 5F7NC 1P7HL 2XWTB 3V6ZB 3ZKXB 4Z18A 2Q9OA 2OJEB 1JXKA 5G2NA 2CIIA 3E38A 4HEPG 5C0CD 2VXSL 1EAQA 4ZOAA 1J86A 2PYEE 3AQYA 1Q9OB 3ARGC 2NUTB 4JDVA 4HFWA 3WG7B 2YSSB 2PM6B 5T3ZL 3FUEA 4GRMA 5FDYA 5DTFA 1CDJA 5DSCB 5KN5B 1PG7X 4AYBA 1BYNA 1CQKA 4YSDA 4BZYA 1W15A 2CPUA 3GWJA 4RRPA 5B4MC 1E8ZA 1KZYA 1G9NH 1OCZB 1VSCA 3G9VA 1K2DB 3QDGA 2PO6D 3CDCA 2HPTA 2C1PB 2OZ4A 2EH7H 4KMTL 1OTTD 2YPLD 3BH9A 2XRAL 3ENEA 4UZGA 1HHGA 2WXMA 1YMHA 3R8BB 3CDGA 3BLKA 1HE7A 2XL3A 3FBKA 4NRXB 1LMIA 2VOTA 4LNRA 3SKMA 3TZVB 1ZIBA 3MV7E 3ZVVA 4QO1A 1E50A 4OV5A 5CCKH 1UEMA 3T0EB 4PCKA 3BIBX 4HISA 4I2XE 5LLIC 2N1TE 2QDWA 1F4XH 2J8UA 4P5MB 5AZ2H 4O51B 2V7HB 5JA8B 3O4LD 1CD8A 3KRWB 3DBXB 1ODUA 5TTRA 3HI1B 5EEXA 5CD5D 4EUPH 2YD6A 1ND0B 1OSPL 4PV9A 2HVJB 3LXBA 4OCYH 5DJ8B 3C5MA 4PRPB 4A11A 3VWKC 3PLYA 2EXSA 2IAMB 4MKTA 4BSWA 5D70H 3B3IA 4AQ8A 2V2XA 4QTIH 1I9RH 4E9WA 5SWQA 2YD1A 3PJNA 5CIPB 3NSCA 2A3TA 2WM0A 3MNWB 2ZUSA 4NQDE 3S96A 3VG9B 2NXZB 1UGKA 1I85C 5LBGA 4Z7VA 4GH7B 1HINH 4KXDA 4ZQKA 3NJVA 4WWKC 5IROC 3EBIA 4JO3H 5EU6A 5EORL 2WTRB 3U0TB 4OIBA 5K1JA 1ZV5A 4R7LA 1FNFA 3EO0A 1HC1A 3FO9B 4AX4A 4XTRC 2H2PC 1HI6B 3F7RA 4DVRH 1RK7A 3WEXB 1I3RB 1MCJA 4DN3H 4QRPB 3TNMB 3VFRB 2WZAA 1XCWA 3BLBA 4JPIA 4XP4H 4Y4HA 4HS3A 1TYRA 3VFWB 1F2QA 1GGBL 2VRKA 2VDOB 2X9WA 4R84A 1AD0A 5IZ7A 5TF0A 4EEEA 4NFCA 3CZEA 2NSMA 1OMWB 4QYOB 2RCSH 3EYVB 5I17B 2WWMC 3S36L 5JO5A 2P43B 3UEZA 1A6WH 3C5JB 2CUIA 2BHFA 2W95A 2CO6B 5F9WC 3W15A 2VRAA 2YLHA 3MA7B 1IGFL 2Y9RT 5IVXE 2EE3A 2UX7A 4UV4H 3WJJA 2FJUB 2A9CA 5ICXA 4TXVB 3QUYA 4JFTA 5DZVA 5J89A 4XXWA 3HCVA 3VI3E 1QYGL 3BEWB 2I9TB 1A4JB 1FL3A 2CDEA 4JO2L 3CVIH 1TQBC 4MAUL 4EZLA 1AI1L 4J6RL 4U0RB 5C0EA 5D2NE 4U49A 4AG4L 3BAEL 1FZOB 3OKOB 5EWIL 3CX2A 1AP2B 1CXHA 3IVKA 3HNSL 3UBHA 1CG9A 1PX8A 1PU0A 2IWEA 3LAFA 3O0LA 2NNCA 3GSUB 3U7WL 4IIQB 4JK0D 1HXMB 2X6UA 5DURD 2R27A 2CO3A 4GS7C 5J1TC 2FYYA 3FB7B 3QPQD 4P3WA 2VQUA 1FYTB 3ZRFC 2MCAA 3SD5A 2DH2A 3VCLB 1DTUA 3G6JF 3TIDB 4CY1A 2ENPA 3FOLA 1J0ZA 5F7MC 3PVWB 1NFAA 1D9KC 5SV4A 4Y7OC 2DQEH 3UAAA 3STZA 3ZIYA 2ZPKL 1SJXA 4DVBB 1E6JH 3HE7D 4XNUH 4AKPA 4JFOA 1T5XB 5DMKB 3FZUD 3Q1SL 4H44C 1A9EA 1P2CA 2NXYB 4JRXA 3TO4C 3T6QC 4WGWB 2P5WB 2HLFD 1FL6A 2YOCA 3WNOA 3T8XB 2QDVA 4TZ4A 3KYMA 2P3YA 4UBDC 1EX0A 4LPCA 2AV7B 2YR3A 2NNFA 4AUYA 1B0RA 4HETA 3QEQB 3VGAC 4U1GB 4FA9D 1UUSA 3CC5B 4HCRL 3U4EB 1FGNL 4BQ8A 3FPXA 4LLWA 4EPSA 1UM4L 2FIKA 3BWAA 3RWIB 3S9DB 1MG2A 3BT2L 5BNXD 4S1SH 3QZBA 3UGUA 1YMMD 4D9QE 1LO5B 1W8OA 4LRNH 1W72A 1MPAH 3O6LL 3LNFA 2PPCA 1Y7VA 3BPOC 3FU9A 2PW1B 2Y1YA 4NI3A 5IMOA 3TWCL 3U4BH 3W9DB 1HHIA 4FFVC 1BG9A 3QWRA 1R5MA 1HOCB 1MREH 1P1VA 4KO5A 2M2DA 4Z23A 3V5WB 3LRSB 1G6RA 4XO5A 5I8CB 5LGJA 1R47A 1XB6A 1LGVA 2BK8A 2WVVB 4PJ5B 5IV2B 3FJTA 5LUMA 2W60B 3RKDC 4PWEA 3RAJH 3TJEL 1T2XA 1BQLL 3CZKA 1TPXB 3GZOA 4FFYH 4XP9L 2ZX7A 3PDDA 5EO9A 3MLTA 4L29A 3G9AB 5AOKA 4AGPA 3N43F 2WSPA 2DYPA 3CFEB 1EMTL 4OZFA 4DPAX 4HBCH 2WQUA 1A64A 4AIXA 5CKGA 3IDNB 2BZDA 2X4OA 1E8YA 5SX5H 3LDBB 2H9MA 2DJMA 2MPVA 4HDJA 3P4MA 1MOEA 5DI8B 1A5FH 1UD2A 1OB1B 1U8MA 1ZA6B 1PL3A 3FSWA 3I9PA 1X9LA 4JO5A 4K3JL 4A7GA 5E6YA 1WJ3A 2FO1A 4F8OA 3PXTD 3M17A 3RJQB 3QH3B 1AY1H 3MRNB 1QFUL 5GS2D 2XQYA 5JW4Q 1F6LL 3FB5B 5KSUB 1DVFA 4YAQB 2K78A 1IGJA 3MYZA 4L8SC 1CLOH 4JFFA 5DT1H 1KNOB 2FNBA 2GTZA 2AMGA 1T1XB 3K1KC 1EEUA 2DW5A 1EHLL 3UYRL 1WV7T 3MCKA 1TQCC 2R51A 3OXSA 1TEYA 1U3NA 4PJ7A 4R26L 4DWHA 1ZLEA 4X4XA 4CC4A 2A6IA 1DO5A 4BEIA 4X9GA 1XMWA 3CDZB 1GIGH 1ZTXE 1JOFA 1F11B 2WOBA 3LEYL 2J8UF 2OMVB 2WMPA 3FN0L 2JELL 4NQXB 4OGAD 1F4YH 1MWAH 2WAHA 3C5ZD 3N50A 4X4KA 4Z7WA 4YDMA 4H5IA 4NPJA 1EUTA 2QJDA 2HT4D 2IWGA 1H8SA 3PE7A 1I3VA 3EO9L 5DA0B 3DO3A 3JB9L 3PYCA 4I88A 2MCMA 4DH2A 3S35X 3SQRA 4O5LL 4KO9A 4MJ2A 1GZPA 4FA6A 1R5IB 2OZ4L 4GG8A 4NKDB 2P8PB 3VXUA 2IVFC 2WJ5A 1FORH 1FVCA 4OD1L 1A1MB 2AEOA 5F96H 1WD9A 1X5AA 3WMPA 1A25A 2F19H 4Z7VF 2NNXA 4Q6IB 4F37K 4QHUA 2G3XA 3GREA 4J1UA 4NQUA 4ODTH 3FN3A 1E8WA 5FV2A 3VFNB 3IF1B 4M43H 4URTB 5IMKB 4PRNA 4K2UH 4I5BB 3ULVF 3CVDA 5KS9A 3KPLB 2JJVA 1Q9KA 5CSZA 3OKDA 3T6VA 2P4AB 3O45B 4MDIB 4XNMB 1UGNA 5DR5H 5K19A 5DK2B 1NCNA 4JFVA 2R0LL 5KSAB 4YR6B 5A2FA 1F4WL 3ALXA 2MOVA 3MLZL 3GBNH 2X1OA 4ODVH 4WU5B 3ZO9A 1OTUD 5AUMB 3Q2VA 5E8DH 1QUPA 2QTVA 3BKCL 2EINB 4RX4D 5GZNA 5FF6A 1E8MA 4QR7A 4XC3H 4PJGA 4ZD3L 2CUAA 4R6UA 5MEQB 1NM4A 2AV1B 4J82A 1UWXH 1DZBA 1FQ9C 5FDWA 1Z7JA 4IBVA 3GXPA 5EALA 1FSKC 2V6HA 1KC5H 3VXNA 1I3UA 3ULVL 5TQ0L 4HPOL 3SKNA 3ARBA 5B3JE 3JPXA 1OAZH 4P4KD 1BVNT 1MCWW 3ARGB 2APBA 3ROOB 2APVA 1Q4NX 4K55A 3CUPB 4NZRL 2Z7YA 5SWSB 4ATTA 1C5CL 3GXFA 2CKBB 4YIQA 1WH0A 4YSTA 1VEPA 5DRXA 4BK8A 2NR6D 4UAOB 4HH9B 1MJ8H 3IFOB 1E5CA 1U8LA 2EDJA 2OMUA 4AXWA 2GAZB 2F8OA 3MMEB 3V5KB 2FL5A 1BZ7A 1IQDB 4G8IA 2OSXA 3IWVA 3HJEA 3FB6A 4N20A 5D1ZC 4X60B 1URIA 1VFOA 1VPOL 4F15C 4LCCA 2YA0A 3BZ5A 1BCIA 5CJ5A 1QLEL 2JE8A 5ES4B 4ZODA 4HKXA 2ALAA 2X2IA 3BISA 4R90H 1DVZA 5A43C 5F9JB 5IB1B 4HMCA 3MVDK 2HFEA 2PCPB 4M7LT 3BKJL 3WIIH 3L1OL 4KKLD 1CE1L 5EBLA 3QZWB 2XA3A 1ICTA 4L4VE 5HDBE 2LABA 4B9GA 3JUZA 4P5KB 4F7MB 1NGXB 3DUUA 4MB5A 4JMXA 5DJDB 1CICD 4ODWA 1ZK5A 4ZUSA 3V6FB 4PJFB 2DV6A 1NBYA 3G04B 4XBMA 3V6OC 3VWKB 4KU1A 1IMHC 4OLYH 5DMIH 4MB1A 1GTNA 4OJAA 3OHXA 5T33L 1XIWB 2WXGA 4GIAA 4RAUA 2ODIA 2F53D 2YSTA 3FTXA 4LHQB 2ITFA 4FMKA 2BRRH 4LEOA 5C7XL 1VFAA 5IJKC 5IJ7E 3FF8A 2P9PC 3IJYB 4M8UA 1YEEL 1JNLL 1OGAD 4U1KB 2Q3ZA 4A7VA 3DOHA 5B1JA 4LHUB 1XH3A 3U46B 2EVHA 4A7SA 5FHAL 3UVKA 4FTVB 4FZ8H 6FABH 3QJRB 4LGPB 4G82A 4N4YB 2FQFA 5LWYH 4E54B 5J12B 3D52A 4JFZH 4KQ3L 2B1HL 5BRPA 2PR4H 4UM9A 5MERB 1BAFL 4YZWA 3WFHB 2ATKA 3B8SA 1EEZB 4KJYB 1IE4A 2ZAGA 2ZSWA 5MEND 1NSNL 2NY6B 3L4OD 4M5SA 4KBPA 3O4HA 2Y3NA 1QW9A 4WJKA 5HYNB 1QWNA 25C8L 5ABDE 4MCYA 4OLUL 1P7KB 2CN2A 3TO2B 5F9WB 4B5ZA 2A7BA 5B3NA 1N6QH 1UM5L 5M95B 2IGFH 3LRKA 4ZUVA 3JYBA 1PKQB 2GIXA 3WNLA 3RWDA 3O6MH 4L9LC 4O2EB 2G9HA 3QG7L 4XNQB 1W72L 2XTJC 2ZXQA 5I76A 4A7GF 1IGMH 3HMWL 4I0PA 4XXDB 5F1SA 4WV1C 4LB8A 2CO7B 4MDJA 4P49A 5LBSH 2JKLA 4PRHE 2ZJSH 4UT6A 1T80A 1A14L 4LOVA 5E2UL 1NEZB 4WFGD 3NA9L 4CSTA 3LOWA 1G6RL 2EE9A 4D94A 5LGHH 4OLZH 1MRDL 5I1KH 4POUB 2NY0C 1YEDA 5CINL 5IJ8E 2P26A 3CFIC 4PJ7F 2GK0A 1MF2L 2WNWA 3OLDA 4FTDA 3SB3A 2TSAA 3DC0A 1S7QB 4N0YH 1U3HD 2I3SA 5TEFA 4NUMA 4TQEL 1UKSA 4HIHA 3UTSA 1NCOA 5ACMA 4D6VA 3VW3L 3V0AC 1R3KB 3EOAB 4AQEA 2HFTA 1KJ2A 15C8L 3VDBA 5ICYB 2P8MA 5I6LA 1KF9B 1JPST 2C9XA 2VUYA 2R69H 4NERA 4Z7WF 4E9LA 2IH1A 2F7IA 3QEHB 2YIHA 4GIOA 4KI5C 5DLLA 4Z3JA 1OP5H 5BUGA 3I6KA 5GMKn 1D9KB 2WANA 4K23H 4CVZB 5JHLH 2FZ3A 4Q56A 3HR5A 2ZG2A 4HF5H 5DUBB 4YOKA 1DQLL 2DQGH 5DZ9A 5AYUH 4ZFFB 1ZTXH 3SJVB 2AK1L 2I32A 3WFEH 4HIJA 3F3HA 3TO4B 3ZUCA 2IPUK 2X44D 2E76C 4I3GA 4XCYB 3OLGA 2G4GA 4Q0XL 3ZQXA 3WE6A 1K4DB 2R1YB 4M1GH 2WB7A 1TXKA 3KR3H 4UV7L 4MS8D 1RJLA 1YEHH 3K91A 1E9PB 1FCGA 1KJ3H 3MHZA 5JW4N 4FAVD 4X7CC 5EBGA 2QKIA 1KENH 4KJQC 5SWZA 3N1QC 4YE4L 5B1CA 4TS6A 3HA0A 5AMSA 2HVBA 2J6EA 4ISVA 1O6SA 1SFDA 3OJVC 5F6HJ 4W9GC 3KDMB 5EC1A 3T2NH 5KS9F 1CYWA 4XB3A 2ORBL 5J5EA 1H3VA 3WAJA 1L9MA 3AGWA 3ZTDC 3F6JA 3K5RA 1KYUA 4FI7A 5CP3H 3PREA 1RERA 2ZQKA 1MH5B 3RRQA 1SF5A 4FNLH 4H7VA 5KVEE 5K9OB 3IEAA 1JRHI 5CLXA 3MUNA 4HC1H 2C9UA 4N28A 3CE1A 1NCBH 3BPOB 1BVLB 3D18A 5D7HA 3JVGA 5HVWA 3L5XL 2EIBA 4NI6A 1B9XA 2GUOB 3L4VA 2KI6A 2IADB 1QW8A 4NHUA 1JV2B 4RGOL 2X2YA 1Z1WA 4WENB 3OKWA 1VIWA 4HCIA 3INUH 4XWGH 4LZKA 2WVUA 1V3JA 3PWVB 3SDXF 3O4GA 1UKQA 4AQZA 3S97C 5HYJA 4PJGF 3BGFC 5ITFA 3AZUA 1X3DA 3D09A 3GT6A 3IE4A 3O8XC 5HGAA 2Y3AA 4WK0A 1JTTA 2B7DT 5AVWB 3T3MB 4AYID 1K4CA 1I3GH 3SY0B 4DJMA 5C08A 4FNSA 43C9A 2EIZB 2VC2H 4OZGE 2HU7A 2DMKA 3CHRA 4GRLC 1NDGB 1JMXA 1KB5A 3IDYC 4AEIL 4HWEL 5I19L 1MI5B 1ZHLA 4RE5A 1UZ6E 3D3VB 1B9KA 1YFQA 1AR2A 3VTMA 3MTRA 4ZOEA 4IRSD 1HILB 4FQQB 4AW7A 1AO7A 3KS0J 3PXSD 5I18H 1IE5A 3RI5K 4U6YA 4Z7OB 1O7DC 1XGQA 4J3SA 4FQ2L 4L8SB 5ALBL 3G08B 4BRVA 5L8KB 1OT1A 3ORVD 1BF5A 5HJDA 3JWDH 5E5RB 1O6GA 1H3TA 3O6FD 4OZHF 4P59H 3EG9A 2XTLA 2YKKA 4M56A 3SJLD 1TQCB 3RIFF 4YHIA 4OCSH 4TPRH 1QBLH 5TQ2H 5T1JA 4M6AA 1JSYA 4N2EA 4OM1H 2KHAA 1DVQA 4H8HA 4RMRA 1JF1B 1EHAA 3H1ZA 4DKDC 2ZNXA 1RZ7L 1CD9B 2GTQA 3SQOL 5DZPA 3T0AA 1Y6KR 4B9JA 1NBQA 5H4ZA 3FTSA 3O2DH 4G5ZH 4RGNC 3KMDA 3HG0A 2IAAC 4JB9H 3P11L 4I79A 5INCA 2Y6SC 2CCVA 4FMVA 5IW1A 1JD9A 2NSQA 1B4JL 3CFKA 3HC0A 4PY7A 2EILB 3KPRB 1T03L 4KKRA 2K6YA 5DZNA 1RIHH 2TRCB 4ETQB 5ANME 2AQ1A 1LD9A 3HB3D 4W4OC 2VSDA 3DX8B 4XMPL 1RSFA 2B16A 4LGRB 3F3GA 1AC0A 4KC3B 1CZ8H 1UH3A 4WHYH 5JIIA 4GJTB 1JPSH 1KXQA 4XNDA 3J7HA 4K7FB 3ZOAA 4RZCB 4ELMB 1DN2A 4OBRA 4ZUTB 4GRWF 3ULSA 4GXFA 4ZMZA 3EH4B 1WZMA 4G9FD 2Y5QA 5FWRA 4NO0B 1GJWA 4PRDB 3SE4C 3QJTB 5E1AB 2WIMA 1FFQA 2D4DA 3QR1A 4HJ1A 1HYSC 3H9SB 5DHVA 3WSQH 4JVUA 5KSBE 4X63B 5KUKA 1T7XA 3I6SA 4KY2A 2VITA 2DMBA 1PZ5A 3UZEA 3MVSA 1QWUA 2QR0B 3MUJA 1DE4A 2YNOA 4YDJA 2KZWA 4X50A 3HRZC 4U4BA 2P49B 3FUHA 3S34H 2P24B 2C8NA 5DXWA 3OAZK 3MYJA 3DPBB 4GBXD 1EDYA 3MXWH 3QUHA 3QI0A 3ULEC 3QIUA 3MTXA 4HIIA 2CK0H 5D7LB 1WZ1L 2F9BT 2Q8AL 3RWGB 4OFIA 4EXKA 1BQHA 4PP2B 2DQUL 4W4NA 4XVOA 2BMKA 3OZ9H 5I16A 1RZIB 2A9NH 4ZTEA 4PN6A 1KEGH 1LEKA 1M2VA 4YZFE 1Z6JT 4PGDB 3L3HB 5GGSB 1YY9C 4I8DA 1HSBA 1FSKB 3ESNA 4LSPH 4AJ0A 1AGBB 4FQ1L 3ZL4L 3EJTA 3UABA 3QFJE 3L3IB 5T1DH 1UZ8B 1LL1A 2HN7A 3PP4H 4X7SH 2AGJH 4NZ8A 3TT3L 3I84A 1HOEA 1IKFH 1IQWH 1MFDL 3QHYB 3QO1A 2AXHA 1FP5A 4FQJL 4H1LH 4MJ5A 2MHAB 2A2QT 3I74A 1R3JA 2Q3AA 3OMNB 3TBTB 2G3NA 3SDYH 3EUDA 3L9RB 4JRFA 5FOBB 2OK4A 4JN2B 4NT6B 5D1ZB 1FLRH 1YYLH 2R1XB 5T3XH 1OCWH 3AU0A 4F15B 4DP1X 5F7HA 5I6OA 4E0RB 4LCWA 5CGBA 5EO0A 2WLIA 5J13C 4G8GD 1OCOB 3CZNA 3MA9L 3RVUC 3FO0H 1LLAA 1MLCA 2CUHA 4J0XA 2J73A 2F8IA 2WZ0A 4UILL 2EDKA 5D1ZI 4MRBA 4XAWL 3VFPB 2YMOA 1E3XA 4UT6L 4P0DA 1XH1A 3CLWA 3Q2NA 2K8MA 4OD3L 4CSZA 1R3LB 2N0MA 3L8QA 2WY3B 4LKXA 1YN6A 3GRGA 3II3A 1MIEL 5F88B 3OZLA 4JFED 5J06A 4NM4L 4HG4J 1BLNB 3OKTA 1WT5A 1A4BA 4F20A 2M26A 2OTWA 2E7LC 5E99L 5J1AB 3ATBA 5IEHB 5JXEC 4W93A 2Y25A 2OYKA 3MRLB 2FWOA 2HXAA 3UO8B 2F1AA 1HHHB 3SYPA 5CP7A 4C56E 2P5EB 3KVPA 5FK9B 3KGRA 1DBAH 1KJ2L 3SZ6A 4X98A 3IPEA 4ALAC 4B9ZA 4JHUA 2P44B 4Z7UE 3U2SB 3VH8B 4GYBA 4J79A 3NIFA 5KBKA 3QJZA 2EKSA 2RQ8A 2AXFB 5E6ZA 5F7EH 2W0FA 1HTYA 3L7FB 1ANUA 3GSNH 3IAQA 5AOLA 5EU3A 4WVRA 3GLAA 4WEEA 4EIGB 3WUWA 3GJEB 4LOFA 3ZE0E 3ZZ1A 1RUPH 4PJXB 2HU5A 5KWYC 2AVGA 3V4UL 5I71C 2X4NB 4XPBH 3WHE1 4E41D 4OUUB 2ITDB 4QRAA 4EOWL 4JKMA 1XB3A 2KH2B 5TFSH 2A6JB 2FQEA 2J6EL 2ZE0A 1BD2B 1CLZH 4YDZA 2ADJB 3IJ9A 5AB9A 4ETYA 2X4SA 2G2PA 3AXLB 4XCCH 5CLZA 4EI5D 1SQJA 2XBTA 4A2FA 1JF6A 4AQAB 5I1LB 5KBNC 1IBYA 1PY0A 1SY6H 3WL9A 1BIHA 4OI7A 1TFHA 5IG7A 4GB9A 4N0FB 4L9LB 3QHFH 3HE6C 1HXYA 4TNEA 1Z9MA 1WO2A 4MAYA 2EDHA 2XTJB 5C71A 1T6WA 2VDNB 5GSRB 4WV1B 2Z9TA 3SYCA 5I24A 3ZDXA 1ZAGA 1DDHB 4JBSA 4U6VH 1JGVH 3F6LA 3UPRA 4K8RC 2Z64C 5DJ2B 3S37H 3EF7A 3WO4C 2WTPA 3APCA 4N90E 3ZE1E 4V1DA 1KPUA 1FNEB 3WS6C 1XVSA 3NK3A 1MFUA 4PJBB 2WAQA 3W37A 1IT9L 2PTTA 3DETD 4J23A 3FRXA 5CXCB 3KWXA 5I1DA 2NY0B 4S0HA 4BM7A 3RWHA 4WI2A 3HKZA 4AW4A 2HLAA 2Y72A 1XTMA 1S9YA 3O41A 1MCNA 3POCA 4LVNB 3ZLQC 4X6EB 3MKKA 5M94B 1YNTA 5CS7A 1T66D 4O4YH 3OKEB 5CZXD 4JG0H 5BS0E 3Q48A 2KL6A 3EI4A 4P2QA 1MSPA 3QRGH 1Z3GL 1SUJA 1FCCA 2VR8A 1KB5L 4MFHA 2PM7B 5DRWA 3E1ZA 3WV0A 5I8OH 4HWBH 2AK4A 1L7TH 2D3NA 4X6FB 5B21A 3BUQA 3IFLH 2YB8B 1T20A 3FKUS 3NJGA 4Y2DD 5ID1A 4BFBD 2FWSA 3PQYE 4X8CA 3P4FA 1ZDSA 3EGXB 3S4SG 4LCUA 2Y7OA 2KS0A 3S3PA 3QIWB 2NY3D 3MV11 4BH7B 1J87A 3VYPA 3WLBB 4X4YA 4J0WA 4NZTL 5CZKA 2LAAA 2XA8L 4AOFA 1AG0A 4MD4A 5FGCE 3A6CL 2AQPA 3NFSL 4HLJA 1RLBA 3LEVL 4MJIE 3NEEA 1MHPL 1XF5A 3ESUF 3W56A 5HI4D 1V5JA 1NC2B 2RB8A 3DTXB 1JV5B 1IM9A 1SBSL 4O02A 5CD3A 4R4NC 1BFOA 4JSPC 4DPRA 3MSPA 1MCDA 4I87A 2COQA 3ZTJH 2BVOA 1UD8A 1U92A 2CCWA 2VISA 5JYMA 1SLUA 1G9ML 2Y5TA 1VZHA 1KY7A 3HBGA 5DC4B 3VXRB 3HG1B 4CU8A 5AOIA 4NQDD 4IK7A 3GHEL 2X6CA 1RFDH 2BP5M 2YHGA 3W82A 2PXYD 3C60C 3RDTC 4WJG3 1INEH 1KDIA 2RJMA 3MROB 1QI5A 2QQLL 2GCYA 5FGBC 5HVGB 4JUTA 5AVUB 1Z0NA 3VD0A 4OKVA 1WE5A 1MCBA 3OJDB 4BK5C 3SSGA 1I7RA 1FFNA 3D9AL 3TNNB 4YXLH 1FBIL 2IG2H 4QXUH 3BGFB 2Q86A 4WGKA 1ZHKB 1VHPA 1RLWA 4P3DA 3X11A 3CHXA 1M3JA 2R9HC 1CFQA 2HJKA 3B2DC 2VO5A 2OMXA 4MWFB 5DFWH 3L7EB 3LKSB 2R23A 4PD4J 3PY9A 4QHLA 4QGYA 4PREB 3IDYB 4CKVX 5LQBL 1I1CA 3JWOC 3P9LA 4N2OA 3SPVB 3V6ZA 1O6TA 4L3EE 4LPVA 5IFAH 1C9SA 4ZYKA 3I6GA 2J2ZA 3KJ6L 5KSVB 3RL1B 1WITA 1NIEA 5FCSH 3QUMH 5BRQA 3ZTNH 3MBEA 4ZW3A 1E43A 1JK9B 2V5RA 3FS9A 3MV8E 1YEKL 2O6CA 1Q9OA 1AS7A 3CCHB 2CLRA 1RZ8B 3TPKA 1LDSA 1EHNA 1K6QH 1WZLA 3NDYE 5DRZB 5C0BA 4KVCL 5IBTH 4J4PA 2JV6A 5JMOC 3IMUA 1VADB 2DY2A 3ILQD 3MLSL 3FO2B 3TIEB 5ABZA 2XFXB 4K9JA 5FW7A 5M5TA 3Q1EA 1KEMH 4RFNC 4WO4D 1UACL 4TUUA 4V33A 5AFU3 3PV6B 5F0MB 2X5PA 3UCQA 1K2DA 4P2OC 2ENJA 3NP3A 3DYMA 2BVYA 4DK6A 2ZOOA 4RGNB 1AGDB 4X4MA 1JWMB 5K9JL 1B88A 4NRXA 3NJXA 4FFWD 3WY3A 3LRHA 3S98A 3FH8A 1NFIA 1EPFA 1AKJB 4BUQA 3OKMB 3BRDA 1MRFL 4JR9H 4O51A 3L4YA 3QNXB 2UZIL 3GMQB 4KK5C 3ZT7A 3DBXA 1ZHBB 2NLJB 2YUZA 3GBEA 1CLCA 2LHAA 2MTAH 2AS5M 4WK2B 1DQDL 35C8L 4Z78B 2NYYD 2DIEA 3ZXAC 3EQ7A 2XFGB 2WGNB 1JPGA 1NCAL 2Q3XA 4WU7B 3HVNA 1ZANH 2E47A 3NP4A 3FK3A 12E8L 5CIPA 5CUSH 5HHOA 4C83A 3NIFF 1RV6X 4MMXB 3VMPA 4Q52A 3PG2A 1GS7A 5E5UB 3EHBD 4H4NA 2HKFH 5CHNB 4BFRA 1I9JL 1QBML 1FHNA 2DJSA 3HRZB 2WTRA 4B0MM 3U79A 4L1SA 5BZWA 2GHZA 3O3DA 5DQJB 3AS3A 4U6HB 3UDWC 1IU1A 3L3DA 4M4RB 4DQOL 4UNVA 3L2MA 3C9NB 1WTGT 3KPOB 5DFTA 5CEYB 1TZIB 4D9QD 2DTML 3B2MA 1HWWA 3QG6A 1NL0H 4QRPA 1EAOA 3BGMB 5EN3A 2BSCA 2FATH 2QLYA 3LS5H 5BPPA 5GZOC 4WTXA 3QNFA 2ZXDA 3KXFD 1ETA1 1FE8L 5D6CA 4HT1L 3UJTH 3WFCH 5ACZA 4JM2A 1K8IB 3DV4A 2UUDK 2O6EA 2YPLA 2CRZA 3KH4A 5HYIA 1OSZA 2XPYA 1TNMA 3QHZL 4X6BB 4WI0A 5F8QC 3C5JA 1E6OL 3ZDXF 1WIPA 3MA7A 3UG5A 4K5LA 4BWWA 2J72A 1MFEL 1XGUA 1MXDA 1T21B 2H1PL 3H4FA 3N1FC 2HRPH 4PB9L 3KWWA 4O2FA 2Z8VC 5FGSA 1VA9A 5D1XA 1GMIA 4FQIL 4XPAH 1LK3L 3ISRA 4YO0A 2CSPA 1MN4A 1B0GB 2VQ1B 2WO3B 5H94B 3SPCA 5TE4H 3V55A 2AJSH 4XZ4A 3VGGA 3L9EA 2TSBA 4JSNC 2WQWA 4FCHA 3Q2WA 1WFTA 4Q7DA 1FZOA 5IBUB 1BPVA 1AP2A 2ICWA 4JM4H 4JPKL 1YNTF 4OZ4A 1BZ9A 3IJSA 1YHPA 1QZ1A 2VSMB 2FH6A 4FG0A 2CDGB 4IIQA 1I7ZA 4YLQT 5I1IH 1CFTB 1U30A 4WLCA 5K9QG 4M8RA 3D87B 3RZCC 5J13B 4U1EI 5B7EA 3FB7A 3J8F7 1MAKA 4HG4K 1K3ZA 1W0WA 2ZWKA 4WGVB 2HLFC 1M9SA 2DKUA 3LV3A 4B0MB 4J27A 5CFAA 4GQPH 1B4LA 4O3TB 3L1GA 3G6JE 2IQ9L 3WXWH 4BGDA 2UWEB 1H15A 3GO1L 2R29A 3K7UA 5AW1B 4L1MA 1GY2A 1WVZA 2FBJL 2P5PA 4OFKA 3HC3H 3K5SA 4IBZA 1JCVA 4G9DB 1INDH 4PLJC 1X9QA 4UINL 4QUOA 5L2JA 2WN2A 3NSDA 4G1MB 4H26A 4JG1L 4NQSA 3C5XA 2VXUL 3APMA 4AV5A 1NLBH 4F7TB 1V7NH 2D0FA 3BO8B 3ARWA 3T8XA 1AIFA 4L37B 4AE1A 3IU3B 3CU1A 5FX3A 1CURA 5INDB 4PHXA 3P2DA 3FUIA 3FCTA 3MLYL 5MP6H 4BV1A 3CVHB 3IETB 4PJ8C 5GHWL 2VLJE 3HZYA 3H55A 3PE9A 5LG1A 3CC5A 5FFOA 3ZDZB 1P4UA 3AT9A 3L4MD 4YBLC 3RWIA 4L1DA 4AX3A 3W3BA 3TVMA 1RZJL 4XP5L 4WUKL 1U9KA 1HEZA 1W6LA 4Y19E 4YEFA 1CLYH 1LO5A 5AVXB 4J6IA 1J1XH 3I7KA 2XQYK 1KV7A 1ZCRA 3QPXL 2FJSA 2DLFH 1NEPA 2PW1A 5K1VA 2P42B 1YSOA 5I71B 4QWWC 2P9UC 4POZD 3O3UN 2ZX8A 1HOCA 1OAKH 3LYRA 2QVKA 3SE9L 3S88H 3LRSA 4IQHA 3FU7B 4ZS6C 5I8CA 1WYJA 1J12A 1T89A 4PJ5A 2VXSH 4O02L 4YNYB 2BOCB 2PM9B 5LB1A 3WDJA 3W38A 3REVB 2W60A 4ODBD 1WHOA 1DBMH 1X5ZA 3MBXL 3PVUB 2X9XA 4ZW5A 1VCBC 4G5AA 5T3ZH 4KK9D 5HTSA 4EN3D 1A7NL 3FCGA 1GGYA 5F3FA 3WFBH 1FFTB 1AFVL 1QSED 3HE6B 2Q7YA 1GYUA 3I02A 3BPCB 3OHMB 3BSHA 1SYSA 2WLYA 5A7BA 1E4XI 5E6RB 1OP5K 1GOGA 1GZHA 4FQXB 2QVIA 4LBEA 2I7SA 1UG9A 3SE8H 4P5TC 2V4LA 1X9UA 2YMXL 3F6IA 4XVUC 1E9QA 4FAND 1N4XH 2JQZA 3WO4B 4JY6A 4ZQTA 5H37G 1T7YA 3HBZA 1S9WA 3E3QC 4X7TB 5EU5A 4HJSA 3QNYB 2EO7A 1G1CA 1PFCA 4KRPD 3QH3A 1S7WA 4UTAH 2GQHA 5KSUA 3VA6A 4DHLA 3CMOL 5BQ7B 2VZOA 3FB5A 1L9SA 1YEFH 1ZLUH 2G60H 4YAQA 2IOIA 4HUCA 1N6UA 3BAJA 5FAAA 5HQGA 4ZX6A 4BFKA 2OI9B 2DQ6A 1T1XA 3QDGE 4PLKC 3SCMD 3PNRB 1AR1B 2ROYA 3BQUB 4K7PL 3FQUB 4PP1D 2FGWL 2Y1VA 1KTBA 2IWKA 4U31A 1OSPH 2WV3A 3C6SB 1LM8V 5F7WC 2YQ3A 1ZSDA 1WIOA 3K2IA 2VDQA 4AQ1C 1RZQA 3FPYA 5E2JA 2YC1A 5E6UB 3I7OA 5E6IC 1TNNA 2J8UE 1T04B 2WINB 5BV7L 5EOCH 1YMMA 2BWIA 2Y7NA 3GMRB 1ONQB 1VE7A 1N70A 2Y5EA 3HHSB 1PMYA 1UWGL 3DJ9A 2TRYA 4X7FC 2I24N 5AZEL 4L4VD 3PWPB 3SGKA 4ZZKA 1U93A 3MRBA 3O3EB 5DHMC 5GRVL 3ULUF 4IEFA 2DWSA 2NY2C 3EGDB 4NKDA 4NJAL 5AFAA 4GMSL 5I6MA 2O61A 1A1MA 3X13B 1TTUA 2O4EA 3S4SB 5D1QA 4Z7VE 4D2NA 3Q2LA 2YXVA 4P8QA 3OR7A 5ERWB 2GY5A 2EYRB 3H6AA 1JZ7A 5EU6E 1MLBB 1PZUB 1NGYA 3A4EA 4I5BA 1N7ML 3ULVE 1S8DB 4B96A 3QEUB 1BJ1J 1JZHA 3KPLA 4XI5C 3WLWC 3C60B 3RDTB 1DHKA 2CJSA 3LHPL 2DQTH 3DV6A 5E00B 3S36H 5IWLA 4QRTB 4F91B 4AITA 4XNMA 3RN1D 2BHYA 3BVUA 4QF1B 1SDDB 4HOWA 1Y6MR 4PD4K 1BFVH 5C0CB 2X0VA 1WA2X 4WEUD 3BG1A 3KLSA 5DLMH 5AAWC 2VDOH 1IKNC 3DIFB 2EEFA 3G5XA 4JM2F 2M1KA 3RIFK 1QYGH 2E59A 3ULUL 2BJMH 2FB4H 1HEHC 2BSEA 2HSIA 3OB0K 1P5UA 1AI1H 4MAUH 4J6RH 2DKSA 4K7PY 4Y16A 4AG4H 3BAEH 4NO2B 3MOBL 3FQ4A 4QRQB 2GUYA 3FQRB 1A1NB 5MEQA 3EJZC 3ZKNC 4C4KT 1KIPB 3U7WH 1TVBB 3FQNA 2WO2B 2Q6WA 4W70A 1U8HB 3AWGA 4JSVC 4ZI8A 3JAMg 3FTGB 5IY5B 3N1GC 3CHPA 4UWQB 1PD0A 3I8EA 3BZEB 3C5ZA 3H7LA 4H20L 4X3EA 3K74B 5FIEA 2FCBA 4TUJB 3ME0B 3VFVB 3HTLX 4HUXA 1BMGA 5F89B 4ANVA 5DFVD 1S5IL 4JJHA 4PCSA 3BCFA 4PRHD 5K59F 4L5FH 1J5OH 3MLUL 1QR1B 1QRNA 2LW3A 2MOGA 2RFXB 4HJJH 3QQ3B 2XBZA 2YXMA 2XY1A 2FWLB 2GAZA 4RFNB 1TJMA 3O4LB 4MA8L 3FFCB 2GY7B 3I7NA 3PRZA 4P2OB 1IQDA 1KT2B 3NIGA 4GGCA 4QAMA 4GW4B 2J1ZA 4JY4B 4MXQC 3QXAB 4HEPA 2EDLA 3DX4A 3Q1SH 4I1NB 2NY1D 4X6CA 1G1KA 1MAML 5BQDA 4EI0A 3CHOA 2AI0L 2IPUG 4ZO9A 4LAJH 5DJCA 2CE9A 3C99A 3GB7B 3IUQA 3AG3B 5TF2A 4W9HC 2H26B 4F9PA 2O5NA 5JOFB 1JXDA 1KTCA 2Y7QB 1NMAL 4G80A 1F1DA 4BKLB 2L7QA 3V9EA 1KGCD 2AHIA 3LKRA 4KTDL 2ADFH 1FGNH 3Q3GB 5HI5C 5KOMC 2GC7C 4HSQA 4KRMB 4P5KA 1X5MA 4JRXE 1NGXA 4RFOL 4F7MA 5DJDA 5ETUA 3MJ6A 2X1QA 3DXMC 1AZBA 2ADGA 3H3PL 4BH8B 4L8DA 4PY8I 3VM5A 3G5VB 5M7QA 1XCTB 2KDYA 3TL5A 5H17A 3DOSA 1KIRA 3O6LH 4JZJC 2B2XH 3JZHA 2E0PA 1CD1A 1R0AL 4CUCA 1M7IA 3OLEA 3TWCH 4BE6A 4Q9RL 2WQXA 3GJFA 1QFSA 4OCXH 1UB5B 1G5AA 2H14A 1U8OB 3VRIA 4MNQD 1SJEA 3EYFB 5E2TH 4MQ7B 3IJYA 5DK0B 4ZZFA 1WWAX 1WSST 4WWKA 3MMYA 1IZJA 3LNHA 2BERA 3RWCB 3U46A 2R29L 3TJEH 5I1GL 2JJSC 4XP9H 4C58B 1LYQA 2QXVA 4YL4A 5C0FA 1AOHA 3UZVA 2MNUA 2YK1H 4CA4A 2WGXA 1S9XA 5C0IB 3BMVA 3E9TA 5E03A 3LEXA 2HMID 3ESOA 4E42B 3GIZL 5MERA 3WFHA 1EEZA 4ICWA 3VMOA 3L5JA 2AJVH 3BH8A 1J0KA 5E6SB 4ZW7A 3RGBA 2FK9A 5PCYA 2DWTA 4LOUC 2H32H 3H0TA 1VB9A 3VNYA 3L3OC 2FECL 2GT9B 4PH8A 2FX7L 5E0QA 2ATPB 4YHKH 3C75A 3S5ZA 1QFUH 3V8OA 2O5ZL 4F7EB 2D9CA 1NMBL 2ZTBA 4HJGA 3X3FL 3BFQG 4TOYL 3GSWA 3UYRH 1KLUB 1G7QB 3LN4B 2P9SC 4O58L 2QT6A 4R26H 4R4BB 3R1GH 2V5YA 1LILA 4XXDA 3L5HA 2PMZA 4BD4A 1ZGLA 1ZE3H 2BNRA 2CO7A 3ZE2B 4J73A 3B1TA 2Z0BA 2VDKB 1V7MH 1I1AC 3RTQD 1FVDB 1OF2B 2LU7A 4JFFE 2PWGA 1E7UA 3UFIA 4QQEA 4S1QL 1FN4A 3CLFL 4PJ7E 4Q2ZB 1IIIA 1LO3L 3RZCB 1PIGA 3H53A 3EO9H 1S7QA 2IANA 5HYEA 3TJHD 1RUQL 2ZOLA 3CIKB 2FJHB 4O5LH 3EOAA 4JE4B 2Y07L 4JPWL 2BP3A 5TH2B 4CGTA 1U6AH 4XZUB 5ICYA 2P7TB 5D7IA 4FJYA 3N91A 1O6VA 2YKLL 3LKOA 3SKJL 4Z7WE 3U6XS 1R4XA 4M6OL 2ZXEB 5CZRA 4ZG1A 3S2AA 1HVXA 3MJWA 1D9KA 4CVZA 2VZ1A 1JPEA 3BVXA 4AMKL 3BI9X 4GGDA 1QTYT 1INQA 3GM0A 2L0DA 1TCRA 1Y6NR 3PWLA 5DUBA 4ABUA 1KMGA 2OQJA 3MQIA 1UOVA 2DMGA 3TO4A 3IDJB 3EFFB 3UH8A 2JH2A 3ZKMD 2XKNA 4HPHA 5L4JA 2QHRH 5TDOB 3VXUE 4KY1L 1CU4L 1E9PA 1MZYA 3HFML 4XWOC 4RAVA 2HT2D 1AACA 1E28A 4NAAA 3MACH 3TA3D 4PJ8B 3STBA 4EDWH 4XN7A 4J3OF 5D72L 1G0DA 1OK8A 3BC9A 2VDQL 3KDMA 4I3SH 2Q2EB 3K71A 4YBLB 1KOAA 2PUQT 4N2FA 5KS9E 4NJ9H 1XF3B 2OCJA 5DO2C 2IDFA 4U3HA 3BN9D 1MH5A 3BKCH 3PAZA 1NAMB 3P3YA 2QZQA 4LSSH 5JW5A 3L6FA 1PLBA 4JJ5A 4ZD3H 3P0VL 3IFPB 3GD1C 2AERT 2R2HB 1RIUH 2O6FA 4HJ0D 4P9MH 1YEJL 1CVRA 5E8OA 2GUOA 1CE6B 4BA0A 4ZUUA 4U1LB 3BZ4A 3ULVH 4A7JA 5D7KE 2AFNA 2PR9A 4AIZB 2VN4A 4FJZA 2BIMA 1KY6A 3GSXB 5C86A 3MODL 1Z3RA 1GY1A 2V8LA 3AS2A 3SDXE 4DUWA 3APNA 4LEXH 2X4UB 5A6LA 2WXOA 4PJGE 4PIBA 5IK3A 4JKNA 4XOCA 5IMLA 4FB1D 3T3MA 2WQSA 1FG2A 4GAGH 2UZXB 1W8EA 4XC1L 4KX7A 3V95A 4EUPG 1G9NC 2I0RA 2XV3A 3OKKB 3V4PA 4P5TB 1DCLA 5JWZA 5IOKA 3EBHA 1MAJA 1IGIH 1QOKA 5JQHC 1PIFA 2J21A 5KVDH 3ZL2A 1SRDA 1HILA 5GIRB 4QLRA 3B9EA 1TYEB 1U95B 3AAZB 3QFJD 2P9KC 3PABB 5A2LH 4JHZA 3AUVA 3HAEH 4OJCA 5AVQB 4M48L 2GC4C 1I4FB 2UYLB 3CFJA 1C8QA 3G08A 1ZY9A 1LO4H 1DR9A 1CE1H 2GHWB 1XCQB 1CL7I 3SFZA 4WEBH 3NIGF 2Z2PA 2HRHA 2OZNA 1QKZL 2Z31D 2CE8A 2QQNL 2YAMA 4B41A 3U0PB 3NZUA 2QGEA 1AOZA 3UJJL 1IKOP 4X6CF 5FUCE 2LU3A 4N6QA 1DJXA 1YQVH 2X6VA 1IX2A 4LIQL 3DUSA 4AQ1B 3RNKB 4U1HB 1EFXD 3R06A 5E6IB 4MMYA 4A7UA 1WBXA 5CBAA 1O0VA 2V7NA 3EJJX 3TLRA 4G7VL 1RJCA 5C7ZA 3F62A 3F83A 5C7XH 3F12A 4Z3IA 4QRJA 2WP3T 2A6DB 3N44B 4Y9FA 3BCDA 1PG7L 3FCUA 2J88L 3IKCA 4ETQA 2HYEA 2EC8A 4L1TA 3AROA 3R0NA 4YHML 4FZEH 1AG6A 4ZTPL 1MUJB 3SIKA 3DX8A 5FHAH 2GBUA 4YGAB 4CVUA 2K3TA 3V9CA 3EW3B 2NY2B 3ZK0A 2IV9A 4HUWB 4RZCA 4PLNC 2I0SA 4J84A 4ZUTA 1IL1B 4GRWE 4GG6B 4HKBB 2VRQA 2CA4A 2B1HH 5E2VH 5GSVB 1IEAA 3QCVH 2D2OA 5C3LD 1H0DB 1IIKA 1AS6A 2UZYA 3K3QA 1EK3A 3O4OC 1RZFL 1NSNH 2K0RA 5EZIL 4PB0H 3H9SA 4C56D 2EIEA 2NNAB 3M07A 2HTKC 4IBLT 25C8H 4H25B 4OLUH 1SXNA 4YXHL 4IRSA 1JPFB 3UO1L 3SMRA 4LSUH 1HWGB 5D6DC 2EXTA 3LJ3A 3KZ8A 2VZTA 4NKOB 5KYUB 2AEWA 4ZPVA 1IAOB 2VM3A 4KKCD 2F7OA 3WTYA 2XU7A 2K8QA 4I3RL 3WOVA 1C9LA 3QG7H 1W72H 4ATWA 43CAB 3FRUA 4ZOBA 4MA7L 2R2EA 3QYNA 3BVNB 4PP2A 5CO1A 4NQCB 1RZIA 1A14H 1F6AB 3P4OB 1G6RH 3AQDA 1MCQA 4ENZA 2OXHA 1C5DB 5EARA 1F0LA 4R83A 4XNYL 3L3HA 2OR8A 3V5DA 3W9EB 4NSKA 4N8CL 1H8LA 4FHKA 3SBPA 4LSDA 4WI4A 5DD6A 1MF2H 3P54A 4A09B 4PG2A 5ABAA 5C07A 3D2UD 3MJ7A 1MIMH 4ZN4A 3L3IA 1PJWA 4TQEH 3KBPA 4DGIH 2CJUL 3VW3H 4MD0A 5I8EA 2IGLA 4FULA 3T2PA 3VI4B 2H2SD 4XMLH 4IGBD 1PZCA 3TH4T 5BO0D 2BY2A 2FJGB 1TVHB 5GS0D 2VDRB 2LLGA 4N90D 1QASA 3F7LA 2W65A 4NPKA 1KCLA 1OD7A 5FOBA 4JN2A 1U21A 3DMMD 3L13A 5D1ZA 4CZYA 2R1XA 1DQLH 1CICB 4KHTH 3UTSE 4ANUA 2AABL 4G9FA 5IESL 1P4IL 1UT9A 2HPOA 4RMQA 2C1OB 5ALCL 3CFDB 1DBJL 5DJ0B 3BEVA 4M8QA 4YFLF 4Y5YA 2WBJC 5D7IF 4Y5VA 2I9LB 1E27A 5IVOA 4OI8A 3H3BC 3PHQA 5TDNA 1Q94B 3IDUA 4LLUA 1EERB 2AEPH 4M6NL 3FT2B 1IFGA 4YE4H 4HSAC 3FONB 5CLTA 1UWYA 5KG9B 3IUNA 1FNHA 1JYWA 2IBZY 1H6TA 3NQIA 4LE8A 3C6LC 3G5YA 3IXTB 4H40A 1OGAB 1MHCB 3PQYD 1R3LA 2ORBH 2RALA 3KWVA 5EMYA 3GMMB 3V6OA 1M57B 2V5MA 2DN7A 2LU4A 3UTZB 4P2RB 4FWWA 4LDLB 3LKPA 1RIVH 3QCTH 4I4WA 4NP4L 4JZJB 4YDVB 4AV0A 1BBJB 5SWZE 1JRHH 2GIMA 2GJRA 2HVKB 3MRLA 1ED3A 4U05A 4F2MA 5J0BA 1W0YT