3SBRA

Pseudomonas stutzeri nitrous oxide reductase, p1 crystal form with substrate
Total Genus 174
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
174
sequence length
581
structure length
581
Chain Sequence
QKIHVGPGELDDYYGFWSGGHQGEVRVLGVPSMRELMRIPVFNVDSATGWGLTNESRHIMGDSAKFLNGDCHHPHISMTDGKYDGKYLFINDKANSRVARIRLDIMKCDKMITVPNVQAIHGLRLQKVPHTKYVFANAEFIIPHPNDGKVFDLQDENSYTMYNAIDAETMEMAFQVIVDGNLDNTDADYTGRFAAATCYNSEKAFDLGGMMRNERDWVVVFDIHAVEAAVKAGDFITLGDSKTPVLDGRKKDGKDSKFTRYVPVPKNPHGCNTSSDGKYFIAAGKLSPTCSMIAIDKLPDLFAGKLADPRDVIVGEPELGLGPLHTTFDGRGNAYTTLFIDSQVVKWNMEEAVRAYKGEKVNYIKQKLDVHYQPGHLHASLCETNEADGKWLVALSKFSKDRFLPVGPLHPENDQLIDISGDEMKLVHDGPTFAEPHDCIMARRDQIKTKKIWDRNDPFFAPTVEMAKKDGINLDTDNKVIRDGNKVRVYMTSMAPAFGVQEFTVKQGDEVTVTITNIDQIEDVSHGFVVVNHGVSMEISPQQTSSITFVADKPGLHWYYCSWFCHALHMEMVGRMMVEPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title N2O binding at a [4Cu:2S] copper-sulphur cluster in nitrous oxide reductase.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Nitrous-oxide reductase
total genus 174
structure length 581
sequence length 581
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.7.2.4: Nitrous-oxide reductase.
pdb deposition date 2011-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
A PF18764 nos_propeller Nitrous oxide reductase propeller repeat
A PF18793 nos_propeller_2 Nitrous oxide reductase propeller repeat 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3sbrA02
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3sbrA01
4EF3A 1AIZA 1NWOA 2B3IA 4YSQA 3SWSD 4AKQA 2OJYA 1BQRA 3FQ2A 3AY2A 1BYOA 4GP5B 2H5UA 4DP9X 4DP4X 1CURA 4J0XA 4QRJA 3IE9A 2BW4A 5A2Qg 5AMSA 1JMXB 1AS6A 5LDUA 3SFZA 2YAFA 5FXYA 2Q9OA 1IUZA 2FQFA 3TBCA 4YSTA 3BWSA 3F3PA 3I8CA 2H6QA 9PCYA 3I7NA 3ODTA 5FQDA 4A2HA 1AZBA 5I5IA 3RLMD 3UKUC 2GC4C 1OCRB 3TU6A 4J79A 1AG6A 2DWSA 3N2JA 4FAVD 4Q8BA 1SHWA 5SXMA 4ESGA 2YAMA 4HCFA 2B08A 3EI2A 2J57A 1NIDA 3NP3A 3GDCA 4DP6X 1JOIA 4GZ8A 2PCYA 4FB1D 5HE0B 4A66A 2HKRA 1K32A 2EIKB 2J56H 4J73A 1EHKB 2XWZA 3TASA 3OL2A 5IJ7E 1PLAA 5E9NA 2RACA 4YSEA 5CXBB 2P80A 1A0RB 1YLBB 1M57B 1ET7A 4M3HA 1OCCB 1GG2B 3EWEA 4JSNC 4L1QD 5EMKB 3RMZD 1NPJA 2IWFA 3SXTD 2XLLA 4J81A 4O3UB 2XX1A 1AG0A 2DYSB 2PPEA 3NSDA 1V54B 2BWDA 4JKNA 2J56A 1AACA 3EI1A 5EM2A 4H5JA 1SF3A 1WS8A 1PBYB 5A7EA 1BQKA 1XB6A 3WG7B 3C5MA 3I7HA 2OVQB 4O1QD 2PLTA 1PF3A 2Y69B 4QKTA 2BP0A 3ABGA 1TBGA 2TSAA 3EMHA 2VSKB 2FWLB 2B5LA 2MTAH 2DV6A 2H9PA 3EI3A 3CZUB 3MMYA 3I7LA 1OOWA 5AZUA 2IUVA 1TEGA 4A2MA 3N0EA 4E5ZA 5AKRA 3AL8B 4P5RA 4X61B 1DYZA 4PXWA 4GGAA 1NWPA 3DKHA 4DPAX 2YXWA 3OMAB 2B4EA 4DP7X 5CXCA 1E5YA 3CIKB 3NJFA 3QJTB 2VSMB 1M9WA 2IAAC 4YVNA 1N6EA 1WA2X 3RRMC 3V9FA 1NEXB 2AZAA 4E9YA 1CUOA 2CCWA 3GYRA 3X1NA 2PM7B 3MZLA 2AFNA 3PVWB 7PCYA 3PXSD 4PBZA 1J9TA 1GYCA 4YVDA 2UXFA 1MDAA 2LLNA 4D6VA 3WKQA 1BXAA 2HKMA 2FNWA 3G5WA 1GW0A 5I6OA 3BG1A 1AOZA 3WKPA 3GFCA 3X1FA 3DTUB 4YSPA 3WIAA 1SHXA 2TRCB 3PSCB 2PPCA 4GQBB 2DWTA 2HLEB 3S8GB 3FGBA 2P9PC 1QLEB 3FPXA 3P4FA 3SHFA 1CYXA 5B7MA 2H3XC 5I5JA 3PCYA 1URIA 2TSBA 5IY5B 5EM2B 4CZYA 2CAKA 1NPNA 1XB3A 1SNRA 2W88A 1L9PA 3NJIA 3C75A 3X1GA 4FAND 1N6FA 2BCJB 1GP2B 1KCWA 4AEZA 2MRYA 4Q89A 1RCYA 5PAZA 4PSXB 4DPBX 4Y5RD 3RFHA 3UVNA 3EU7A 3DSMA 4DPCX 3ABKB 2HZHA 2AGZA 1N68A 3FU7A 1XB8A 2MTAA 1A4BA 1NIEA 3JRPA 2GI0A 2XX0A 3KW7A 4NERA 3UAEA 4JSXC 5IGOA 3FYIB 3MX0B 3N55A 5ANHA 3PAZA 2PM6B 5B7EA 2IDUA 2VM3A 4A68A 1GY2A 1W6WA 1SDDA 4YSUA 2CO0A 3FU7B 1U4CA 4FA4D 1PCSA 1TU2A 3SMRA 4DP1X 1OCOB 2ZXWB 4I79A 3H4FA 4JSPC 5D4IA 5I6MA 4U1EI 3ABLB 1GOTB 2GC7A 1ASPA 3EI4A 3GREA 4PC0A 3BVDB 4O9DA 1OLZA 3FU8A 4CY3A 4E9WA 3FU9A 1RZPA 5B4WA 2PPDA 3ABMB 1JMZB 3NJJA 3MKSB 3NJMA 4HHGA 2IUPA 2HXAA 2IUQA 4ZOZA 4BL0A 1NZRA 3EH5B 5I6KA 3VA6A 1TKWA 2P9LC 4L9OA 3AG2B 2GNQA 5IGQA 1HAWA 6PAZA 5GXHA 1WA1X 3CVDA 4HZ1A 3QJSB 1MDAH 5THAA 2IWKA 3ERXA 4CC9A 3CDZA 1OE1A 2H47C 1W6LA 3EHBB 4W1TA 1NINA 3AFCA 3IIWA 2YAOA 3VGZA 2HYEA 2YBAA 3BG0A 3NT0A 3S3CB 3OM3B 1SFHA 1BYPA 1PNCA 5EMMB 3EH4B 2R7EB 3NJNA 2AGYA 4N4YB 3UVOA 1KCBA 4PAZA 5B1KA 5I6NA 5PCYA 4F7KA 4KFMB 1ILSA 3UR4A 1E67A 4A0BA 3NYKA 4KOBA 4G71B 4CI3A 1K8KC 2EIMB 4KO5A 5I5MA 2P9KC 5H17A 3J80g 2XV0A 4CZXA 1MZZA 1V55B 2VMJA 2CALA 4HALA 2XL3A 2YAPA 1ASQA 1HAUA 1GY1A 5FLXg 1AZRA 1GSKA 5I6LA 5EARA 4G56B 2XU7A 4J77A 5HE3B 5GXIA 1DZ0A 3AG3B 5GSAA 3IIYA 4BWTA 4PCYA 3EI3B 3L4MD 2CBPA 3RN0D 4HIPA 1ZV2A 2I0RA 1KGYE 5HYNB 3I7PA 2EIJB 3CDZB 4HHWA 2P9UC 2J55H 1SQJA 3V5WB 2G9AA 2W8CA 1MG2C 4X3EA 1B9XA 2YAEA 3NVQA 3RFGA 1XHMA 3SQRA 4CI8A 3NJHA 2CJ3A 3OMIB 1PNDA 3PXWD 1MG3A 3OQRA 3JT2A 1BQ5A 4LG8A 1ZIAA 3IJCA 2W18A 1OV8A 4BXSV 4E9VA 4A08B 4ERQA 3FYEB 4K3ID 1AS7A 1NICA 3FSZA 4E9RA 5TEFA 3DM0A 3V9CA 3EI4B 5I6PA 2BHFA 1F56A 4E9QA 2ZOOA 4A11A 2ZWNA 1TEFA 1KDJA 4M4RB 1E5ZA 1SDDB 2UZYB 3ORVD 3U4YA 2HJBA 1WS7A 4KNSA 2HRHA 2Y1AA 5AFAA 1JZFA 1ID2A 3EF4A 4MFHA 2AGLA 2YNNA 2YNPA 2PCFA 3JAMg 5H14A 4L3HD 5EMJB 1ETJA 1I53A 2UXTA 4HCGA 2CN2A 4AOWA 4PNKB 3DWLC 1J5DA 2JXMA 5HQGA 1ET5A 3UVLA 2XYBA 2Z2PA 3ULEC 5FA5B 3FQ1A 2QPDB 3F3FA 4A08A 2YQBA 3HEIB 3PAUA 3L4OD 4E54B 1FA4A 4O45A 2VW7A 1IBYA 1W8EA 2X88A 4BUJC 2HX7A 2BZ7A 3X1BA 4DP5X 3SLED 3PLYA 1JOFA 2XU9A 1L9RA 1XIPA 3IBOA 1OE2A 2H6NA 2DYRB 2QXVA 5IT9g 4FA5D 2XYIA 3MKQA 8PAZA 3I2NA 1KBWA 4NAJA 2IURA 3MZKA 3NP4A 2YNOA 4IMMA 5FKSA 4A2DA 5B1BB 4L0PB 1JXFA 2AH1A 4BDVA 1N6DA 1AZUA 2GBAA 2QDVA 6PCYA 3KRXB 2J57G 3OKWA 3AH8B 4F2EA 3ASOB 3OW8A 3OMNB 4U7AA 3OD3A 4A0AA 2PP7A 3IKOA 3UACA 4TXVB 1NIFA 1PGUA 2FQDA 2OCCB 5I26A 5B1JA 1CC3A 4G7QB 3T9WA 2YB8B 1ZDSA 2I3SA 1B3IA 5EAPA 4CY5A 4A09A 3FS9A 3PAVA 4BDVB 1AR1B 2OK4A 2BBKH 5FKRA 1V10A 3H56A 3HFQA 3W15A 4GYBA 5B3SB 4UF7C 2HXCA 4A0BB 4FA7B 5TK4A 2H13A 3JZNA 1VLXA 2H9LA 2XVBA 2B5NA 2WSDA 3QJQB 2HRGA 2VW4A 2YAQA 1KV7A 5FC9A 2R7EA 3QQXA 2GSMB 2XV2A 5TK2A 4BWWA 2P9SC 3DXMC 3AL8A 3PE7A 4MK0B 5B1AB 3UGEA 1TYQC 3UADA 4AKPA 3ASNB 1PEVA 4JT6C 3V7DB 4CY1A 4E54A 4N8UA 3SBRA 4BH6A 2OIZA 2BP0B 3T6ZA 3BQVA 2I3TA 1XMEB 2BW5A 5D4JA 5IJ8E 4Z8LA 1JZEA 1AS8A 1WAEA 3EH3B 1Q47A 4JXMA 2XXFA 2WO2B 3T6WA 1P22A 1UATA 3CFVA 4DP2X 2ZONA 4FA9D 1PMYA 4E9TA 1OE3A 3QJVB 3IN0A 2AGWA 3IJ1A 2GHZA 4YSOA 3WNIA 4NSXA 3JB9L 3E0CA 4GQ1A 1BEXA 4XYHA 1QHQA 3UAAA 1J5CA 3MBWB 1PZCA 2IH9A 1IC0A 1PZBA 4J8BA 4N14A 3S3DB 3B7FA 4GMBA 2I7SA 1ZDQA 3NSYA 3CVBA 1L9TA 3OL2B 1GS6X 4ERZA 2HX9A 2H14A 5TDHB 4ZN4A 3FM0A 5K1CC 3K26A 1SQ9A 2Q5BA 2AQ5A 4FHLA 3SBQA 3ZDWA 2IAAA 5TEEA 2CO0C 2AVFA 4KO9A 4ENZA 2AANA 3UABA 4J87A 1AANA 2FQEA 2YAHA 1X9UA 3NJKA 2H6KA 3PPSA 3SVWD 3C75H 2PPAA 3NSFA 2FJSA 4YSRA 4DP0X 4G72B 1S4UX 3SBPA 3NJGA 1YFQA 4JT5C 3ZBMA 2EILB 3X1EA 5KDOB 4JD2C 4PSWB 1A8ZA 4QT8A 4KNTA 5EMLB 4WTQA 1ET8A 1A4CA 3NVNA 4H5IA 4Y7RA 5D4HA 4EWRA 1ZIBA 1SJMA 2WO3B 5F7AA 4HAKA 2PBIB 1PLCA 3UVMA 4K3JB 5TF2A 5HE1B 5IC7A 1JZJA 1OCZB 1ZPUA 2XL2A 5B1JC 4ZK8A 2EINB 3JTBA 3V9EA 1AZNA 7PAZA 2PP8A 4UAHA 1KBVA 1R5MA 2Z2NA 4LGNA 4X60B 3FT0A 4YL4A 3RN1D 4ZOXA 4X4KA 3QPKA 1AQ8A 1BAWA 4QQEA 2Q7QA 2PPFA 2QDWA 4E9SA 2AGXA 2CE9A 3OKYB 4ES0A 2BP8A 3CFSB 4E5ZB 1E30A 2XUWA 1T5KA 3GXUB 4GY4A 2H68A 3JROA 3WNJA 1U2VC 2CUAA 4G7SB 1B9YA 2H3XA 4GM9A 4AX3A 5C2VB 3T6XA 3T6VA 1SF5A 4ERYA 3FSWA 4BK5C 2YMUA 1PI6A 3FRXA 3I8EA 2X87A 3AZUA 4J82A 2I85A 4BWUA 4WKXA 2GC7C 2BP8B 1GR7A 4IA9A 4D0KA 1FWXA 1KYAA 2H9NA 5CYKA 1A65A 3NJLA 4JSVC 2GB2A 2P9NC 2H9MA 3IN2A 2I7OA 2UZXB 4GQ2P 2BWIA 4UI9R 3KRWB 4G7RB 2AH0A 5HE2B 1GS7A 3IJ0A 3QJRB 4A2GA 3DXKC 3I7KA 2UX6A 4O3TB 3DIVA 3PVUB 2P80D 2I0SA 4X63B 5F7BA 1L9SA 3VH0A 1AZCA 2FT7A 3EG6A 4A09B 3EI1B 1HFUA 3OKYA 4J86A 1JXDA 2IWEA 1A3ZA 1J9QA 2JFCA 3FSAA 3S8FB 3L45A 3SJLD 4A67A 3F3GA 4A2FA 2HESX 2IDQA 3WI9A 4A0AB 1N70A 2FT6A 1J9SA 2J5WA 4OZUA 2PM9B 4XEIC 3K27A 1E65A 5CXBA 2XXGA 1NDTA 1ILUA 3QJUB 3MXXA 3PSLA 5GMKn 3RYMA 3A0FA 4J78A 4ZOVA 4DP8X 5AFU3 3J81g 4KO7A 3NSCA 4YSDA 2IDSA 3EI2B 1IBZA 3I89A 2BO0A 4FA1D 4HDJA 2UXGA 1ERJA 1AAJA 3JZGA 2H47A 4W9ZA 2O9KA 4J0WA 4CZVA 5I28A 1ASOA 2OK6A 4NB7A 1XKSA 4L3GD 5B7FA 1L9OA 1EZLA 3C9CA 4PBYA 4AI7A 2PM9A 5H1MA 5C2WB 3H4HA 1JVLA 5K19A 4GM8A 4GP4B 4GP8B 4J84A 4YVUA 3HB3B 4KNUA 3IEAA 5EHFA 1BXUA 1PZAA 4YSAA 1JZIA 2VM4A 5JWZA 2A3TA 2EBSA 3ZIYA 1GS8A 1MZYA 4CSZA 2FT8A 1MG2A 1KDIA 1L9QA 1PY0A 1SFDA 4GGDA 4E9XA 1JJUB 4RH4A 5C9ZB 2J55A 4A11B 2OJ1A 4JHVA 2BZCA 5CXCB 2HX8A 3T71A 2PP9A 2E86A 5EAMA 4J8GA 3S3BB 4KOCA 4YSCA 1RI6A 2NRDA 2IDFA 3NVXA 5CYKB 3UKRC 2OVRB 1JZHA 4KO6A 1R1CA 1L0QA 2UX7A 2YARA 1CYWA 2VW6A 3KW8A 4F2FA 2B5MA 3AW5A 4GXFA 1BXVA 3AG4B 1NR0A 1JXGA 3AG1B 4YSSA 3SN6B 4JHUA 2QC5A 4CY2A 3X2QB 3U25A 1ADWA 4A2EA 2CNXA 4P5SA 4QL1A 1RZQA 1NIAA 1NTDA 4LG9A 4A2LA 1MG3C 2JKWA 4UANA 4AKOA 3JPXA 5EALA 2QT6A 2FTAA 1RKRA 4FAAB 4A7JA 3C99A 4XYIA 1FFTB 2QPEB 3PXTD 4GGCA 3FSVA 2HJ4A 2I0TA 4GM3A 1M56B 1GXRA 1QNIA 1JVOA 4TZ4A 1A4AA 3TA4D 3I7OA 3FQYA 4BXVA 2Z2OA 4QLWA 1JERA 2IDTA 3N0DA 4ZOYA 2CN3A 2IH8A 3JZHA 5FKQA 2N0MA 2YXVA 2GIMA 3OKTA 3SCYA 3ZWLB 2G99A 1PLBA 2GC4A 5AJAA 1X9RA 2DY2A 2XV3A 5FKTA 1JZGA 3CVCA 2OV0A 2VN3A 4R7AB 3TBBA 1OMWB 2P9IC 1OF0A 1WA0X 1J9RA 3PXLA 4AZUA 3RSEC 2UXVA 1VYHC 2OVPB 3D12B 3AL9A 2CE8A 3CG8A 4CI1A 3ZX1A 3OTTA 4G70B 4OWRA 4CSPA 2FQGA 3UVKA 3FPYA 1IKOP 4K9JA 4FWWA 4CI2A 4HCIA 1PAZA 2AZUA 1SHYB 1NIBA
chains in the Genus database with same CATH superfamily
4EF3A 3PGDA 1EK3A 3MRDA 1DR9A 3O2DL 3U0TB 4LGPB 4HT1H 4NQDA 1PU0A 2A38A 4M62L 2GJRA 1MCPL 4JGUA 4P9MH 2K9FB 2JELH 4MCZA 1CBVL 1WCBA 1JMXB 3B3IA 3WFCH 4FJ6A 3DOIA 3FU5A 4YHOH 2FH6A 5F6HI 1M2VA 2MCPL 5C9JA 5I5IA 2HCZX 5E8OB 1OTTD 1WISA 1ZS8A 3ARWA 1A14H 2EYTA 3FO9A 5IK3B 5C09B 2YAMA 1KWGA 3FUFA 1CCZA 3APFA 3ZE2A 3FUEA 4UNVA 1N10A 1QRNB 1UOWA 2C3HA 3KPPA 4G8GE 5HE0B 3OKNB 2WQUA 4FB1D 3ZDXE 3CLEL 4QAMB 1UXWA 3KDMA 3JZYA 5ISZD 1OARL 5I1HH 1M57B 4HUWA 1BZ8A 3SXTD 2BK8A 5ISZE 4KNQA 1RP8A 3K4ZA 3MR9B 1J87A 2BVPB 2GCYB 2QQQA 2MNUA 4RQQB 3OHXC 3RWDA 4LPXA 1BF5A 3K0WA 4IRZL 1CK0L 4HS8H 5HJGA 3T0EC 1B0GB 1T4WA 3EYFB 3T2NL 3NMEA 3I7HA 5HDOA 5CIPH 2WB7A 3JSSA 4QKTA 5IMLB 3K1KC 2EIZA 3HZMB 5CLTA 5GZND 3VFNB 4EQ2A 2HRLA 1CXLA 3NIGA 3EDFA 3QZWB 3BDBA 4K3DL 5C08D 1LQSR 4WHTA 1BCIA 5JA9A 5CHNA 4H8PA 4Y4FA 2OSLB 4P5RA 1A4KB 3WIIH 1MFMA 2F7IA 4PGDB 2B9AA 2IWGA 3RX9A 3G5ZA 3EJUA 3EYQC 4XAWL 1F11A 4N3TA 3QT2A 1ZCRA 2JCCF 2R2HA 2FH8A 2WXQA 4NKIL 4UQEA 3WEBA 5F2FA 3F01A 2AVGA 1CUOA 3RG1C 4DJMA 1JD7A 2F8OA 1J9TA 3MTXA 3RDTA 5I6OA 4D0DB 4M7JH 5DUBA 1TO5A 3DTUB 4FTDA 4YSPA 2N01B 3ARDC 2ILLA 3CVHA 3QHZH 1QLEB 2J1YA 2Z93B 3IGKA 4HPOH 4NHUA 3NIDE 5E0QA 3MA9L 2D9CA 2J44A 2V9TA 4OLZH 2OXGB 2BCJB 1KFGA 5G4MA 1YPZE 2VDNL 3VD3A 4GUPB 5E4EC 3QZNA 1T22A 4DGIH 5CM1A 3IDGB 1O6SA 1KXTA 4JVUA 4OTXH 2GJJA 3QE5A 5I1DA 4ODUB 3DSMA 4CMHC 1EMTH 2VC2L 3UBGA 4LDCA 3EXJA 1JIBA 4CADA 5GS3A 2GITA 4G6AD 3DJ9A 4M02A 3S34H 3ZR6A 5DJ2A 2B5IC 1VA9A 4JFOB 2WXGA 1YC7A 3FU7B 4WEBH 3EXLA 4LOUD 1UT9A 4PWFA 4P2OA 4YHMH 5T5FA 4LHJB 1G1KA 2CDGA 4KX8A 1QW8A 3GSQB 1NMBH 3KYAA 4CY3A 3AWEA 5F1NA 4OGZA 1B9ZA 2WXJA 3KPLB 1BQUA 2XCMC 5DI8B 4BV1A 1HTYA 2BIIA 2HVBA 4HHGA 1UB6A 2B1AL 3FB7A 1UENA 3UGXA 5LNGA 1DE4B 5KAQF 2P9LC 1DSYA 3AAZA 1FZMA 1AZZC 4GXVL 1CGSL 1OGTB 3AU1A 3WJMB 4U33A 3BZDA 1OE1A 1YNTB 3MRRA 1IBBA 1QLFB 2EKSB 2EDJA 5I66A 3CHSA 3C5ZC 3L17A 1N4XL 2HYEA 4MQXD 4XMXA 4KJPC 2E0PA 1PNCA 2WYZA 3DGGB 2XSKA 3AITA 2NSXA 1RK7A 4YWGL 2MPVA 2ZUTA 1KPRA 1XF1A 2G2PA 1TENA 3BGFC 4XWGL 5D7IB 4JCMA 1D7FA 3PXJA 5BMFH 4QTIH 3D2TA 1YNKH 1JNLH 3Q8CA 3AMLA 3T3PE 3WELA 3JTTB 4OZIF 5E6ID 2YD7A 3A21A 2EYSA 1QTPA 5HYQB 3D9AL 2NLJA 4F2ME 4HMEA 1WFIA 4O02L 1ND0B 2IXQA 4MHHI 3WFCL 5FW6A 5FA3B 2C1OB 2NZ1A 1FL5B 5D1QA 1YHPA 3WFEH 1KGYE 5L7XL 1P0SE 1YUHA 2DQCL 4PJBA 3VFMA 4P3DA 4PVMA 1CGVA 4QOKA 2OL3H 3PNWB 1QR4A 3RGVD 5J6HB 1H6FA 5EC1A 1BVLB 4J3VA 1WDAA 4KKCC 5CJBA 3V5WB 1CN4A 1O7VA 4FMKA 3RFGA 3O8XD 2ENSA 2YRPA 2CJ3A 5GS1C 2Z8RA 3QW9A 1ZIAA 4LEOA 4PIRF 4CU8A 3SDYH 2LW3A 4ABVA 5EWIL 5I1HL 2Z92A 4EI5C 4P2RB 3FSZA 2ZUYA 2J4WH 1P7BA 1HI6B 3VD1A 1RK1A 1XF3A 1P84J 1ADQA 1WZAA 2IALA 5HHMB 1LXMA 4IRZA 3DTXA 3O8XC 4V1DE 2OK0H 1LJMA 1DLFH 5GQBA 1P5VB 4N8CL 1HX0A 3KWWA 4Z3TA 1C8PA 1FORL 1PJWA 4GAGH 2HRHA 4V11A 1O0VA 3V55A 2BSEA 1NLDL 3AS1A 4JM2C 4QAWA 5GISH 4L3HD 2QHRL 3H7LA 4XMPL 3NN8A 5CD5C 1Q4NX 2QPDB 4WGWB 5GS0L 3E1ZA 2FD6H 4HPHA 3O3BB 1IAOB 3BWZA 4N0YL 3ARSA 5GRJL 3QUMH 3FRPG 3JTSA 4UM9A 4A7SA 2K4AA 3KLDA 2WLJA 2DI8A 3HFMH 4MCMA 4N9GA 4WEEA 4A2DA 3N40P 5BS0A 2X6CA 3AUVA 1AJ7L 4BGLA 3H3PL 3D18B 3OMNB 2PR4L 2A0LD 4F57H 4XVJL 5TE6H 2GAZA 4L3CA 1CPUA 2VR6A 1NLBL 4U7KA 3KNBA 1L7TH 2X4QA 3BGMA 3CXHK 2LU5A 3H56A 1KB5L 4DUVA 3TJPA 2QR5A 4Y2DC 4FA7B 4JPKH 4HUCA 1VLXA 2V33A 4YBQD 2XVBA 4YE4L 5J11B 1NMCC 5C0GA 3MRCA 2Z34A 3LS4H 5F96L 2EXWD 2V9UA 2BVTA 3VFVB 4YX2L 4O02H 1XGQB 1CZ8L 3W38A 4H0GA 3T6ZA 3HUJF 5D6DA 4ZFFB 2ZPKL 2OP4H 5JPNA 3NCEB 4Z7QF 4I18C 1CD8A 25C8L 5CU5A 5EULV 4XNUH 5I1EH 1GZHA 3BKYH 5TGBB 1G7HA 2P9RA 5C08E 4YHKH 5DWPA 4ICWA 1YECH 3IDJB 2VXQH 4LNRB 5CKGA 4X7TB 4AT6B 1ZLVH 4N2EA 3RBSA 2J1XA 3RB7A 4ZSOA 2MTPA 2PXYC 3EQ7A 3F58H 1SXAA 2XDWA 3S3DB 4N14A 2QZPA 3UTPE 3JZ7A 2I7SA 2K6WA 1L9TA 4BCCA 2XE4A 4LEEA 2JJVA 2EC8A 3MLVL 4GS7C 1E8ZA 4JRXE 4NUGL 4FHLA 1S7VA 4PN6A 1ZGLP 5CNHA 2DMCA 5AWNL 3NZSA 2IOMA 3HJEA 1DEEA 4XPAL 3SCMD 1C5DB 1T4KA 4JT5C 1AE6L 4OW6A 1B3JA 1A8ZA 1IM3A 1FUNA 4N25A 3BGAA 4WTQA 3VRJB 1T2QL 4Q4EA 3REWA 3UO8B 4EBQL 2D3NA 4HAKA 4QRFA 3CZNA 2R56H 4JFED 4YHYC 4HLEA 3V5KB 3UG5A 5JHDE 4FQLL 5MERA 4GB9A 3DX8A 4P5TA 5ANME 1ZPUA 4U6XA 4Z6AT 3K6FA 4ZK8A 4FXLA 4R96A 2P8LB 5GZOC 1WCQA 4OLUL 2Y2WA 2R29H 1GA2A 1E5UI 3VXSB 2B5IB 4DOHE 1ZHLB 2QZ5A 2XN9D 2PPFA 3PWPD 5IVXE 1QBML 3OHXA 3OX8A 1MFEH 3APMA 5HYSB 5K39A 4O58H 4QXWA 1KCVH 3P2BA 3BUTA 4I85A 3FF7A 1L7TL 3N42F 3CZFB 4RAVA 5IB5B 1SF5A 1GH7A 2DH3A 2X4PB 5F89A 1M6OB 4DN4H 1D3CA 2BNUA 1FVDB 4KPHH 4YO0B 2V9RA 3CSBA 5KVDL 3F6LA 3MRJB 5BPPA 3VTTA 2H2PC 5ACZB 2X2YA 4UOJA 2Y3NA 2H9MA 3B2VL 1RIVL 3CWGA 4U1JA 2OSXA 2CKBA 1GXEA 4F20A 1MRDL 1U42A 4M7ZB 1CFVH 2I0SA 1G9NH 4U6TA 4OVVA 1CFMA 2JB6A 4WEMB 3RVWC 2X70A 3FSAA 3VFTA 2OJZL 5I2IB 2EDXA 3N44F 5KYYB 4XEIC 2AF2A 5CGTA 5KSAB 5CXBA 4ODUA 3L2MA 2QHRH 3BT2H 4U1SA 4BZ2L 1M71A 3ZHFA 4J78A 1A1OA 4P48A 4KO7A 3OLIA 1UZ6E 1YNLL 4PI2A 1O9WA 2H0FA 4HUVA 4OY9A 4XP1H 1IZKA 2DW5A 2MWCA 4NUJB 3WFHA 1S5HA 3B37A 3W9EB 4NFBA 2ZJSH 3HE6B 3ISYA 4ZUSA 4PCTA 2RFXB 4KY2A 1L9OA 2J72A 5D1QC 4O4YL 4ZW7A 1DQDL 5AOMA 4LLVB 1LNUB 2VH5H 3GBML 4GSQA 2ZOLB 3IKCA 4ODHL 4RGND 2CLZA 4P5KA 5I75C 3WN5C 1HIMH 1KG0B 1URLA 3SPVA 1F4YL 1H3VA 1OAJA 3HPJB 3K2MC 2GJ6E 2X53A 1SQMA 4FNPA 2ZXAA 4X4ME 5A2AA 3VQ2C 4GGDA 1IGMH 1U8LA 1AFVH 1PPIA 2CBTA 4Z3GA 2DRUA 5E5UB 2PYEE 2IPUK 5E8DH 1XHHA 1U2YA 1ZVSB 1X3DA 2BSED 1MFBL 5DF0A 4BFBD 1U4EA 4BZ2H 2Z8SA 2Q7YA 4XN1A 3SGDI 3X17A 2DQMA 5C09D 2CR6A 4AYFB 1SQ2N 3G9VA 1AE6H 4HGMA 1E9QA 4IS6A 2Y72A 2G5BB 1BG1A 4MCYB 2J6EA 5L2JA 4DERA 4J3OD 4N0CD 4E2OA 4WEUD 4UANA 1AGBB 1LO0H 3DX9A 3O3UN 4MLSA 3V4PL 3QXAB 5K9OB 3WXWL 5KVGH 1CLYL 2HKHH 3ARBD 1QNIA 1CFTA 3CK0L 3SKOB 2WLIB 1A6UH 1KEGH 1HHJB 3BZEB 3FAXA 3CNKA 1IGIL 1M3IA 2DLFL 3AVEA 3LY6A 3RTLA 5ICZB 3CVCA 4JPQA 4ZMZA 3QEGL 2ZUXA 4WU7A 3UO1H 4XCNB 2VERA 2AQQA 5KVGE 5BUAA 1F0LA 1A7NL 4TNVK 3Q1SH 4U0RC 3QQ9D 2Z8WC 3QDGA 1XCTB 5HYFA 5IOPA 4D8PA 4HCIA 1K2DB 1KXVC 3O9WB 4PJ5D 1K3ZA 3B3IB 1A0QL 2IMNA 3SWSD 4AN0A 1SXBA 2GKIA 1N7ML 2QQKH 3TA3A 4YBHA 3OKKB 3EYUL 1QP1A 4N28A 1LP9B 5JR1L 5M5UA 1FO0A 5FGSA 3KCPA 1AS6A 2GTZA 3DSFL 5IB3A 5B3JF 2FQFA 4KTGA 1EMTL 3IMBA 1FG2A 1JI1A 3HFFA 3TCTA 3KPQB 1NH6A 3S9DB 1M42A 2DWSA 2PUQT 3N1GC 3D0AA 1VFUA 1KB3A 1DQJA 3BQUB 3KLQA 1NIDA 4PG2C 2RD0A 3H42H 5H37A 5KYUA 2AGJL 3L5WA 1MFDL 4A66A 1FH2A 4G1MB 1KJ2L 3GMPA 1SN5A 3VGAB 5EF3A 5JMOC 2BP3A 4S2SA 4X7CC 3SDCC 1KWKA 4JANB 1FC1A 3BAEH 3D39A 3MLTB 4BCYA 2CGZA 4HJEA 5DEJA 2DJSA 1TJHL 5SWSA 1LMIA 2BXZA 3T1FA 1EXUA 3VDCA 3ISWA 3F7KA 3QCVH 43CAA 1UKSA 5KG9A 1G9NC 1MRCH 4OCLC 4F7MA 4XXCA 3P3YA 1MOEA 4KVPA 4NQSB 3MMYA 4PVNA 4BSVA 4M29A 4MMXA 4BKSC 4NWUL 5DQ9A 4HOMA 4X7SL 4BHUI 5G4NA 1JUFA 2O5ZL 1P9MA 4JFDD 4HIEB 3V6ZA 4X6CE 3DKHA 3FU6A 4FQIH 4F3FB 2ZUVA 3QJOA 5DMIH 4HWEH 4HPYL 1FIEA 2VSMB 1HXYA 1HXMB 1E7VA 2JB5L 2O5NA 4Y2DA 4LE8A 2LE9A 4LCWE 4R83A 4KVNL 3HI6H 1AHMA 2RB8A 4BSVB 4Z0XB 5HYSG 5CWSB 3L7EB 2HKMA 4JKPH 2WLYA 1JRHH 1JSYA 4MVBD 4GO6B 3VFOB 3WKPA 3X1FA 5FCUL 4ZD3H 1FNGA 4LVHB 2ICCA 3HIZA 4UQ2A 2D2OA 3SHFA 1JPSL 3PHOB 4MJ2A 4MB1A 4N20A 2ADJB 4NM4L 4Q9CA 2MHAA 4L3EA 4ODVH 1EXUB 3PCYA 3TN0D 4CZYA 5DJXB 1G6VK 4JR9H 5DHYA 2ODIA 4KROC 5EWIH 2D7TH 2RH0A 1OZUA 1KGCE 2B59A 3ARRA 4DPBX 3B9AA 1B4LA 3PHAA 3KS0H 4FFZH 5C07B 2WSKA 4L9LB 5D7SL 1A4BA 3RUGE 2KKQA 4RMUA 3V0WL 4WHYG 5IVXB 5T1LD 1QG3A 3SDCD 2DN7A 3BCDA 4NI3A 1HILA 1FH5H 4JZNB 5MI0C 1J8HE 1KMGA 5IHLB 1EHAA 3O4HA 3ZKQD 5KSUB 3ZHLA 3KPQA 1BOGA 5FAAA 2H1LM 2JCCB 4JHBA 2GY5A 3LXAA 4WJ5A 2KLSA 4EKXA 1NMAL 5BZDB 3UYOD 4HS3B 1UZGA 1H5BB 2JE8A 4G7VL 4NZTH 2NXZC 1UH2A 3ZDZA 3PHOA 5FK9A 4WKZA 5IJKC 5GXHA 2G75A 3CVDA 2YKLL 5FO8B 5IMOA 4XP9H 5EOTA 4F1ZA 3OG4B 2H47C 3EHBB 4I3RH 5GZOA 3QUKA 1J7VR 2YAOA 3Q05A 4PRPA 5IROD 4UOZA 4QHPA 2WZ6A 4G9DB 1WBYB 4ZODA 1WBXA 3WDHA 1FBIL 3GTTA 1MSPA 4F7KA 2EUWA 4OGAC 4GINA 1RK0B 2VDKA 3QQDB 2CRIA 2W60A 4PWEA 2C4XA 4NHCH 5FYJE 5TQ2L 1E8NA 1NCBH 1OM3L 1DUYA 5T3XH 4AUYA 1T03L 5AYUL 2J8UA 1P5UC 4FNUA 5A6MA 3K8KA 3GZPA 4LDLB 2ERJB 1Q94A 3ZTJG 1ZKAA 3ZU8A 4IS6B 4GW4A 2J55H 3LDBB 4QY8A 2VR3A 4K5MA 4WTZG 2UWEF 1N59B 4NS0A 3EOBA 3ZY7A 2CLVB 3OMIB 4MASA 4LLWB 4ZMPA 4UOW1 5LBSH 4OF3A 4FQXB 1N3NB 4DESA 3MROB 2ZOKA 4LKXB 5F3HB 1ZVSA 3FTUA 3C09B 5EFIA 5HJ3B 3GC3B 4Y2NA 1Y18B 5HI3D 2QVMA 2AAAA 1OWRM 1YR2A 1FGNH 3U4YA 1WS7A 4W4NA 3VI3B 5ADOL 2CLRB 1JZFA 1ID2A 3AUWB 2YNPA 2L04A 2VCOA 3RVXD 1FGVH 2P28B 4MA1B 5E5MA 5J9PA 4NPYA 5ELIA 3PDOA 2BSRA 3SB3A 3RDJA 5F93C 5DD6A 5CGYC 4C56E 1UACL 5DS2A 5DYOA 5KS9F 1R5IA 4KZDL 3U1SL 3HEIB 3KHQA 5FOBB 3ZKXB 4Y16A 2VW7A 2O5XH 5EF0A 1JGLL 2V8LA 4HK0B 2LABA 1D2OA 2CO6A 4J6RH 1P4IL 2GFBA 5KOMC 3WFHB 5L8LB 4PTTB 2H6NA 2NY1B 5IT9g 3GMMA 4PJCB 3UBXG 1Q0XL 1EAJA 2R69H 5DZVA 5TD4A 2AH1A 1S7XB 1MQ8A 4JO2H 4TKWA 4HOWA 3LQZB 1N0LB 1DVSA 5DCCA 4A0AA 5D1ZD 1IC1A 1IGYA 3FTXA 4LARH 3VXOA 2D7MA 1MRFL 1ZDSA 2JNZA 4OFDA 1NBYA 3F84A 3BGFB 4AOFA 1NC4A 3FS9A 1RPQA 4OD3L 2OK4A 3FB5A 4YHIB 2ZZUT 3LS5L 3RL2A 4OIBA 1BQHG 1TLMA 4KDWA 3VH8B 4C56B 5IGQA 1PX3A 5F1IB 1RIUH 4L9OA 5FC9A 4IEFA 1YVLA 2XV2A 4LOVA 4XAWH 2QL1A 2DS4A 1U8KB 3NCJL 3M7OA 1EJ6A 3EYSH 1R3JA 1OK0A 2DD8L 5I1CL 1MRDH 4L18A 1G9MH 3NQKA 4HD5A 5I0DA 4GRWE 1QPPA 3RA7H 2A73B 4KJWD 2GUOB 4HKBA 4NQED 1BMGA 2A4EA 2NQDA 4B9YA 2KS0A 4NQEE 4HU8A 1YMHA 1NCUA 1PL3A 5B38A 4QOKD 3B9KC 3E0CA 4PJ7E 5E2VH 2RA1A 1W0WB 1RZIB 2IH9A 4LCUA 2ZWSA 4R96B 3WIHL 3VUAA 2YK1L 3QI9B 3ZL1A 5EIVA 3LJ3A 2OR9H 4UCFA 5HVGB 2CO1A 3O3EA 5CZVL 3MREB 5I1IL 2NW2B 1EDHA 3FT1A 1P2CB 2YKLH 4M43H 1S7SA 3T4AB 3ZK0A 3CFQA 5GJTL 1F86A 2VDOB 2D7NA 2R0ZH 2WLZA 4EUPH 3X1EA 3FN3A 2OMTA 4IHOB 3IJEA 5DHDA 3AREA 1OL0A 2DIBA 5JOPE 5C3TA 3GBNH 4NJAL 5I17A 2EDOA 1ZANL 4O2FA 4UIKL 3WJLC 2VO8A 2P8PA 3DXAB 4PS4L 5HE1B 5IC7A 3H7BB 3C6SB 2AXWA 3P2TA 1GGCL 5B1JC 1LWRA 3KLAB 4X99A 1A3QA 4G43B 1QSEB 2XJKA 1NGXA 4XAKD 4JFWA 4K55A 3VXNB 4IBLT 4CSTA 4HT1L 4GPVA 3TNNB 5IT2L 3J07A 4E9SA 3ECUA 3HNSL 4Q7DA 5LXGL 2B77A 3MUOA 4MXWH 1EAPB 1T5KA 2IPKB 3QIWB 1S7WB 2ITDB 5DMKB 4ORGA 4UT6A 3ZMEA 1J8HD 2YRZA 1IKNC 1J1OL 2L0DA 3QDHA 3ZVVA 3FSWA 4WUUA 1QLRA 4Y4KC 2XQYK 1B4JL 4I0PD 1PYWA 1IAKB 4G8GA 3P40A 1A9EA 4KK5C 3RLSA 4IGBB 4HG4J 3G6AB 2GB2A 4KK5D 4APXA 5IESL 4N2AA 1EFXD 2XWCA 2BMKA 4EUPA 1I8AA 3QJRB 4AV0A 5JQ6H 1R0AL 5B1CA 1LE9A 4X63B 4PGCB 3BEWA 3EG6A 3DXAA 3GSNB 4LASL 1A3ZA 4J8RA 1CBJA 2JFCA 3MJ7B 3P3RA 3HN5A 2R4SL 1X5IA 1J86A 2GPZA 2F15A 1HNFA 4M5ZH 3GI8H 4FX5A 4QUOA 1HZLA 2YXMA 4MDJB 3BUDA 3DX8B 3NIGE 4P5TB 3MXXA 4MX7A 1UJ3A 2FGWL 5IKCA 4CVWA 2OP4L 2ICEC 3UDWA 4YHZH 2F54A 4Z7WB 5HGAB 1IBZA 1UKQA 2VDLA 1INQB 3TYGL 3UCQA 1U9KA 5HSFA 2GSGB 2HT3C 4TOYL 5IBTH 5I1AA 3P77A 1XF4B 3FO2A 3EGXA 3V2AR 5HI5C 1A6PA 4FQIL 4JY5H 1MJ7L 3QSKB 1MPAH 2DQJH 3N0EA 4U1HB 3IEAA 5JQ6L 5DHVB 4U1LB 4KUCD 3CMOH 4O51A 4NBZB 2F54B 2BIQA 4RH4A 1LE9B 1BSIA 2ZUQB 2ADIA 2Q3AA 3T71A 1R3KA 2APVA 4MSWA 3DMMD 4N8VB 5JW3H 4K2UL 3QCUH 1IGCL 1GOHA 1XAKA 4KQ3L 3NJXA 4WTXA 4LU5H 3CSTA 4ODWA 2YARA 2FGWH 4XVUC 3QUZB 4EIZC 4R7DA 1ACZA 3BSZA 5JPNB 1N6VA 2B0SL 3PP3H 5BOZG 1ICTA 4TPRL 5LGYA 3TO4A 5LAXB 4QL1A 1NIAA 3PWLB 4LG9A 2HFGH 4GKOA 3P9WB 4N5ED 1I8MB 1XAUA 3N0AA 3CCHB 4XZUA 1ADQH 3UH8A 3WCYA 3TNNA 4A7JA 4JMXA 1B4TA 5MEQA 2QPEB 2QVFB 3QH3A 3TV8A 3FSVA 1NGXB 1GGIL 3NZUA 5EU6D 4H8UA 4W4OC 4OFIA 3ARTA 3DHMA 5CGMA 1AZVA 2VDRH 5T1LA 5I82A 3AT0A 5IQ9B 1HSAB 5FO7A 2I32A 2J6WA 4ORGB 2M83A 4K8RC 1UWYA 1FYTD 1OF0A 3WKML 2WCSA 4JUSA 3DGGA 5AUMA 1HZHH 1UTCA 3V7AE 3ZX1A 4ZX5A 2HT4C 2E6QA 3BUPA 4TQEL 2PYFA 4HC1A 1AG6A 2IQAA 4V2BA 2F19H 3CVIH 1B2WH 1TETH 3HRZB 4NRYB 1AXTL 5D7KE 5LB1A 4Y1AD 2BM3A 1P2CA 5DVPA 1YQ2A 1AD9B 1RZKC 2JKJA 4PSPA 5CMAA 1GVIA 4O51B 4ATWA 2AK1L 3S36H 2IGFL 4JFHD 4Z7OE 3MV7E 2FECL 3VW3H 4BQ8A 3MUZ1 3JWNG 2Y6SC 2F53E 2QKIC 3QDMB 3STLA 1IUZA 4EKJA 3BH8A 3HNTL 5FXYA 4M6AA 4FXTA 3UEQA 2O1AA 3EGXB 5B22A 4MMZB 4OLYL 2FATL 3UTQB 2OMUB 1HU8A 5F3HA 4PJCE 1H2XA 4J3XA 1I31A 4BCDA 4ESGA 3RGBA 3UMTA 4EZJA 1H15A 5IVNA 1G6RB 1S7TB 4X7DC 1UOVA 4ALAH 3D7PA 4QOKE 2I60L 2Y36H 3B9KA 4G3YL 1SJEA 2J5LB 4M3HA 1RZIA 4R9HA 5FDYA 4JSNC 1NPJA 4OGYL 4LMQI 4JHAL 1BF2A 5F88B 1BQLL 2DYSB 4TSCL 2GTQA 4IRJA 3QI0A 1AACA 1I9EA 32C2B 1OAXH 2AEQH 4DZBA 4X6DE 2OFQA 1WYJA 2YA1A 3FB5B 4O1QD 1PF3A 2Y69B 3ABGA 2MOQA 1RZJL 3EI3A 1G43A 1A9EB 1WBXB 4Y2LA 3OZ9L 4E5ZA 3KBHE 4FXGB 1NGPL 3LHAA 3IDIA 4GEJA 2NY1D 3HLAA 1GGYA 3IDMB 4WF7A 2OJZH 1WZKA 5TDNA 4A7GF 2FLRT 3A0OA 3CIKB 4L05A 2CCVA 5DK3A 1N6EA 5DHMC 4RX4A 2X6BA 3RRMC 2R2BA 2ATPA 4ABUA 2AFNA 4JO5A 2BLFA 1MCCA 3DO4A 1WEJH 2VN7A 1WVZA 1WF5A 1CVSC 4WSKA 1SHXA 1A6VL 4UQ9A 2HLEB 3P1VA 1HEZB 1DBML 5HXMA 4PV9A 4AYID 4QHMA 4C83B 1NAKH 1WC7B 4ELKB 5F1NB 4ZNCD 3IAGC 4FAND 4ES9A 5FUOH 4FNLH 4GAAA 2FIRT 1E4XI 1NCCL 5CZRA 1LVEA 5C07A 3KH4A 4DNWA 4XC3L 1PZUB 1AR1C 1JTOA 1WAAF 3BD4A 2YD9A 3AWFA 2EVFA 3FYIB 2VL5A 4KRPB 3SYOA 3EOBB 1E5CA 3EW3B 3QNYA 4PWHA 4IMKC 1CXIA 1OW0C 4GG6A 1N5AB 4DP1X 1CE1H 2ENQA 1ACCA 3HAEB 5HYJD 3OJ2C 3TTSA 1J8HB 4XNQA 1A1NB 4O9DA 4MCZB 1MREH 4BRVA 4UYPA 4X7EC 3WFZA 1XGUB 1OTSD 4F8OA 4I0PA 3GXMA 1KGWA 3CC5A 5DVKA 3D87B 4GO9A 3LZQA 3MRDB 4R7LA 4WGKA 5DUBB 4CC9A 2UV3A 1NM9A 5IQNA 1Q9OB 1W6LA 3FBKA 4OQ1A 1T1XA 3AFCA 1I7TA 3SE9L 4OIFA 5EC2B 3RAJL 5HYJB 4G9DA 2EH7H 5F21B 5JDJA 3FQTB 1RUML 2R2HB 3CXHJ 5LCVH 4PAZA 4RMVA 5IMOB 4NQXB 3RWJA 1JP5A 3H3PH 3M88A 4PS3A 1QFOA 4ZOBA 5IQLA 1HYSD 5TQ0H 5I5MA 2WBJD 4YNYB 2X28A 3ZE1F 4HAGA 3PU7A 1A6ZB 4HALA 2QTEA 3EGDA 1A2YA 2V5SA 4R4FL 1HAUA 4HS3A 1Z9LA 4FG0A 4AJ0A 1GSKA 4F7EB 1O75A 3BW9B 2PN5A 3EI3B 4ZO9A 2Q2LA 4H20H 4JPWH 3VXRA 1VJSA 3VXQA 2I0RA 1OAYH 2FBRA 2WOBA 3UP1A 3BWAA 4HS6B 2AJXL 4YGVB 3CDZB 3IFPB 4DZBB 3RWEB 5ICXB 2QSTA 4CSSA 1KIUB 5FFGA 4N5EC 2VISA 1KPUB 4NKMB 4B9GA 3TV3L 4DK6A 3IJCA 4WJ5B 2DM3A 2YEVB 4UM9D 2NNXA 3HTLX 4I5BA 2X4TA 4JPVL 4QAMA 4BGDA 1SLUA 3EQ8A 2FJFA 4FLHA 1YEDA 1EEYA 1S7TA 2ZCLL 1S9YB 4NM4H 3DPBA 4W9KC 2VDMB 3FFCE 3B43A 2P52A 4LSUH 1KPUA 3CFIC 1BREA 1KELH 5CJ5A 2CU9A 5FDWB 1JWUB 1KFAH 4K7FB 5T1DH 4EVNB 1DVFD 1FZJB 4PH8A 2Z2PA 1Y0LB 2XKNB 5DRXA 4XX1E 5EOQH 2X6VA 1UHVA 4K0OA 4BUJC 2X88A 1W8EA 3Q0HA 2EDRA 2HX7A 4IOIB 4UQ3B 5C92A 2KZKA 3PLYA 1VKXA 3K74B 2ENYA 1UD2A 2ORBH 5DLML 2DYRB 1RL1A 2ROXA 5GRVK 1HXYB 1B0RA 1M1XA 4YXLH 5I8KH 4FFTA 1OT4A 5GGTH 5DJ6B 3H2WA 1JN6B 3G08B 4XCNA 4BZYA 1I7RA 2A0LC 2BFVL 3GXIA 3MGTA 3AY4C 1HHJA 1P4BH 1BBJA 3MC0A 4HX1A 4IKKA 5T5NG 5CCKH 1ZTMA 2F5BH 3ASOB 3ZTNH 1A7BA 3SGEI 3HHMA 4HK3J 4LLMB 2AW2A 4P2RD 4M48L 5EAPA 1I3RB 3VX1A 4BDVB 2NPLX 1PLGL 1XIWD 4GKSB 1AHWA 3GSXB 2HXCA 3MNVB 3VA2C 3BO8A 2BSSA 5I1GH 3CC5B 3GUTA 4TRPL 2VN5A 2P9SC 1T1ZB 4X4MA 5DQ9B 2H26A 5F9DC 3NPZB 4X9HA 3RY6C 3FH5A 1BGXL 1AKJD 3LV3B 1R9FA 2I07B 1U3HC 3O2VL 2BERA 4UTAL 5E70A 2EVHA 1JFHA 2BW5A 5D4JA 3FTVA 5E4AA 5GGRA 5I0YA 3FRPB 5KG9B 5JPMA 1FGNL 3SKJH 3CFEB 3T1FB 4CBPA 3VWJD 2X4UB 3QUMA 2ZCHL 1CTNA 1KN2L 3KM1A 3O2WH 2DB8A 3QISA 3NBNA 1LP9E 1MRCL 2OMZA 3SYQA 5JDSB 4GUCA 4JE4B 5FKPB 3FQWA 1AGFB 1QHQA 4UMSA 3JV4A 1OANA 3ES6A 4QO1B 1J0JA 4F27A 2VJXA 2FIKB 3GMQB 1ZLSH 1ZDQA 2P5WD 1HOCA 3CVBA 4WJKB 2VDOH 1DJYA 3S5LA 2B1HL 2O5ZH 2W0LA 3ZE1E 2Q5BA 3X12A 3SBQA 3V4PH 3P3TA 4KO9A 2CO0C 4LKCB 1R5VB 4C83A 4NYLB 4K7PL 3PPSA 1Z5YD 3T77B 1NFIA 2CKBH 2EILB 3PUCA 3VXRB 4OFPA 1JGDB 3U9PL 3G6DL 4PJGB 4ODXA 4EWRA 3VFTB 5CR1A 1TVBA 2HVKA 5LBSA 4MB4A 1SUJA 3LEVH 3VWKB 1W15A 2WXNA 3O6LH 1X5LA 1IT9L 1CDYA 2NY1C 4RIRB 2C3VA 1C12B 5DZLA 2NY5L 1RJCA 3IFLL 2CO4A 1DVQA 5D5MB 3NK3A 1IIIA 3POHA 3WXWH 3ULVH 2QVTA 4UTCA 4I13B 4XHJC 3SQOL 4DW2L 2DLEA 4I3RL 5D1XA 3QORA 2WXFA 4NC1E 1QFPA 4YFDB 2ZTBA 3GXUB 4PLNC 4IRJC 1CJYA 5DDHB 1ZGLB 4ZPTB 1OW0A 5CBAA 3MLSL 4P2QA 4UIMB 1MCIA 2VB5A 4M7JL 1YO4A 3FRXA 2HTLC 5K39B 4J82A 1JGEA 1WLHA 1NAML 1TJGL 5IHZB 1NKGA 5D5MF 3AT9A 3F12B 5E08H 2XZQL 3MCLL 4M1CC 4JQVC 2CGRL 4KKAD 4QWWC 5LBSL 4UI9R 4W93A 3KRWB 4I0PC 1NGZB 4N2OA 4MGXA 4UNTA 4OFYA 3QIBB 5E8NA 2D3JA 3W5MA 4QJ5B 4A09B 5I1IH 4YHPA 2ZWKA 2IWEA 3A6BL 1D5BB 3RX7A 2A74B 3BXNA 3RKDD 3T3MA 3QUXD 4FKHA 3N43B 1EGJL 3ZKXC 5EO1B 1AGDB 2Q76B 2J5WA 1USQA 1KYUA 4NEHB 3FUHA 5IVXF 4IGBC 4CVZB 3ZL4H 4POZD 3BKCH 4G1MA 1IKFH 2XN9B 3MRIB 5CS7A 1RZJH 3ARDD 3RE0A 2FVNA 4Y5VC 1BGXH 4ZMQA 5EA0H 1KG0A 5CINL 1KXVA 3UJTH 5GIRA 1VFBA 5I28A 1XKSA 4P3WA 3VAEA 4RWYL 5JQHC 3COOA 3JYCA 2NXZB 4JRLA 5E2TH 4X4XB 2IQAB 2XT1B 4YVUA 1KENH 3QBTB 5DWUL 1KOAA 1FVCA 4LCWA 4U6YB 4UM8A 3C60D 3W9EA 2ZYIA 3BP6B 2WLMA 4QTHA 4NJ9H 2EBSA 1PZ5B 1MZYA 1WIPA 2DIEA 3OR6B 2ATKB 5E8NB 3QIBA 4QGYA 3JYBA 3ARED 3QRGH 2PP9A 3FN0L 5FCUH 4KOCA 4G5ZL 3ZT5A 2DWXA 3V8CA 4GKNB 2VAAB 2D4FA 1MH5B 1NKRA 4FXGA 3MRJA 3HN8A 3HOGA 4TSCH 3BZ4B 3UYPB 2QVIA 5FHBH 5JIQA 2V17H 3FQ4A 1QBLL 1BQHB 2X4PA 4HKBB 3AG1B 2H7WA 2IG2H 2VZVA 5JNYA 1SY6H 3MRLA 4I48A 1IVLA 3C12A 1Q8MA 4N0UB 4P8QA 3UTTE 5ACLA 3BDYL 4ZTOH 1BPLB 1A6TA 3BPLB 2J8HA 4YFLF 4U1JB 3VFSA 5FYLD 5J6GA 3JPXA 3ZDXB 1Z1WA 3DGCR 1FFTB 1L7IL 2IDCA 5E99L 4NPKA 1YEIH 1O6GA 4KZDH 1YJDC 2VR5A 3K2UH 1MW2A 4XXCC 5AYQA 5E9DA 4XC1H 1E27A 3QIUB 2QSVA 5C0CE 2O26U 4HSAC 1LO2H 3MUY1 2C1PB 4MAYC 4XNMB 3ZRFC 5I0XA 2AQ3A 2WP3O 3JVFC 3TBBA 5LHDA 4M1DH 5HYSA 5E6IC 3THML 1VYHC 2OVPB 3HE7C 4G9FD 4AGQA 1U21A 4Z7QA 1BJ1J 1FL6A 2VLRE 3QZBA 1DEEB 4UT7L 1NWOA 2ZCZA 4IIZA 4PRPE 3STLB 4YSQA 2OJYA 4LRIA 2X2JA 1TLKA 4J0XA 1IC7L 4J3OF 2E76C 4ZW3A 2BW4A 4Y4HC 1TEYA 4OBRA 2ZOLA 3IKCB 1BFOA 3T0EA 2DJMA 4G2AA 3HRZA 5DFVC 3V52L 2ZXQA 3VD2A 3DBXA 3FT4A 1OXYA 5GZNA 2EC9T 4A2HA 4AMKH 2BVQA 3O6FA 1SMAA 4AEIH 2R4RH 2IV9A 1DQLH 3F6IA 3LYRA 2J8UE 3PUUA 2D7PA 2MNWA 1SOXA 1OP9A 3ARBB 4L4TB 4PJGE 3CFEA 4V1DD 4XWOD 4J8RB 1A1OB 5LO7A 4CMMB 3UZVA 1JGVH 1RY7B 2V2WB 4JE0A 3V6FB 2XWZA 3GEFA 4XR8C 3TBYA 5IJ7E 4MJIE 1R3IH 3V95A 1WPCA 1N3NA 2X5PA 4OCYH 1KB5H 3HAEG 1YYLH 2NMSA 4NZUH 5GRWA 1OSEA 2WNGA 1G7HB 4PS8A 2HU5A 2YSSB 2AEOA 4RWYH 5T1KD 4XXWC 4XBGA 1KULA 2WC7A 1LE5A 3BAJA 4RZCB 4XN2A 4LOEA 2FCBA 2FHBA 3NCCB 3B9VA 3TESA 4X80L 4S0TD 2FWLB 1EA9C 4XX5A 4P2YA 5IHUH 4AEIL 2ZOTA 4RMTA 4XBEL 1J0KA 2HKFL 4QRPE 4KDTA 4ETQA 4R4NC 3T8XA 2E4TA 3K80A 1NWPA 15C8H 4AE0A 3HB3D 3N3EA 1U92B 1MIEH 1H8LA 2H1PL 1M9WA 3WTYA 3WN5B 3F58L 1HIML 4IOFD 1R34A 4F2MB 1MI5A 3APNA 4RMBA 3UJJL 4EN2A 1GGCH 2Z0BA 4YHZL 4Y8DC 5BS0D 4NZRL 4LPUA 3WU1A 5J1TC 3CXDH 3LNFA 3FTGB 5BOPA 3QNZB 3MRHB 4HK3N 2GW5A 5SX5H 2P9PC 3TNMB 3BPNC 1Z0NA 5B7MA 2AQPA 3IDNB 2I9TB 3HI1A 5HGAA 1MWOA 2VSCA 4PJAF 3CMGA 4EPSA 2VIRB 3R7RA 5IKCB 3UJIL 1EVTC 2VITA 4G6FD 5AOJA 2BNRA 5FXCH 3RFHA 2XTJD 2XETA 4WQOA 3RVWD 3VSUA 3TZVA 3CHOA 4PJHB 3BEVB 1BG9A 4POUB 3JRPA 4N0YH 4LLUB 1GC1C 3NRPA 2HN7A 1O7DC 1T5WB 5D96B 4DFHA 5LGHH 2WP3T 3ORJA 5IB4A 2MQCA 4LOUC 5K1NA 3EO9L 1W6WA 3QA3B 4B9ZA 4GRLD 2N1TE 1KEMH 3MLWL 5GS2D 2NTFA 4IBTA 4RFNB 2E6JA 2IPTL 1TTRA 4PJBB 3VFMB 3ARDA 3DX3A 4UBDD 5D1QB 1OP5K 1XXDC 5IB2B 3LB6C 2Z92B 2G9HA 3IDJA 4MDRA 1HSBA 2VDNB 5JOPD 3E3QE 1FSKC 4LQFL 5KSBE 3WUWB 3EH5B 1CFQA 1GGIH 1FFPB 3VXSD 1WA1X 2V9QA 4W9IC 3SDYL 5FGRA 3QCTH 1RIUL 1NINA 1WITA 4Z76A 4ZMLA 5AENA 2H3KA 2YBAA 1EAPA 3NCMA 2Q7AA 2R15A 5EMMB 3MRCB 2H6UA 1W91A 2AV7A 3RIAF 3VI3E 1HXMA 1M4KA 4JHNA 2DTMH 4O5LL 1EEQA 2ZSWB 2ZX8A 4M8UA 2EIMB 3RZCA 3V6ZB 2F7OA 4CZXA 2PWEA 4NDMB 5EU4B 5F7DA 5E6YA 4O2FB 2DKSA 2F74B 1DZ0A 1IC4L 3WLBB 4WI4A 4BWTA 3L4MD 1U91B 3ESPA 4R3SA 2NY6C 2ZSVA 3I74A 3Q6GH 4JM2A 3V4VA 4WFFD 2J71A 4BE6A 5BS0B 4U3HA 1NANH 3BT0A 1KJ3L 1IFRA 2ZUWA 1S7SB 3SGDH 3ATBA 4PYGA 4R26H 2CBMA 5F8RC 1E6JL 2GABA 2R2EA 2BIOA 5TPWH 3JT2A 1NUGA 3B2VH 3PE9A 4TSAH 1B0WA 3MV9B 4E9VA 2NDFA 4NUMA 2CUIA 2P45B 3L3OA 3UROR 5IB1B 2XA3A 4L4VA 3SDDB 2Q3XA 5I6PA 3EO1B 4P2OB 4WUUE 1NUNB 5IQMA 2N1KA 1E5ZA 2ZOKB 3MFFB 3NPSB 2RQ8A 3GHEH 3VFRA 1SLVA 2QELA 3EF4A 2I24N 2HUHA 5H14A 2WB1A 1X44A 1NL0H 1PX8A 2W91A 4MQTB 3D0LA 3PGDB 3WHE0 2CN2A 4ZXBC 4HUUB 4XBPB 5T5FH 4TSBH 4P2RA 4EOWH 3QPQD 4A08A 5ID0A 3QR2A 1T22B 1B6DA 5ICYB 2AJYL 5GRVL 2Z7ZA 2MPAH 2XG4B 4XNUL 5I1EL 4D9SA 3QJXA 5BJTA 3GXDA 2NR6D 4RLDA 4Y4HA 5I8EB 4LB8A 4IMMA 1PGRB 3CVHB 3MSPA 1OSZB 1RUQL 1MXDA 2VDPH 3TT3L 4JR9L 3WMQA 1BECA 4AL8H 43C9A 2Z1KA 4Y19B 3WTVA 3IKOA 1NDMB 3B6SA 1NIFA 2XN1A 4ONFH 3BSZL 3O3DA 2OCCB 2NR6C 5B1JA 5E23A 1QR1A 4C54A 1TVHA 4L8DB 4JPKL 5FKRA 4NZRH 3ZSTA 4DKAA 1SEQL 5SWQA 1KYFA 2G75B 5J13C 4JY5L 4P49A 4N85A 1A6WH 2VDNH 2YAQA 1HH9B 2CO6B 3BESR 3UTSB 1WGOA 1JZ8A 4WHTB 3UADA 4HIJB 3TF4A 4MCYA 2D73A 5L2JB 5IMLA 2BP0B 2BSRB 3BLPX 3DO7A 3VXMD 1I2MB 2E7MA 4Z8LA 3NABL 4KVCH 2W9EL 3EH3B 2ISDA 1I9JL 1YG9A 4OLVH 4HIIA 3DGDA 4LSUL 5T33L 3CFVA 3SDDC 3UIYA 3IN0A 3QJFA 4PV8A 2AGWA 4I9WE 5C0IB 3RFRA 3UTPD 4X5PA 4P5TC 2ATAA 1IC0A 1BZ9B 4PGJA 4JNXA 2P44B 1TZOA 2KH2B 2HX9A 3N85H 4NWTH 4ALAC 2VYRE 5D7KD 1NC2B 4LLWA 2AQ5A 4AYDC 3QZMA 3BJ91 5TEEA 1BFVL 2X4SA 4NN7C 3UABA 3D07A 4UWQB 3DIFB 3MCYA 1AXSB 3WFDL 3DVNB 3C75H 4GW4B 5MENA 2G2RB 1JF5A 2DBLL 5KJRL 1M2VB 5FYLL 4D7BA 3AABA 5EH1A 4ODBD 5DT1L 2XA8L 5D4HA 1GZHC 3NABH 3SDAB 3LNGA 2PCPB 4B9PA 3MJWA 2HRPL 3UVMA 3MRFA 1NCDL 4F7CB 1AXIB 2XG5B 4GS7B 1N8ZA 3F85A 1X5AA 2PWGA 3EYOB 3FO1A 3RIFF 1AYOA 2W60B 1X5YA 1YN6B 3QQDA 2PCXA 4QHLB 3SYPA 3SPGA 4PRIE 3RN1D 4A7TA 4XCFL 2BNQE 1BAWA 2X70B 4HPYH 3C8KA 4QQEA 4P23B 1T5XA 4HUKB 4HP5A 3RAJH 4V1DB 1CFNA 3PGCA 5DD0L 1USZA 2GJPA 4OKVA 4NP4L 5E03A 4N1CA 5EO0A 3SDDD 3T6VA 3QPXH 3Q5OA 1L9NA 2I85A 3B9EA 4BWUA 5J1SC 1A6WL 4OZHB 8CGTA 1U3HD 4JRYA 5CYKA 4LRNH 4W9CC 3ARFA 3FQUA 1T21B 4AG4H 1GS7A 3KYNB 2H45A 3F05A 1D5XB 2KBGA 1B0GA 3EYFA 3GKWL 3HC0A 2FSEA 1HHGA 5ID1A 2W0PA 2HWZL 4FOMA 4XNAA 3TS8A 2CM6A 1BVZA 1JXDA 1LO0L 1MVUA 4EDXB 1G4MA 1DJIA 1MHPH 1JGUL 3Q8FA 4TSBL 3ILPA 4GRMA 1EERB 5FUCE 2CKNA 5I1AB 3FCBA 4UQAA 3AS0A 3G6DH 1I1AB 3VFGH 1E4XL 4PY7B 5GMKn 2DJ4A 4NSKA 5DJ0A 4DP8X 2MEJB 3RZCC 3HI6L 1E5AA 4KX9A 3SDXE 3EI2B 3ARXA 1GJUA 3OJDB 4MS8D 3DVFA 3KE0A 1HL4A 3FO9B 5FYJU 4MX7B 1ZA6B 4J0WA 1V7ML 3HE7D 3WEMA 2OK6A 5DJ8B 1V3KA 5CCHE 3AS2A 3R0MA 1KCUH 3H4HA 4ZFGH 1RQ5A 1U8JB 4QRTA 4X0KB 1IEAA 3I75A 3TBSA 5KVGL 1A0QH 2GJ6D 3U2SA 3GTVA 1W0VB 2M2DA 5KS9A 4MXQD 1A12A 2AJSH 3NJVA 4PR5A 5HGHA 4PJ8A 2SEBB 1IZJA 3Q1SL 2CRMA 3B56A 3MBWA 2IQ9L 3GS4A 1XH3B 2EABA 3G6AA 2OVRB 2AJ3A 5TQ2H 2VW6A 1KN4L 3AQYA 4OM0L 1JHKL 1OAQL 2QSCH 2XZAL 4PJFA 4FZ8L 4KMLB 1UUNA 2H32H 5D7JD 3VWJC 3MRKA 4EDWH 4DKFH 1I7UB 2EJ1A 4RMRA 4K8RL 1TMCB 3ROOA 4KUZH 1OP5H 2EDYA 4K9EL 3VGEA 4R90H 4XYIA 1DFXA 2BC4B 4JHAH 2DQDL 3HMXH 1BYNA 4ZMWA 1IL1A 1T1YA 1QI3A 3MRBA 3V6BR 1TQCB 4BXVA 4QLWA 5MEPA 4L8CA 1QTSA 3CIAA 3QAZB 4WNJA 3GQFA 2DY2A 2HT2C 1BWMA 2GC4A 1UXSB 2Y7SA 3OLDA 4NM8L 4QHUA 2GAZB 1G7IB 1TZIA 3OAYH 1KIRB 2QBWA 1U8MA 5CEZH 3N06B 4I3SL 5F0MB 3UZQB 4RNRB 4GOSA 4H5JA 3CFDB 3NTCL 1Q9KB 2G3XA 3OAWA 1IAIH 1I8IA 3QCTL 4AKQA 1GAFL 4M9PA 4PRBB 1BYOA 5EU5B 3HHSB 2EZ0C 1Z66A 2B14A 4KAQL 4DP4X 2LU7A 4RETB 2P5EA 5IFJA 1H6UA 1M7UA 2FBJH 3MACH 1HK6A 1UFUA 2UY7A 4GBXD 4E36A 3F3PA 2H6QA 3OPZH 1AZBA 4ONOA 4EEEA 5IOPB 3EYVB 1GCYA 4L5FH 3GSWB 4MAYB 3N2JA 5B38B 5L4MA 5E5LA 4PRHB 4HCFA 5E6SB 1QACA 3O6MH 1QO3B 3Q2WA 4LP8A 1KEML 3MLWH 4PGEB 2C26A 5DJCA 5BW7C 2EIKB 4J73A 3WNNA 4HGWA 2IH3A 3STZB 4Z7WF 4FD0A 4UINL 5DC0A 3FU3A 5E9NA 3LPGA 4NI6A 2QJDA 1OCCB 2B4CC 3F7YB 1ZOXA 3EH1A 4J3OC 3TM6A 1XXFC 4RX4D 3RL1A 5CLYA 4ODVL 3A5VA 5DJZB 4JDEA 2CGRH 2H41A 4QOKB 1ZHKB 3OF7A 1RUKL 4ICXA 5FYKH 3FN9A 4QF1A 2PLTA 4AQEA 4R4FH 5M5TA 3L5XH 1U2CA 4TNEA 3P2DA 2F1BA 1IQWH 2V7NB 5AKRA 3UTSA 3LQZA 4TF4A 5J5EA 5E9AA 4Y7MA 4QRBA 3QIWC 4FNSA 2CIIB 3IBEA 4HCRL 3VNZA 1XD0A 2CIIA 5EZOL 4DVBB 1UOQA 3BIAX 1NCGA 3CD4A 3OGCA 5DEGA 2KZ1B 4EXKA 1WFTA 5H37H 3QRFM 1P1ZB 3MNMA 3O9WC 2OCJA 3KL0A 2R0LL 4YBLC 1XTLA 1MFCH 4JDTL 4QRRE 4Y5XB 2OL3A 4ISVA 5EN3A 5EUOA 5LG6A 1R3LA 1UWXH 4UQDA 1RURH 4MQ7A 5EDXA 3OJVC 4NX0A 3FB7B 2DDQL 4WHCA 4TUUA 4QXGH 4FI6A 1NDGA 3W0WD 4JS7A 3ZTNL 2W88A 2NY2D 4AW7A 1S7VB 2XRAL 3U79A 1XZ0B 4M4RA 1P9MC 5F7EH 1N6FA 1BQSA 4RVBA 3T4AC 1CTOA 3ECBB 4PSXB 2YR3A 1G1YA 4MJID 1XCQA 1R3IL 2W1NA 2YGQA 2JTDA 1DSFH 3VXPB 5K93A 5AW1B 5T3XD 2NCEA 1N68A 4OUUB 5JTWA 3UTTB 4FQXA 4UTBH 2A9DA 3MJ8A 2ZUUA 2YUZA 1T7WA 3N55A 4I7ZC 1LMKA 2R83A 2JB6B 5B7EA 4ADGA 4BKLA 5I8CA 4AQ1A 2NX5D 3OXRB 1ES0A 5DQDL 2E56A 4HAFA 4WRLA 1PKOA 5ECGA 4XMTA 1OP3K 4GUPA 1UM4L 3LXBA 4P3CL 1RULL 2IH1B 5F1KC 3L8QA 5IQ7L 3C9NA 3FC8A 4HJJH 3FN0H 4UV4H 3VFVA 3MKSB 4QRAA 1QPKA 1FI8C 1P5UA 3KXFB 4Y2OA 1F3JA 2CIKA 4MNQE 5HBBA 1KTRL 2COQA 4MQ7B 3HFML 4AJYV 1KCLA 1YEHH 4M5TA 2GNQA 1JV2A 1SJHB 4FQXD 1OGSA 5MI0B 4D0DA 3WAKA 1QWUA 4KI5C 4W1TA 2X4QB 4PHZA 2HVJB 1FZKA 2Y5QA 3CJJA 1CL7L 1GPOL 1Q0YL 3D85D 4OLWH 3BDYH 3CX2A 4H2AA 4Y1SA 1U2HA 4YDLB 1IFHH 2VZTA 2VDQA 1U58A 3BCFA 4M1DL 5I6NA 3LQAH 3JV6A 5T1MB 2K3HA 2APBA 4LDEB 4WKZB 2Y7NA 3J80g 2DYPA 2OTUA 3P3UA 3DUSA 4Y4FB 3B2UC 4PBXA 4R97B 4ZUVB 1Z2KA 4A6YH 1T7XA 2AV7B 1KJ2A 1FFOA 5FGBC 3L9RB 4L8SC 4G56B 3RY4A 1OAKL 5HGDA 3QRGL 4QT5B 2A9MH 2YMXH 2MCPH 1BOGB 4OVUA 3RN0D 1EJOL 4G6KH 3FRUB 4AYBA 4ZUUB 3NFPB 5GPRA 2YEZA 5HHQB 3HZKA 2C4FT 4NKOA 3RY6A 2VQTA 4N0CC 4FI7A 3SQRA 3BFOA 1JMZA 4G82A 1HHKB 2W18A 2XRAH 5K9KB 3I7PA 4EI5D 3GT6A 3VGBA 2WCPA 4NKDA 1QRNA 3KPPB 1GHFL 1CICB 3LRSB 4LSQH 4DKEH 4OZHE 3HG4A 2PCFA 2ADJA 1NJ9A 3P11L 2EDTA 4Q52A 5C0RH 3D30A 1I53A 2CQVA 4AGMA 3DWLC 5HGGS 4ODSL 2XOTA 5BNXD 5CBEB 4FMFA 3TO2A 2WXRA 1L6PA 5EZPA 3D51A 4D2NA 4GAJH 4N86A 5AOIA 2H6PB 2ITFA 2OTWB 3GHBH 5J11C 3T3ME 1R24B 4GQQA 1JOFA 3GIVB 2QXVA 3VDBA 4LCCC 5FYJL 4FQ2H 1BX2A 4F3FA 2H32A 3MBED 2AK4E 2R2CA 3AACA 3ILPB 4GRMB 3CUPA 4PLOB 3OKWA 3AH8B 4DZ8A 4C55A 3OD3A 4CKVX 1C9LA 4B9FA 4M61A 1HE7A 1X7SA 3MV8E 5DYFA 2YB8B 4NQSA 3KPOB 4YDJB 3PQYA 4PRDA 3S5ZA 1AR1B 1UD6A 3GZQA 3QDMD 3LN5A 4L8CB 3WSQH 1S9XB 2X1WL 3SQOH 5EORH 3MRQA 5TK4A 3KMDA 2CO7B 4Y16C 2YD6A 3M1CA 1QA9A 1MIEL 5CYKB 4JAMB 5FYLE 4Y1AB 3DXMC 3B2MA 4P05A 5D72L 5ERWA 3OKDA 3KPLA 5DI8A 3LH2L 4CY1A 2QHLA 1RJZB 3SBRA 3NG5A 1KTCA 5FX3A 2JH2A 2Y23A 4QRUB 1JZEA 3PABA 2ZAHA 5EOCL 4BZ1H 2GBTA 1DO5A 3F7PC 3O4JA 3T6WA 1UATA 4OCWH 2F8VA 3I6GB 3QFJD 3BIKA 1OE3A 4P46A 2D8KA 1FYTE 3FQXB 4XYHA 2XQBH 3J2PA 1Y6KR 4OLUH 5BVPL 1J5CA 4JFDE 4KKPA 3UTTA 1FG2B 5GRXG 3A22A 3LQAC 4NO0B 2QV4A 1KCSH 2D7OA 3H9SA 5HGHB 4GMBA 3TBYB 4NNXB 3VJ6A 3ZKMC 2O30A 2ITCB 2H14A 2XG5A 1W0VA 2Y5EA 2A6IA 1KXHA 3JUZA 4DUWA 2YUWA 3OR7B 5T3ZL 2OW6A 2OXGA 5C6TH 3JQOB 1OO2A 4PJEF 2XTLA 5EIIB 1E6JH 1H2ZA 3HG5A 4J87A 2XKUA 3ULUD 2WIIA 3EDJA 4RDQG 4MKMA 4QJ3B 5LDSA 2AEPH 2MOGA 1YUHB 4DN4L 3ELQA 3N1MC 4KY1H 3RRQA 2KZBA 2WBKA 1MN4A 5LNEA 4Z3HA 1TJIL 2EE0A 2X4SB 5I30L 3PS6A 2NY4B 2BCKB 4AE1A 5TF2A 4NHCL 1EFXA 5D2LB 3KWXA 1J8KA 1ML0A 2OPCA 3GJFH 3EAKA 5DEZA 1R5MA 5CSZA 1KBVA 5IF0A 3E2HC 4PJDA 1G7JA 4BYHA 2HU8A 2OMYB 3DVIA 1ZV5A 4PWKA 1CD9B 3V4UL 4H5SB 4E5XG 2X4RA 4N2BA 5MP6H 5I9QB 1AGBA 3DX9B 4HIIB 3KYMB 5AOZA 3T0EE 3KVPA 1Z6JT 1SGKA 4BUQA 5DHVH 3T0ED 4PJ9A 4J28A 5C1MB 1OGTA 1WWWX 5DA4A 2HYMA 2P5ED 1U8QA 3MYJA 3PHQB 3LB6D 3FQUB 4I77H 1E5TA 1H8OA 4PLJC 3LH8A 2WXPA 3FCUB 1UJ3C 4ZBJA 4CVUA 3L7FB 3WJLA 1IM9D 2XKSA 5EU3B 3DWTA 3RWDB 4O5LH 1VAHA 1KYAA 1QSFA 3ULUF 3ZDXA 3FB8A 4PMFA 1FPTH 2FEJA 3TOPA 3EDEA 2I7OA 2NUPA 5CO1A 2BWIA 5H35B 4GQ2P 3IXTB 1BP3B 4KKBD 5DRZA 3TBVA 3C60B 3IJ0A 3HG1E 5F9AC 2UZIL 2YPLD 1LEKA 4NQCB 3N85L 1I8LA 3SE4C 4P2CG 2AERT 4LCIL 2NY0C 3EI1B 2YGPA 1GL4B 2ORBL 4YDIH 1IAIM 3L2LA 5DJ2B 5EUOF 1F6LL 2GTWB 3E8UL 3B6SB 3CN1A 3A6CL 2NW3B 3F3GA 2HESX 1MWAH 2EYTB 4GW1B 2WBJB 2PKDA 4MAYA 4Q2ZA 3NCBB 3G6JB 2WQ8A 3EYOA 3A47A 2FZ3A 2D31B 3ZTEA 3RYMA 3W9DA 2QGCA 4DNLA 5JHAA 5AL8A 2PO6D 5IFJB 1KYOJ 5M5VA 1MNUH 3HZYA 1QSZA 3GM8A 4QTHB 4FXKC 5CP7A 3WNMA 2W95A 3RFZB 1ERJA 2X9YA 4OZGA 2YS4A 1EZLA 4IJTA 3CFDA 2CUHA 5I1GL 5GISL 5I2IA 1N0XL 2EVIA 3PWPE 1ETZB 1AXTH 2X1OA 5GIRB 3U7WL 3VVWA 3QQ4B 3CFMA 4NWTL 4F8QA 3DBSA 1KCRL 1DBBH 2EYRA 1TFHA 5DRNA 2DQCH 3QUZD 1IEBA 4NQCA 3WNKA 4EZMA 4W4OA 3PDDA 3SKUD 4K73A 2HSIA 3CBKB 4CVZA 1CL7I 5E9DD 4BH8A 1RI6A 3KL5A 1U3JA 2OI9B 2XNAB 1A4KA 4LFHG 1KB5A 5KJRH 3NVXA 5AVQB 3MRBB 4KO6A 5HI3C 2WQVA 1Q9LA 4ZZKA 4AYSA 2E7LA 3BXNB 1AC6A 4DQAA 3AW5A 3GSNL 2WQXA 1EX0A 3HNSH 4Z7VB 3X2QB 2EDWA 3K71B 1B88A 1I7UA 2APXA 4P5SA 2QR0B 3S3SA 3GFUA 1YPZB 2GJZA 3EYUH 3ZN6A 3LHPH 4JO1H 5TF1L 5EALA 2W80C 3LKPB 1X6LA 2HJLA 1HH9A 2BOCA 1QFWI 4N2HA 3UAJC 4Y9FA 2I0TA 4XBMA 1KCSL 3LRHA 1GIGH 6TAAA 2CDEA 1XH3A 2ZICA 3R8QA 4P2QB 2N0MA 4JQXC 4XPBL 4ELMA 4QCIA 4ZPTA 3ZZSA 5AJAA 1JZGA 3B2UD 3FW6A 2XQYA 3RU8L 1JJUA 3QEUB 3ARGB 2AGJH 2WVSA 4LVNB 1OMWB 4AN1A 3NEEA 5D2NA 4FULA 3D08A 3RWIB 1XF2A 4PB9H 4Y5XC 1IM3B 5SX5K 2KHAA 5E8OA 2WQWA 4K9JA 2Z1PA 3BAEL 3E6FB 4QRRB 4EZKA 2O4EA 4JQIA 4FG4A 3ULVL 4EI0A 4GMSH 3DVGA 5EIIA 4GP5B 3HBGA 5ITBL 1EJFA 2FGZA 5AMSA 1K85A 1CICA 1QTYT 1E8YA 2YXFA 3TBCA 3VXUA 4PY7A 5JXAH 1G9EA 1GJWA 4WFGD 5IWLA 1MLCA 4V2CB 4IBWA 5DU7A 3DROA 3IS1X 4Z7AA 3F6JA 3MUUA 4QTFA 1XZWA 5D1ZB 4Q8BA 4AQAA 3CSGA 1S46A 4F37F 5KW9L 2NDGA 2MH4A 3AXLB 3IETA 3MOBL 2RJMA 5JW4M 1JOIA 2ZIDA 1MVUB 4QRPB 4EDXA 4ECNA 2NNCA 2HKRA 2J56H 2QQLH 5I23A 4JCWA 5I16B 3C2AL 5H94A 1CIUA 2DEYX 4B3VA 1G7MB 1X7TA 1NCCH 1MUJB 1M7DB 4Z9KB 3V0VB 1MCRA 4GW1A 3FRUA 3L54A 1MDTA 1RUPL 3TL5A 2VDLH 3OKMB 2VIRA 1JWMB 4JB9L 1UC6A 2XX1A 4N3UA 3HMWL 1T6WA 4B9CA 1RJLB 1RPKA 3HC3L 2WWKT 3EI1A 2CXGA 5BZZA 2WTRA 4CN1A 5KZCB 1NUDA 3ATEA 3ARZA 4L3AA 4MJIB 5EO0B 4NC0B 1UT1A 4APQD 4PRDB 5TFSL 1U91A 4R3SB 1D6EB 2IBZY 3UPAA 3LV3A 4A2MA 3ZO0A 4YPGB 2YBGA 3QQ3A 2VDPB 3MA7B 3R18A 3RUGF 3O45A 3UGUA 3MO1B 2H32B 4DPAX 4H4NA 3BSGA 1CQKA 4P2RE 4WY7L 3H6AA 4PJ9B 4IOFC 2DL2A 1PKQA 5T5FL 2C8NA 3T8XB 2JI1A 1O9VA 4IYKA 1IAOA 3PVWB 1JGIA 2H0EA 5ALCH 4LLAA 4LIQL 5EU7E 2VZUA 3RHWK 1JHLL 4LSDA 2Y07H 5H2BB 4W68A 4ZMNA 2PPCA 1D5ZB 3A24A 3D6GA 1E8WA 1WZ1L 3LZPA 3APDA 1TQTA 3CN4A 4ZO7A 1C9SA 4FL4B 1X7QA 2TSBA 3L81A 3MBEA 5AVTB 1UA3A 4GQPH 2B1OA 2W9DL 1HSBB 2VDNA 2FX9H 1DN0B 3HS0A 2OMVA 1RK1B 3QZWG 4MQSB 4E9LA 4GUQA 3HNTH 3ZYJA 3QFDB 1FZJA 2AGZA 1YRKA 1XB8A 2OX5A 2HFFA 3HZVA 2XX0A 4U2YA 2DQGL 3S96A 1NJ9B 2PCFB 2VXSL 3R0NA 1T0OA 2K6ZA 4PJHA 4U05A 1EEYB 4M7LL 2F19L 3CVIL 2IBBA 4M56A 4CJ0A 3REVA 2BVQB 3O6FB 4KZEL 5T3XL 4HF5L 4ZQKA 1F42A 3C2AH 5F7WC 5K69A 3G7TA 2WZPD 1MHCA 1RZKL 4OJAA 4PLJD 4E9WA 2VDQH 4XN8A 1YN7B 5B4WA 2CHWA 3P54A 4PJDF 2EXYD 4FMVA 2ADFL 4S1RH 7CGTA 4DNUA 2H1XA 2E7DA 4LHUA 3SE8L 2FO8A 2DYPB 5ENWA 4ZMAT 3HC3H 2UWEE 1HJCA 3FTGA 1QFSA 2FYVA 2G0LA 3F5WB 1MFAL 5HDBB 5GXBB 2VDRA 5GRYA 2QMKA 4KV5F 4LPYA 1I85C 1HZHL 2CJSA 4DGYL 1A9BA 1CT8A 4I1RA 5CSBA 3P4NA 1WFMA 2EECA 2E8ZA 3H9SD 4PBVC 3WGVB 1VFOA 2FWSA 3RGVB 2XN9E 1A7OL 1CLOH 7TAAA 4F7EA 5MENE 2E9JA 4UTAA 4KFMB 1E67A 3WTSA 4N6RB 1KYOK 3ULAB 1AQKH 1ZE3H 1VFAA 3CU7A 3I84A 2D03L 3IKKA 5LGJA 4D0CB 2ARJQ 2OMWA 3DK0A 4F33B 2YAPA 5AB0A 5IJBC 5I6LA 4JFZH 5FCSH 2IV8A 1T3FB 2PO6B 4UQBA 2CBPA 3VWKC 5IEHB 3VB9A 4I2XE 3MV01 3CFJB 2FUTA 2X4NB 4M93B 2EIJB 1FBIH 4UTBL 3PHSA 2FLBT 4FDWA 4YZWA 1SEQH 3K5SA 2W8CA 5DJCB 1I8LC 1BAGA 3SE4A 4F5CA 5JYLA 3BLBA 4LLYB 2AQSA 4RA0C 5L4FA 1BIHA 1R24A 4D9LH 2EDQA 1XWVA 1KJVA 2J1KA 2Y7LA 4BXSV 4OUUA 3WY4A 2VZOA 4JZOA 4P9HH 3KPMA 2QQLL 1BM7A 3AROA 3V6FA 2V2WA 4P3CH 1JHTB 1DBKH 1NCNA 1YDPA 4M4RB 5IB1A 5EF1A 1G7QA 3HCVA 3O11A 2Y0SA 3TVMA 5AFAA 4TV3A 3VXTB 3U0WH 1KB9J 3HMWH 3ZSSA 4S0HA 1IEHA 3D0VB 2VLKA 1LYQA 4ZFQA 1A7RH 1VEOA 5A2KH 4Y5XA 2J1WA 3NSJA 3PNRB 3DXAD 3GMOA 2Y7OA 3C2SA 4G59C 4HDIA 4F91B 1ZTXL 1T89A 3QJHB 4MZ3A 4DEPC 2X6MA 5AVVB 4Y5YA 5HI5D 3QNFA 1XIPA 2VNCA 4LOFA 1TZIB 3UEZA 4NDMA 2BNQB 1WQVT 3L3KA 3VI4A 3MV7D 2NQCA 2VQ4A 4BRJA 1WUNT 2F08A 1U6AH 2H4EA 4WWOA 5FKSA 3NSXA 4XTRD 5IVZB 3UMNA 1AZUA 2K1MA 2VMEA 5E2JA 5MEPB 4R6UA 2WN2A 3W0WB 5EZJA 3LKNA 5F7FA 4KFMA 4P23C 4BQBA 1Z9NA 1U33A 2L7JA 3MNZB 3SDXA 4OB5H 1U8HA 1ONQA 4M8VA 2FQDA 1LO2L 5I26A 4U1IA 4XNMA 2FK9A 1UVQB 4BQ9A 3DV6B 3CPLB 3W15A 3ZKND 3GDBA 4JKPL 3GK8L 4F58L 4TRPH 3QUHA 3BSHA 4LVEA 4UZUA 4KHXH 1FNAA 3PXHA 4A2LA 2QKSA 5HJDA 3QQXA 1KJ2H 2DJUA 2NUTA 5EZOH 3UBXI 4KK9D 4ELMF 1L9MA 3TGXA 2IG2L 5J6GB 4HCRH 1QBBA 1A5FL 2QADB 4BH6A 4U6HB 4QPEA 1X9QA 1UXWB 2WJ7A 4HGWB 2YRBA 4FQHA 5HHME 1X4YA 2Z31C 3NCYS 5C08B 5HTSA 2AI0L 3D69A 1I1FB 2ZONA 3V8OA 5D1XB 2CDFB 3CDGA 1PMYA 5DR5H 1MH5A 2MCMA 5DJAA 5IB4B 1CDUA 2NYYD 1YDPB 3I75B 4Q0XH 4C56D 5LJYH 1RI8A 2ZX7A 5IFAL 3H3KA 5D6CA 4PJAA 3G04A 3STZA 4OJEH 3UFIA 2WMPA 2A9CA 2LLLA 4GI9A 1TTBA 2VITB 5IJCC 5MHSD 3K26A 1SQ9A 1S7QA 2YPLB 1UTDA 2DQFA 4U4BA 3FUDA 3WDJA 4B60A 3EZJB 4OT1H 4X98A 4XO5A 1II4E 3F7LA 3PRZA 1XSIA 4XX1G 5AKSA 3V0HA 1QI4A 5T1KB 1IM9B 3VXPA 3NACL 4G72B 3TJEH 3T3PA 3G5YB 2UWEB 1IGIH 3BKCL 3UBXA 4PJXF 1XZ0A 2EC9U 4PRHE 5IMKA 3MLRH 4G9FA 1EUUA 1G6RH 4F2MA 3TFKD 2PBIB 3EJTA 3CFCH 4PRBA 4S1SH 3IDYB 4PU2A 1MFUA 1HINH 2J1ZA 3GIZL 4PP2B 5FB8A 4IIQB 3W82A 4J2XA 1T21A 4LGNA 1AGDA 3FT0A 4RFEB 3KJ6L 5IJVA 5T1JA 4NBMA 3RGVA 2OMZB 2QQKL 5AUMB 1K4CB 3JXAA