3SBRA

Pseudomonas stutzeri nitrous oxide reductase, p1 crystal form with substrate
Total Genus 174
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
174
sequence length
581
structure length
581
Chain Sequence
QKIHVGPGELDDYYGFWSGGHQGEVRVLGVPSMRELMRIPVFNVDSATGWGLTNESRHIMGDSAKFLNGDCHHPHISMTDGKYDGKYLFINDKANSRVARIRLDIMKCDKMITVPNVQAIHGLRLQKVPHTKYVFANAEFIIPHPNDGKVFDLQDENSYTMYNAIDAETMEMAFQVIVDGNLDNTDADYTGRFAAATCYNSEKAFDLGGMMRNERDWVVVFDIHAVEAAVKAGDFITLGDSKTPVLDGRKKDGKDSKFTRYVPVPKNPHGCNTSSDGKYFIAAGKLSPTCSMIAIDKLPDLFAGKLADPRDVIVGEPELGLGPLHTTFDGRGNAYTTLFIDSQVVKWNMEEAVRAYKGEKVNYIKQKLDVHYQPGHLHASLCETNEADGKWLVALSKFSKDRFLPVGPLHPENDQLIDISGDEMKLVHDGPTFAEPHDCIMARRDQIKTKKIWDRNDPFFAPTVEMAKKDGINLDTDNKVIRDGNKVRVYMTSMAPAFGVQEFTVKQGDEVTVTITNIDQIEDVSHGFVVVNHGVSMEISPQQTSSITFVADKPGLHWYYCSWFCHALHMEMVGRMMVEPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Nitrous-oxide reductase
publication title N2O binding at a [4Cu:2S] copper-sulphur cluster in nitrous oxide reductase.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 174
structure length 581
sequence length 581
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.7.2.4: Nitrous-oxide reductase.
pdb deposition date 2011-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
A PF18764 nos_propeller Nitrous oxide reductase propeller repeat
A PF18793 nos_propeller_2 Nitrous oxide reductase propeller repeat 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3sbrA02
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3sbrA01
3PSLA 1MZZA 3KW8A 2P9PC 5EHFA 3RN1D 3OTTA 2HYEA 3J81g 1RCYA 2YAFA 4NSXA 3HEIB 4KO9A 4X63B 3NJLA 5HE1B 2JKWA 3QJRB 4KOBA 3EH3B 5ANHA 3ABGA 4A08A 4G72B 1N6FA 4A2DA 2H3XC 4AI7A 2E86A 2IAAA 3I89A 1L9QA 2A3TA 5IY5B 4U1EI 3RLMD 2HKRA 1JXFA 2J55H 3TBCA 4DPBX 2UZXB 4JSNC 4ZOYA 1SQ9A 3EI1A 2FT7A 4A09B 2PM9B 3I7HA 1X9RA 3FM0A 4D6VA 3T9WA 4DPCX 3SCYA 1JZEA 2VW6A 4YVUA 3CFSB 3V7DB 5I5JA 1GG2B 3EI1B 5C2WB 3FSVA 4PXWA 1AAJA 1OOWA 2GC4A 5C9ZB 2EIMB 2Y69B 1B9YA 3JAMg 1SF3A 2Z2NA 1A65A 4ENZA 3FU8A 4NAJA 2EINB 4HCGA 4DPAX 2RACA 2QDWA 4GQBB 1E30A 3N0EA 1ZIBA 2JFCA 2ZWNA 3RSEC 4GGDA 3BG0A 1QLEB 4KOCA 2OVPB 2IDFA 1OE1A 2GI0A 4HCFA 1HAUA 2IAAC 3CVCA 5AFU3 3GFCA 3ZDWA 4HZ1A 2GC7A 4J81A 4YSEA 5H17A 1IBZA 2CO0C 3RMZD 4GM9A 2BP8B 4ERQA 1L9TA 3IN2A 1URIA 1GP2B 3V9EA 1SHYB 3FPXA 3C5MA 1GY2A 2X87A 2CNXA 2OVRB 3CVBA 2PPEA 1ERJA 2P9SC 1XHMA 1PGUA 3PLYA 1KBWA 3TBBA 4Q8BA 2P9KC 3L4OD 3ZX1A 4JSXC 1NIBA 3T6ZA 5FKSA 4CZYA 3DXKC 3IKOA 3EH4B 4E9WA 2JXMA 1W6WA 1FWXA 5PCYA 2PCYA 1A3ZA 3DKHA 3OL2A 3PXWD 5EMJB 4BL0A 2CBPA 4J78A 4CC9A 4FAND 4YVNA 3VH0A 1KYAA 3OL2B 1FFTB 2GC7C 3N0DA 1PZBA 5D4HA 2VM4A 3F3FA 2OVQB 1PCSA 2VSMB 1JXGA 2CN3A 3PSCB 4H5IA 3RN0D 5FLXg 1TKWA 3JZGA 5AMSA 3NVNA 1JOFA 2AGLA 3NP3A 1VYHC 1MG2A 1HAWA 2IDTA 2J57A 3MBWB 3FT0A 1PNDA 3AY2A 2I0TA 4QT8A 1EZLA 2XYBA 1OF0A 3RFHA 5AKRA 4DP7X 2J57G 3P4FA 3FQYA 2ZONA 2YMUA 1DZ0A 2R7EA 5B7FA 2AGXA 2H13A 1U4CA 3I8CA 3UR4A 5EARA 1AZBA 2XUWA 3JRPA 1PY0A 2UXTA 1OCCB 4TXVB 5LDUA 2MTAA 1B3IA 5B4WA 4PNKB 3UVMA 5C2VB 3NJFA 4F2EA 2OV0A 3T6XA 2AGZA 4O1QD 3VA6A 3X2QB 4BXSV 2PPFA 3NSCA 1HFUA 3NVQA 3QQXA 1M57B 2XWZA 2IUVA 2J56A 4CY2A 4J84A 1SHXA 1AACA 2UXFA 5A7EA 2H47A 4FA9D 3FSAA 2BO0A 2CUAA 4KNUA 1JOIA 3PXLA 1E5YA 3UAEA 2HLEB 2PP7A 4F7KA 5B1BB 3GXUB 3IIYA 1PNCA 3IBOA 2H9LA 2H6NA 1NPNA 2OK4A 4LG8A 3L45A 2DYSB 1KCWA 2BHFA 3DIVA 7PAZA 5TK2A 3SN6B 2PP8A 2YXVA 4DP2X 3ERXA 1V54B 1JZGA 3AG2B 2PPCA 3UACA 4FAAB 2IDQA 5K1CC 2GB2A 4CSZA 3RYMA 3EI4A 2OJ1A 4YSAA 5TEEA 3BQVA 1PLAA 2BWIA 1U2VC 2UZYB 3SJLD 2H9NA 1UATA 4CSPA 1OMWB 3B7FA 2WO3B 5I6KA 1BYOA 4JSVC 4ZOXA 3I7LA 4DP5X 5EAPA 2XL2A 2LLNA 2J55A 3WIAA 2YAPA 2GHZA 2J56H 1PMYA 2P9NC 4CY3A 1TYQC 3DM0A 4CZXA 1BYPA 2IUPA 4FB1D 1AS6A 2HZHA 1IKOP 3ABLB 4YSDA 5IC7A 4HIPA 1ILSA 5AFAA 3X1GA 1OV8A 4J73A 1SF5A 1NR0A 1F56A 5I6MA 1P22A 3E0CA 4DP8X 3AL8A 4GXFA 1R5MA 1AZRA 1CYWA 4J86A 3EI3B 2IWFA 2HRGA 4QQEA 4A0AB 4GQ2P 2FQFA 1KDJA 4G70B 4XEIC 4HHWA 1J9TA 1GYCA 1NIFA 4FWWA 1QNIA 1X9UA 1WAEA 1IC0A 2Z2PA 2H6KA 1AG0A 1AIZA 3IEAA 3NSYA 4BH6A 4A08B 4A09A 2CJ3A 3F3PA 5E9NA 1J5CA 4BXVA 4ZOVA 2BZCA 1A0RB 1ASQA 5I26A 4J8BA 3MZKA 3X1EA 3OMAB 2VM3A 1NIDA 1OE2A 2YQBA 3I7NA 3NJMA 3PAVA 4BDVA 4J87A 2BW4A 5IJ7E 2IWEA 3JZNA 2I7OA 2HJBA 3QPKA 3MX0B 1WA1X 4A2LA 3D12B 3C99A 1E67A 2EBSA 4J79A 2N0MA 3PCYA 3JTBA 2QPEB 4E9XA 4G7RB 4HHGA 3U4YA 1IBYA 2EILB 3S3BB 3I7PA 2XU9A 3H56A 4KNTA 3JZHA 4PSWB 3UKUC 3GYRA 3NJNA 6PAZA 4OZUA 2FQEA 1MG3A 2PM7B 1JVLA 1CURA 3RFGA 1JZFA 5CXBA 5EAMA 4BUJC 3KRXB 4HAKA 5TDHB 1SNRA 4GY4A 3WG7B 1L9OA 3QJVB 2BW5A 1GS7A 4DP6X 5B3SB 3PXSD 3DSMA 1CC3A 5HYNB 1W8EA 3MXXA 3JROA 4Q89A 1N6DA 3SMRA 5GXHA 4J8GA 2GC4C 1Q47A 3AG3B 5JWZA 2YNOA 3NJGA 4AKQA 1FA4A 4JD2C 4BK5C 4JT6C 2FT8A 2H5UA 1EHKB 2VW4A 4GP8B 1ILUA 1IUZA 4ZOZA 4E9SA 3AL9A 4N4YB 3V9FA 3FYIB 3I2NA 2W88A 1KGYE 5FC9A 3N2JA 1MG3C 1PZAA 1RZPA 3C75H 4R7AB 3SHFA 4A2GA 4L3GD 1R1CA 5B1KA 3K26A 4X61B 3X1BA 3K27A 2W8CA 3EMHA 1XB3A 5B1JA 2WSDA 2YNNA 4N14A 2XV0A 3VGZA 6PCYA 5IJ8E 1GS8A 2IH9A 1ADWA 2I0SA 1SFDA 1WS7A 1YLBB 4HCIA 2HX8A 4KO7A 2I3TA 1XB6A 3H4HA 2DV6A 2PPDA 4GM3A 2H9MA 4J82A 2XYIA 5I6PA 4E9QA 3G5WA 3RRMC 1XB8A 2XV2A 1WS8A 4M4RB 4FAVD 3SBPA 3NSFA 3I8EA 5GMKn 4PCYA 4YSRA 1SFHA 4FHLA 3UVLA 2GBAA 1NDTA 1TEFA 4J0XA 4L3HD 1PEVA 4FA7B 5A2Qg 2CE8A 5I28A 2BBKH 4FA4D 5SXMA 4G71B 2R7EB 4J77A 1A4AA 1JVOA 5EMKB 1ETJA 2ZXWB 3UVKA 2UX6A 4YSOA 3GDCA 1J9RA 1MG2C 5I5IA 5CXCA 3NJIA 4QKTA 3WNJA 4TZ4A 3MZLA 3NVXA 5THAA 1J9SA 2BP0A 3WNIA 4AX3A 2FJSA 2P9UC 3DXMC 3A0FA 1PLCA 1JERA 3ASOB 3N55A 1N68A 1ID2A 2CALA 4W1TA 3IJ0A 2TRCB 2BP0B 1V55B 3SQRA 2QC5A 3OQRA 4GQ1A 2PLTA 5D4JA 2CCWA 2YAQA 3X1FA 4LGNA 4AOWA 3EF4A 1SHWA 4CY5A 4IA9A 5IT9g 4PBZA 5I5MA 1JZJA 1A8ZA 2X88A 2YAOA 1M9WA 1NTDA 1YFQA 4CI3A 1K8KC 5IGQA 2DWSA 4EF3A 1QHQA 4FA1D 2EIJB 3QJQB 4CY1A 4DP0X 3WI9A 3IE9A 1OCRB 1L9PA 1SJMA 2AZAA 2NRDA 4JHUA 4NB7A 3UABA 2YNPA 5HQGA 4E5ZA 4HDJA 2IWKA 2HESX 1KBVA 1V10A 5EMLB 2PBIB 5EALA 3FSZA 4E9TA 3AZUA 4BWWA 3UVNA 2H47C 2WO2B 2ZOOA 5AZUA 4N8UA 2AH1A 3EI4B 3ORVD 3NT0A 1OLZA 4GMBA 5H14A 2I85A 1AOZA 3W15A 2AH0A 4YSPA 2AANA 3CIKB 3WKQA 3SLED 1PI6A 4JHVA 4HALA 2I0RA 2W18A 3L4MD 2P80D 1N6EA 1GR7A 4JKNA 4YSSA 8PAZA 4E54A 2AZUA 2I3SA 3ODTA 1I53A 4KNSA 4ZK8A 2B5NA 1RI6A 3JB9L 4G7SB 4AKOA 1XKSA 3NJKA 2PCFA 4OWRA 3OKYA 2HX7A 5I6OA 1PAZA 3S3DB 3SWSD 2YXWA 3FU9A 2GNQA 3T6VA 3UAAA 4U7AA 3OMNB 2I7SA 1AQ8A 3EI2A 2XLLA 1MDAA 1PZCA 2FWLB 3NP4A 4Y5RD 1J9QA 2DY2A 1BAWA 3AL8B 1KCBA 4UF7C 1J5DA 1GSKA 4DP1X 3IJ1A 4A2FA 3FRXA 5H1MA 3EG6A 1BEXA 5D4IA 5F7BA 3UGEA 4A11A 3DWLC 4A0BA 4F2FA 5EM2A 2H3XA 1JZHA 1BQKA 1NWOA 4A11B 4ESGA 4A2MA 4A0BB 5TEFA 2PM6B 2BWDA 1BXUA 3JT2A 2OK6A 4YSQA 4QL1A 3EU7A 5FQDA 5HE0B 4I79A 3UVOA 2H9PA 3PVUB 1K32A 2QXVA 4GYBA 3SVWD 2XU7A 3PAZA 4BDVB 3EWEA 1CYXA 4QLWA 4K9JA 2P80A 3F3GA 3FGBA 3FPYA 2VMJA 7PCYA 3C75A 3C9CA 3SFZA 4GZ8A 4E9RA 2OIZA 4UI9R 4UAHA 1MDAH 2HXCA 4AZUA 2HKMA 1GW0A 2FT6A 1AZCA 4FA5D 2PPAA 1WA0X 1NEXB 3TASA 2PM9A 3IJCA 2XV3A 3KRWB 5HE3B 2CO0A 1KDIA 2UX7A 2UXGA 3V9CA 3ASNB 2YBAA 4L1QD 4CI8A 3ULEC 4ERYA 3T6WA 3JPXA 4P5SA 1L9RA 5B7EA 4PBYA 5CXBB 4D0KA 5K19A 4PAZA 3KW7A 1BQ5A 2H68A 1L9SA 3FSWA 2XXFA 3OKTA 2VW7A 3NSDA 2DWTA 2Q7QA 5TK4A 3I7OA 4P5RA 3FQ2A 3S8FB 2HX9A 3CVDA 3PAUA 2FQGA 4WKXA 4KFMB 3CFVA 2Q9OA 2TSBA 3WKPA 1ASPA 3ABMB 2XXGA 3UADA 4E9YA 1SQJA 1TBGA 4YL4A 2BP8A 4O45A 3EHBB 4YVDA 5I6NA 3SBQA 2H14A 4X4KA 3OD3A 2OCCB 5CYKA 1GS6X 2CN2A 1ZDSA 4K3JB 4G7QB 4EWRA 1BQRA 2AGYA 3AG4B 3CZUB 3OMIB 4JT5C 3BVDB 1JZIA 5CYKB 4LG9A 4GGAA 2GIMA 4A7JA 4GP5B 3PVWB 1NIAA 4YSTA 2DYRB 1OCZB 1TEGA 2O9KA 3EH5B 4E9VA 1JXDA 2BZ7A 4YSCA 1RZQA 2B5MA 5EMMB 2QDVA 1ZV2A 4RH4A 5TF2A 2B3IA 5KDOB 2AVFA 3AG1B 4XYHA 3OW8A 2XL3A 2YAMA 1NICA 2YAHA 4WTQA 1A4CA 1AANA 1GY1A 1GOTB 2Y1AA 2QPDB 2G99A 2TSAA 3QJUB 3SBRA 2G9AA 4A68A 2HJ4A 4DP4X 4O9DA 3ZWLB 3OKWA 3OM3B 3HFQA 4BWTA 1WA2X 2XX0A 1B9XA 1XIPA 1AG6A 1L0QA 4PC0A 4CI2A 1ET8A 2GSMB 5B1JC 5PAZA 2B08A 1E5ZA 4BWUA 4UANA 1GXRA 2VSKB 5B1AB 3PE7A 1AS8A 2IUQA 4Y7RA 1JJUB 2J5WA 1OE3A 2BCJB 2EIKB 5F7AA 2HXAA 2YB8B 5FA5B 1RKRA 1XMEB 4QRJA 3GREA 1BXAA 1JMXB 3ZBMA 3TA4D 4K3ID 3ABKB 3BG1A 1PBYB 4IMMA 1NINA 5CXCB 3CDZA 1AR1B 3UKRC 4AEZA 3QJSB 3S3CB 5B7MA 3PPSA 4CZVA 5GSAA 1M56B 2QT6A 4A2HA 4XYIA 5AJAA 3CDZB 2XX1A 2UXVA 3S8GB 3QJTB 2YAEA 4W9ZA 1AZNA 1ET5A 4DP9X 4YSUA 5I6LA 3MKSB 3NJJA 3H4FA 2IDUA 2Q5BA 3X1NA 5IGOA 1PF3A 1ZPUA 2AQ5A 3BWSA 1SDDA 3CG8A 2CE9A 1NZRA 1SDDB 1MZYA 4GM8A 2IDSA 4CI1A 4PSXB 4E5ZB 4JSPC 2VN3A 4GP4B 3TU6A 2HRHA 2MRYA 3T71A 4A67A 2H6QA 4L9OA 5FKTA 4O3UB 1OCOB 4ES0A 2FQDA 1S4UX 2P9LC 4KO5A 2Z2OA 3MMYA 3PXTD 3V5WB 1ET7A 4X3EA 3NJHA 1E65A 4O3TB 3FS9A 1TU2A 1VLXA 3FYEB 4G56B 3IIWA 3DTUB 4KO6A 2AFNA 2XVBA 3HB3B 4MFHA 4E54B 3FQ1A 1W6LA 3AFCA 4JXMA 3FU7A 2AGWA 4ERZA 4A66A 4L0PB 3J80g 3ZIYA 2B5LA 1AZUA 2FNWA 4NERA 1NIEA 3OKYB 2MTAH 3FU7B 9PCYA 2IURA 1CUOA 1NPJA 2CAKA 1KV7A 3IN0A 4X60B 2FTAA 3AH8B 2PP9A 3EI2B 4A2EA 1AS7A 4ZN4A 4J0WA 3NYKA 4H5JA 1ZDQA 1T5KA 3MKQA 1ASOA 5FXYA 3SXTD 1N70A 2B4EA 1ZIAA 5FKQA 2OJYA 4MK0B 1PLBA 1NWPA 4M3HA 5FKRA 5EM2B 2IH8A 2YARA 5HE2B 1JMZB 4GGCA 1BXVA 4AKPA 3EI3A 2P9IC 4A0AA 1A4BA 4Z8LA 5GXIA 1DYZA 3U25A 3I7KA 3AW5A
chains in the Genus database with same CATH superfamily
3LKSA 3OLIA 1QEWB 5EN2B 3BAIA 2QZPA 4NWUH 4OFYD 5EFIA 5IWLA 2C4XA 2R4SH 4PRHA 4Y89A 4FE9A 1KZYA 4CILA 1IJNA 1I3GH 4KJQD 1B6UA 3T8XB 3EJYC 2IOOA 4ODHL 1E0OB 1A1NB 3H3BC 3RLMD 2HKRA 4AGNA 4JSNC 3QR1A 4KUZL 4RGNB 5LWYH 4RE6A 1JF1A 2G9HB 2R29A 4LNRB 5CFAA 3QFJA 1OOWA 3G6AA 3QWOB 1GZQA 2GTWA 4UI2A 2QQLL 1ZVSA 4G6MH 1Q94A 3FU8A 3CFJB 3QXAA 2JIXD 4FQXB 1E30A 4R7NB 3S88H 3PP4H 2ZWNA 3SHSA 1YMMD 4NGHH 1RZJL 4L5FL 1QD0A 1JUFA 4LLAA 4PY8J 3UC0L 2X6UA 3RMZD 4I77L 2HMIC 1URIA 1CF8L 3QHFH 4WI4A 3FPXA 3GRWH 3L7EA 1F6AB 2EC8A 5EUKA 4GXVL 1RIHL 4NNXB 3MRHA 4PS4H 2VC2L 2CR3A 2NYYD 4XE5B 3JV0A 1JZ7A 1MCPH 3C2SA 5GPRA 4WAFA 4U0QB 2VYRE 2KQNA 3OL2A 3KPRE 4AMXA 4J78A 3EBHA 4KRMB 4L3EE 3UTSD 1FDLH 1KLGA 25C8H 4HT1L 3DC0A 5FUZH 5DWUL 3JQOB 1SPDA 3ULVD 3OXSA 3W0WD 1JXGA 4S1DC 4AOFA 5KSVB 1MRFL 3OJDA 2E27L 3QDJE 2Q7NA 1G7MA 1QR1B 1IU1A 3IWVA 3V79C 2CGZA 5M61A 5TJWK 5C0GA 1N0XL 1ZHKB 2H9GB 3MRJB 3CVHH 3MOBH 2DJ4A 2Z31C 4NO0A 2G5RA 4Z0BL 5AYTA 3IJ1A 3P0VH 2AJYL 3DOIA 3Q13A 1S9YB 4JPKL 4S1SL 2QVIA 4EIBA 3A22A 3B9DA 1J0KA 1ULVA 5AVVB 3MUOA 2XETA 3QR0A 1VB9A 4F7CB 2JB6B 2AQPA 1KN4H 3I6GA 5TQ0H 4BZ2L 5GS0C 4QF1A 5GZND 1ZT1A 4PB9L 5G4MA 2AJSH 4FA6A 3IGAA 4U3SA 1Q4NX 2PP7A 3D33A 4ZRGA 1N10A 5BZXA 5BZWB 4HK0A 3IBOA 1NCAL 4LG8A 2N3JA 5EIIB 2BHFA 1VPOL 2ZE0A 3FMGL 8CGTA 2F5BL 5HYSG 2EACA 1JBJA 5D72H 3SKNB 1DO5A 2YJLA 4WHYG 4Z8FL 2GB2A 3L3DA 1L7TH 5F6IB 3SKJH 5HVHC 3IGLA 1KFGA 5EU4A 5JDJA 1SYVA 3PQYD 2BWIA 2DYPD 3S37L 3MRGA 4FLHA 2CRZA 3VWJA 4JSVC 1U8HB 4DO5A 4EEEA 35C8H 3BUTA 3DTDA 3WIAA 3EQ7A 4CZXA 4HBCH 3X3GH 3NZUA 3BIKA 3MLYH 3C2AL 4KMLB 3WHE0 5IC7A 1VACB 5F8RC 4NZUH 4P2OA 3SDCB 4AW7A 4WK0A 3TCLB 5DJZA 4Q74A 3BSGA 3L16A 1V3MA 1P22A 1I8LA 4GW4A 2C1OA 1M7DA 1D5ZB 1FNSL 5IQ9A 5ANME 4WCYH 2ZCKL 4G70B 4XP6H 4ZAKC 1BMWA 1HEJC 2JSFA 2QFPA 1X9UA 5G4OA 4QIRA 1XF3B 4QJ5B 3OR6A 4L8BB 3R7QA 5DUJA 5I17A 3GHPA 5JHDA 3L3JB 1WLHA 5L6YL 5EC2A 1ZS2A 4V1DD 1D5IL 3DIFB 4NXKA 4NO2B 3VXSB 4Y9CA 5IF0A 5I8EA 1RPKA 4OJDH 3O8XC 4L4JA 4QOKD 3RX5A 2J3SA 4Q6IA 1T5XA 3H9SA 1UJ3C 3C12A 4GLRH 4TLTA 2KERA 1QR4A 2G75A 2HP4A 4G55A 1G6RH 1K72A 3MX0B 4HIIA 3AQDA 3VI3A 3C99A 3WU1A 5F7WC 1GW6A 1MFDL 1PYWB 2HA1A 2VDML 1IAKA 3BQUB 3NJNA 3QB7C 3SQBA 3MFGB 1R3KB 1T6WA 1PGRB 5ESVA 1KNOA 4PV9A 3NPSB 3C6LB 1ETA1 2B7DT 3THML 2DPKA 3MV8B 4JZOB 1CFTB 1BJ1J 3O4OC 1XMWA 3DX9A 2W65B 4XPGH 3BN9D 1W8EA 3QJHA 5C1MB 1FZMA 1EH9A 4XCFH 2YNOA 1J8HB 2J44A 3L3KB 4R0LA 3WEBA 1E50A 2WLIA 4K9EL 4QD2E 1CLZH 2EKSA 4K3EL 3I2NA 4GSXA 4LCVA 4XN1A 1H6UA 4X61B 2IAND 3NOIA 3I6LE 1F90L 3U7WL 4ODBD 3MODH 5J3HC 1IB5A 1ADWA 2MPAL 4NRXB 4KO7A 2KDGA 1XO8A 1U41A 1F0LA 1LO2L 4ORGB 3O3BA 5CJ8A 4CJ0A 3AU0A 2OK0H 3E3QC 4YGAB 1FPTH 3FQUB 3I50H 2E6PA 2OZ4L 3KBEA 1LP9B 2VMFA 4YXKH 1MXGA 4HS3A 1UD5A 1Y0LB 4Y5YA 1HL5A 3RFZA 1A6UH 4DZBB 4HS8H 4FFTA 3N06B 4JRYA 3ZR6A 4WSJA 4HWNA 5C08B 4AGLA 1YNTB 2UX6A 5IJKA 4ZMVA 3F7YB 3HB3D 4U1SB 5JW4M 3NVXA 1I9RL 3ETBJ 4AQ8C 5HYJE 1U8QB 1O6VA 1E3ZA 2P9UC 3O6FA 1PPIA 3GO1H 3P73B 4K55A 4NZRH 2DAVA 1HYSC 2YD8A 3O6ML 4XXCA 4R96B 2YAQA 4AOWA 3VFWA 3WNLA 4HOXA 5I1EL 2WLMA 2CRYA 4J3OD 2YAOA 1L5GA 3VFMB 4PLKC 5EZLA 4BCCA 2ZUQB 1NTDA 2X53A 4ODHH 4Z7VB 4KUZH 4XO3A 3KLHC 5T3ZE 5BVJA 3O3EB 4J23A 4R3SB 2CG9X 4FQHB 4UV4L 3QAZB 2FK9A 1A7OL 5D1ZD 1I8IB 2QQLH 4GW1B 5E9DB 4M03A 1CG9B 3KJ4C 4GMBA 5HJGA 2I85A 4MWFA 3V7MA 4ACPA 4XN4A 3TN0B 1P7QB 2FL5A 2YOAA 4HALA 1FZOA 5GRYA 4L5FH 4JKNA 3QI0A 1PG7L 4E54A 4Y7MA 3PG2A 2XVGA 3AT9A 3MROB 3GDBA 5DZAA 3VFRB 4I77H 1CF8H 4OWRA 1K5NA 3DA0A 3SE6A 4WNSA 1PAZA 2I9LB 4KKQA 1HXMA 3T6VA 4GXVH 1RIHH 5INCA 3T0EA 1UB6A 2ZYIA 1HHHB 1CFNA 3VSUA 3L7FA 3IGKA 3PGCB 4MDJA 3O2DL 4EMZA 5JPMA 4NIKB 3GMOB 4JFZL 1HXYA 4HT1H 5DWUH 3EU7A 5FB8A 4Z7IA 3TESA 3BD4A 4N5UA 4OW6A 3INUL 1MRFH 2YEVB 4Z7VF 1K4DA 2QXVA 3GSQB 4XB7A 2EVGA 2YEQA 2C9VA 3NJXA 4QHUB 3D3VA 4K9JA 1U8CA 2OIZA 1L3NA 4ZUWA 2HXCA 2VZ1A 3TA3A 3NCFB 1N0XH 1EAJA 1DVUA 4BFBD 2F74B 1EANA 3MKGA 1LK2B 4Z0BH 3FTGA 5J12B 2CO0A 1IM3A 1K8IA 3MLTA 3V9CA 2WTPA 2YBAA 5DVNA 5K19A 4P5SA 4HWZA 3CPLA 1WZ1H 4MSWB 1AOHA 4S1SH 5A2LH 2OXGB 4ZNEA 2DS4A 2FYYA 3H85A 4ZOBA 4BZ2H 5J1SC 5D7JD 3E0GA 2C3GA 3E6HB 1TBGA 5IV2A 4UT9H 5FFLA 3Q8EA 2P5EE 5HHNB 1RJLB 4N2NA 5DQ9A 1NCAH 3P69A 4DGYL 1GHFL 4XTRD 3FMGH 2F5BH 3WS6A 1XF2B 2HSIA 3FFCB 1KF9B 4JFTA 4WUUA 2WTOA 2YPLD 5E8OB 3QG6B 1KBBA 5C07B 2IEPA 4Z8FH 2XZCL 3IETA 3V8OA 1RK1B 4LHUB 2QR5A 3O9WC 4P5TA 2XL3A 4NT6B 1I2MB 1XR9A 1GZPA 5ESQB 4BFIA 3TBWA 1SJEB 2JJSC 2WJ7A 3PU7A 3PWLA 5D2LA 2VABA 4CVZA 5F1IB 1C1EL 3C2AH 4GQ9L 3MGAA 1FGVH 3NH7L 1QI3A 4PJEA 4X99A 4L1DA 3S3JA 1FZKB 3PDOB 3QDAA 2NNFA 3TTYA 2AV7B 2EE6A 1MCOH 1YY9C 1CB4A 1FNSH 3UKRC 1F3RB 1HDMB 1BQLL 2NY4B 3QJSB 3QEHA 2ZCKH 5AJAA 3KWWA 1ML0A 3VFVB 5H35A 4JFEE 3NJJA 2EEAA 4QGYA 5L6YH 3ELQA 3KE0A 1A66A 1D5IH 3QAQA 3BWSA 4HIXL 1BPVA 5CSZB 2F5AL 3D18B 5TH2A 4ETYA 4MJ6B 3GGWB 3QI9C 4XGZA 1RUML 4GM8A 2AXFA 2ZXGA 4M1CC 5HTSA 5JOPE 2L7UA 3S5YA 1EQWA 4R7XA 4AIXA 5IP4A 2HJFA 2NY6C 3SDAD 1U95A 4YE0A 1RZJC 3VFOB 4F1SA 1MFDH 4L2LA 4U3CA 3UBHA 3IAPA 3NUKA 1ZWIA 2VDMH 4NKMA 2WOYA 3QIWA 4PGJA 3GRGA 5GZOA 3RILA 2CKBL 4HK3N 1YSOA 3TT1L 4KBPA 5DVKA 3THMH 3I74A 4PRHD 3RLSA 4UUJA 2E5EA 1W6LA 2N01B 4PJ9B 4BQCA 3LN5B 1RURL 2QSVA 2XDWA 2FNWA 3Q6FB 4OJEH 5AUMB 4Z7UB 4P99A 3RI5K 4X60B 2FO4B 5C8JB 2EEXA 4YHYC 3BZ4A 5L4IA 3QQ3B 4XI5C 1MWOA 5IM7B 3WD5L 4Q9RL 5BO0D 4K3EH 3FO2B 4NLAA 2FH8A 3HRPA 4OGZA 1QBLH 1NWPA 3AXHA 3L5XL 4MQXC 5E1IA 2G0KA 3QDGD 1E27B 4FQ1L 2Q8BH 4WHYH 4ECNA 1OIOA 4WSGA 1EX0A 2MPAH 4HBQA 4LSDA 2Y7LA 4QXWA 3UBXA 3GMPA 2UV3A 1H5BC 1M05B 4PJAE 1OSPH 2O5YL 3L9BA 5F0JB 1R33A 3RUGE 1UXWB 1VE7A 1LO2H 2R59A 1U8JB 4UQEA 1Q9KB 2AK4B 3X11B 1R5VA 4J4PA 3U2JA 1FYHB 5C3LD 3QUMH 4JY6B 1H0DA 4LAJH 2E86A 2CHDA 4AI7A 1L9QA 5E6RB 3I89A 4BH7A 2CGRL 5BV7B 3U82B 2XTJE 5D9SB 4A09B 4GUCA 4DESA 1ZEAL 1AYRA 4KXDA 3HE6A 2A83A 3KXFB 1B9YA 3IXTB 4XT1C 3RKDC 3A6BH 3RQ3A 1X6NA 1O7DC 3WLWD 1NUNB 1ZS8B 2E8YA 5BQ7A 4BK5A 2X9WA 1XX9C 2JFCA 2VMCA 4N85A 5DHVH 3RSEC 1OTTC 1FSKC 3HI6L 1WEJH 3BPNC 4OCRL 4Z3FA 6TAAA 3IAQA 1BD2D 2HT2D 3QJFA 5I1EH 1J05A 1T83C 2AP2A 3WIFA 4KZCA 1I3VA 4Y4HB 1MW0A 5JHAA 2F19L 3HS0C 1FRGL 3U1QA 5D5MA 1NC4B 4NO0D 3VFSB 1PGUA 3TJHC 5ICXB 1NIBA 1HZKA 3EH2A 1A7OH 5E7FA 1QSFE 2IOIA 4X6EA 5EU3A 4F58L 1AXIB 5I2IB 4BCZA 3DXKC 3EH4B 5FKSA 2JXMA 4PJHE 2ADJA 4Y4FC 4EI6B 5I1GL 5KSBA 3KBPA 2XQBL 4X80H 4CRPA 1G1CA 2Z64C 4XCEA 1UOQA 2DOCA 4LXFA 2WWOA 3ORJA 4XRCB 5EBLA 3H53A 3TYFA 2D73A 5D4HA 4OKDA 3TURA 3CQFA 3GXDA 3BPLC 5FLXg 4LCUB 4X98A 3NP3A 3PJLA 4TV3A 3V4PL 4HGWA 4CMHB 4ZS7L 2FECI 4W4OA 4JM4L 3BAKA 5FF6A 5CKAA 1EJ6A 1LO5B 4R90L 3OZLA 3LNIA 1PCXA 4LEOA 3L17A 3E8VA 2NXYC 1UACL 3GSNB 1D9KD 3RWGA 4OLVL 4JFWA 4J3VA 2WTRB 3FQYA 2ZONA 2YMUA 4AJVA 3O2DH 4IU2B 2B59A 1GRWA 3BEVA 2R7EA 1FNFA 1AZBA 1R47A 4DCQB 1I85A 3GIVA 4JHWL 2MNJB 1G9HA 4JY4B 3LMJH 4L8SB 3C6EA 3HE7D 1E9QA 1U58B 1TJHL 4LL9A 4JM2F 4HSCX 2VQ1A 4P49A 4J1UA 1SHXA 2BVTA 1JI2A 3ZDZB 3FSAA 5IB4A 4LESA 1E5YA 3BGMB 3SDDC 3TIDA 1N7ML 5D1QC 3QHTC 2C1PB 1ZV9A 4KDWA 5C0DA 5CEZE 3GB7B 3IJEA 3VXQB 3WNKA 4LLDA 4DK6A 1OB1B 5J56B 3FT1A 1JI1A 1EVTC 1OK0A 1D2PA 2YGVA 2NCEA 4ICWA 3U30C 3UEZA 5LN8A 3BQVA 1JZDC 1M71B 2IBGA 4K9EC 5B39G 5SX5H 1EFXB 3FUFA 3QXDB 1OMWB 4JEGB 2JKSA 3SPHA 5TFSL 2VH5L 4Z7OA 1QLEL 3H9SD 2P9NC 4CY3A 2VZVA 3D06A 5CEXB 2R69L 1BYPA 5LBSL 5IKCA 3RRQA 1W0WB 1BFSA 4QPEA 5D7KD 4B41A 3L9YA 2BDNL 4L4TB 5GGVH 4HIPA 2WWMD 4DGYH 1W72A 4R2GD 4XNZC 2TRYA 3QUZA 1AD9B 4D7BA 1MCFA 4P57A 4YHPB 3RJDA 1FYTE 4JFQA 3CHQA 5E6SB 1AGDA 5JZ7C 2P5WB 4K3DL 1YEDA 2XZCH 3U4AA 4I88A 1P4BH 4GAAA 3RDTB 5E6ZA 4K23H 1PU0A 1U8IB 5ISZE 4LPTA 5EU7C 3OKDB 2ADFL 3S36L 2B4CL 2EDFA 3SKUD 1J5CA 4EDXA 1XGTA 2EO1A 1A4JA 3OMZA 5DRXA 1HHJB 1A1OA 2PWEA 4LLUA 3I7NA 1C1EH 4GQ9H 4LCYB 1FVCA 4PJIE 4RZCA 3ZZSA 2VZOA 4YDMA 1WT5A 4OSUL 2QV4A 2VOTA 1PZ5B 4A6YA 1XF5A 1BQLH 4KNTA 3NFSL 3C8DA 2CZNA 4O5LL 2BNRE 1JVLA 2APXA 4KK6C 1DLFL 3RFGA 3KRXB 1XCWA 5TDHB 2ZX8A 4QI3A 4WV1B 4ADGA 2VLRA 1FC1A 1S7UB 1H8NA 3F5WB 1PD6A 2MHAB 4PRNB 1UEMA 3PXSD 4HIXH 4DKFH 3PHAA 2F5AH 1NH6A 4PGEB 4J8GA 4PJDF 2BVUA 4JRYD 1S7WB 2Y23A 1AP2A 1KGJA 4IGBC 1QSEA 3FYIB 2W88A 1LE9B 1XGZA 3GLDA 3ZHNA 3O6FD 5HDBA 5HI4D 4C59B 5ENWA 3K27A 3DUUB 4WWNA 2YNNA 2CKBH 4N14A 1NBQA 3BKCL 3E7JA 3MNZA 4M7JH 1KWGA 1YLBB 2C5DC 2HX8A 2JIXB 2OL3B 2EAEA 4PSPA 1G7IA 3OLGA 3RA7H 4QO1B 2D0FA 5CINL 3WNMA 5E4OA 4DQOH 1N3NA 3UJIH 1YMMB 1LM8V 4LSTL 3RWFB 1XB8A 4LOUD 5JW5B 1SBSL 2VNCA 1QFUH 2WKLA 3CDCA 3MCKA 3EHBC 4OI7A 4FXLA 2DKSA 1KB5L 4D9LH 4R97B 1KPUB 4LCIH 2B9AA 1TEFA 4L3HD 4NQEA 4Q9RH 4Y5VB 2PYEA 3VD0A 4OZGB 4Q97A 1MCDA 4PBWD 4TOYL 5F6HI 4DPRA 3GDCA 1CI5A 2CJSA 4QKTA 5THAA 4TZ4A 2X9ZA 5IVZA 1T1YB 4HZLB 1N68A 1ID2A 4S2SA 3UTSB 1KB3A 2O5YH 1EGJA 1V55B 1YPZA 1KJMA 3BZ5A 1LD9B 5I9QB 3ZDYE 4UQBA 2CCWA 2AJ3B 4XMZA 3DBXB 3X1FA 3W0WB 3ZE1F 4PBZA 4D0BA 2EYTB 1HHIB 2WIIA 2CGRH 1EPFA 3PWPB 4YC2B 2WXGA 2XZZA 2ZWLT 1ZEAH 4XP1H 5DQJA 3OAWA 5H8DA 5DYOA 3ZDXB 2OMZA 4E5ZA 3UABA 3MLZL 3MYJA 1XF4A 4DVBB 5E24E 4GO9A 2WLNA 3FSZA 5TDNB 4HIJA 4OCLC 1DO6A 5AOIA 3EI4B 2AH1A 4OY9A 4KROC 3HI6H 2W0KA 4OCRH 3D3VD 2ZX6A 4B7IA 1RLBA 2F08A 4GOSA 5E6IC 2AZUA 2A4ZA 2WQ8A 3NACL 5DJ6B 4AMKH 4D3CH 5HHOE 4GG6A 1T21B 4OZGF 2F19H 2YXWA 4OZIB 2F0CA 3Q5YA 1IM3D 4AUUA 1PLGL 12E8L 3HMWL 5KBNC 4BQ6A 3DETC 1R3JA 3FRXA 4F58H 3EG6A 2Y5TA 2D7QA 3S35H 3IFPA 5I1GH 2JH2A 2EEFA 1BQKA 4IJ3C 3CZKA 3GMLA 3GZPA 2BWDA 2BNQB 4XNYL 5TDPB 3HPLB 2FECL 1X5ZA 5D96B 3ETTA 2VMDA 1PKOA 4FRWA 3PQYB 5J6GB 1WAAA 3FQTB 4QXTA 1XGQA 2C3XA 3V4PH 5TE7L 4MNQA 4ZS7H 4K4KA 3BZEB 4JM4H 3ZLQC 4G9FE 5IFHL 3MRIB 4LSQL 1FNHA 2ZSVA 3C9CA 1BZQK 5FCUH 3SGJC 1RERA 4YWGL 4E9RA 5I30H 1UACH 4OLVH 1U3NA 1KCUH 2WMPA 3QGVA 4N1HB 1QTYT 4W93A 1SM3H 2Z35A 2O72A 2PCXA 3KRWB 2B39A 1XSKA 1YO4A 3RDJA 4KKCD 1G7QB 4P5TD 4L1QD 1UWXH 2BS9A 2CLZA 1ZA6B 1C5CH 3RJQB 4OQ1A 1UOOA 1UH2A 3SQOL 2AKRB 5A2KH 1PEWA 5JNYA 2VW7A 2GFBA 1BAFH 3FU6A 1TJHH 1X7TA 5A7EA 4HW6A 4P9ML 4OZIF 2R1YB 2YXMA 2YGOA 3WFCL 3TBSB 3I7OA 1F8TL 2YQ2A 5HGDA 3CVDA 4B0MM 2V2TB 4NBMA 4PHZA 1IBFA 3VACA 5AB9A 4JDTL 3LZLA 1KN2L 4KJYA 4P07A 4V1DB 4F8QA 4S11A 5DA0B 4MMXB 4KHTL 1LLAA 3AQXA 2CN2A 2YHGA 1VZ3A 2ARJB 3EXLA 1A8JH 3KS0J 4RRPM 3T4YB 4EZJA 3D7PA 1XF1A 3FCSB 3PXJA 1EEZB 2IALA 3HBQA 4XO9A 5M5UA 4MQ7B 1XIWB 3LKRB 2HJKA 1PD1A 2HG5A 1NFDA 1FO0A 1T0NA 3PDDA 5DC4B 5TFSH 3KPOB 1N64L 1QLEH 2Z31A 1AO7E 3TXAA 1E8NA 1FL5A 2R69H 3M7OA 5LBSH 1SYSB 4AGQA 2V9TA 5LGHL 1UXLA 1R34A 3IUMA 2BDNH 4CI2A 3FTVA 1RZ8B 5CJQL 1GXRA 4MMYB 3LS5L 3HCVA 3QIWD 1G7LB 3FRPB 2VLMD 3TJPA 4BCBA 3POHA 4XVUC 2GITA 4K3DH 1EAQA 1D7BA 1M56B 4HKBA 2OULB 1RZGB 1IAOA 3EFOA 2IANB 3D85A 1SMDA 4F2ME 2ZAGA 3IWUA 2YAEA 4B27A 3QEQE 1Z9LA 4LVHB 4WK4B 3KD4A 2B4CH 3D39A 4PTTB 1CLVA 5CCGE 4XH2A 2WLKA 4GSRA 3TC9A 1EUTA 3AS1A 1HNGA 1KTKE 4TSCL 4CI1A 4RZKA 3KVPA 5DLLA 4KKZA 3S9DB 1EEYA 1AC6A 3BW9B 2ZOTA 3T3PB 2IV8A 1ORSA 1MY7A 4WO4D 5F93C 1OAJA 2A74B 2K3TA 2ZOWA 4KK9C 4KVPA 1CICC 3FS9A 4O5LH 3DURB 1PFCA 1ZTXE 4RAUA 3TBYB 1DLFH 3HB3B 2WJ5A 4JY5L 4JFXB 1Q1PA 3F6IA 3EJQA 4J4PD 4LLMB 4YN3A 2X44D 5EIIG 5JPNA 3P3TA 3V5HB 2C9UA 1N19A 1YYLL 1B2YA 4OZ4B 2B0SH 5CN1A 2VDLH 2CAKA 1KV7A 1BG1A 3UC2A 1P84K 4ZAKA 2FTAA 1WDAA 2WP3T 2ZXAA 5L7XH 3HE6D 1M6OB 3QCTH 4U1MA 3MKQA 1Z1WA 3REVB 5KBDA 1JMZA 3CLFL 5BS0B 3IPEA 1NKOA 2MCG1 3L3GA 5C0BB 3P9LA 5EWIL 3O4LE 5LN4A 3O8XA 5BJTA 1A4BA 4F8LA 1NAKL 1DYZA 2P44B 4M7ZC 4QRRE 2BFVH 3GNML 4IHOA 5CIPH 2ADYA 1AXSA 3PREA 4H26B 2YAFA 4LSTH 4QY8A 1GOFA 1KXTB 1A64A 4NQDA 3Q6GH 2CO2A 3AT0A 4H88L 1A2YB 3T3PF 1KB5H 3B9KB 3UOAB 1DVFA 3MOQA 1DQLL 3L4UA 2ZXBA 3SCYA 3UX9B 3FQNA 4F37F 2F58H 5E00B 1GYUA 1JV2A 4TOYH 1MI5B 3S5ZA 4MZIA 4ONFH 3VXNB 4ENZA 2EINB 4OGAD 4JCLA 4PJBA 2VXQL 3VXRA 1SGKA 1AGEA 2P1YA 3QZWA 1HAUA 4KKBD 1Q0YL 2LHAA 3GF8A 4FXKB 4M61A 4IRSC 4U1HB 3UTTA 3VGAC 2NSQA 4JFOA 3HNSL 4MCYA 3VI4A 4YEEA 2FJFB 4C4BA 1MFCL 3D0LA 5J11B 2WY3B 4EVNB 3OXRB 3UZQA 3MUNA 2OJZH 2YC1B 1QP1A 4G83A 2IXQB 3FB8A 3FO9B 1XHMA 5KS9A 4Q8BA 3RJOA 5DS2A 3MLZH 2W60B 3CVHA 4HD9A 5GJTL 4HU8A 3LRSB 2ICWJ 1UGKA 2DMCA 1QRNE 2ESVB 3HS9A 3F12A 3H7BA 4QHMA 4A39A 4AM0Q 3EOBB 1YECL 2Y22A 1MWAB 3RY6C 4BL0A 1DJSA 4FAND 1RUQH 5DFTA 3QYMA 2V2WA 4UMSA 5T3ZL 4XHQA 2H0JA 1R3HA 3KHOA 4AXWA 3ILPB 3RN0D 3MRNB 5E94B 2XWXA 3OG4B 4LU5H 4N8CH 5HHQA 3N41B 1VYHC 1TJMA 4PRPB 4DEUA 3P54A 1E8ZA 4P4RA 4AQ8A 3NIFB 4B50A 4MAYC 2F7RA 1MVUA 2CK0L 5IJVB 4B0MB 2LW3A 3H9HB 1JZ2A 4QT8A 3NAAH 1PLGH 3HMWH 5C0CA 4MD4A 5IHZA 5AW3B 3UAJC 1EAPA 2Z92A 2B4CC 4JS7A 4OF5A 5EARA 2IIJA 3JRPA 1Y07A 2XTSA 4GKNA 4XNYH 4TXVB 4YQXL 4LAQH 4AITA 3ZZQA 5C2VB 1H3GA 2EICA 2CMRH 1TIUA 4FG6D 3V0GA 2KH2B 3NSCA 4WI0A 1TOXA 5CS7A 4LNVA 1KFAH 4EKJA 3I3BA 4LSQH 5EF0A 4X6FA 3VXTA 3QZBA 3QUZD 2C4FT 3AQZA 5F7EL 1WC7A 3IFOA 4YWGH 4BKSC 3CV5A 3NTCL 4Z7QF 5I1LA 1Z2KA 2H7WA 5HDQL 3HG1B 4NUJA 5TK2A 1S7VB 3MMEB 2A9NH 3QUYB 3N41F 4X6BA 2LTQC 3SQOH 5FS5A 4J8RA 1BX2B 2XICA 3KPQA 3NIFF 3CQQA 3FQWB 4FTVA 4P9MH 3LVEA 4M7LL 2IAMD 1RLWA 4JFHE 3WFCH 2NCMA 4TVUA 1JPEA 3BP7B 2JMRA 4JDTH 1KN2H 4OD1L 1BW8A 3AREB 4CKQA 4K94L 4KHTH 3BZFA 1MIEL 3WEAA 1MHCA 3E0CA 2NY3D 1SJVA 2Q87A 4YHNB 2AXJA 9CGTA 3LSOB 5K93A 4PJ5B 4FZEH 1BZOA 2P43B 2APBA 3JVGA 2VLRD 5DZNA 1KDJA 3KGTA 3GSRB 1GYCA 2HJLA 3ECBA 5C0AD 3LKSB 2NMSA 1W0VB 2ZPKH 4ONOA 1O9WA 2DDQL 1YCSA 4P9HL 4OF7A 4PJFA 4FNLH 3RVVC 3QO1A 1SN0A 5EFIB 3SGKC 4PRHB 2CJ3A 3E6FA 2VDQB 4P04A 5DD1L 3VM7A 2OSYA 3LEYL 1TNNA 4OZHA 5CJQH 1AYOA 5EZIL 1JF1B 1V8HA 1UKTA 1YR2A 5DRWA 4OUUA 4UQAA 5F7DB 2WOBA 5FHBL 4CNIA 2JB5L 3QFJB 3UH8A 5AOJA 3G6AB 1E67A 4UB0L 1GZQB 2GTWB 3DXAE 3PCYA 4AJYV 2EBSA 1EAOA 1ZVSB 3C60D 4HHGA 3ZE2B 3BRGC 2EILB 3I7PA 3H56A 3JZHA 3QXAB 2OAAA 1SLUA 3AGWA 3N1PC 2CKNA 3IJ7A 4QAMB 2Y06L 4FJYA 4FL4B 1YG9A 4K5PA 4J7RA 3SZKC 5IQMA 3BH9B 3WXWL 4ZDHA 1JGEB 2B77A 2J21A 3JSSA 3L1EA 4KJPC 4Q89A 4AL8L 3VYOA 4NQED 2YD5A 1GC1L 4PREA 5H37A 4B95C 5EUKB 2BVOA 1CLYH 1X5LA 3O9WA 2BSEA 3D6GA 3QDMB 4LK4A 4M6OL 2X3AA 1ILUA 1UM6L 1UURA 3DRTA 3LV3A 3G6JE 2JJSA 5EO1A 2COVD 2FHFA 2M8XA 4AK2A 4WJ5A 4DK5A 4QNPE 1HQRB 3RHWK 4X5LA 3CN3A 5HI5C 1KULA 5IJ8E 4PWHA 3OXSB 4JY5H 4R7VA 3S4SG 2VERN 2X1OA 1IGCL 5DS8A 5L2JA 4GPVA 3H4HA 3OJDB 1DQQA 1PZUB 3ZE0E 1YYLH 4MAUL 1G7MB 5FKAA 5I6PA 5DD6A 4G1MA 3FH7A 3ZE2F 4XCYA 5C0GB 4RIRA 1DBBL 4GAJL 2XCMC 1F4WL 4WI7A 4FA7B 3V4LA 3CLFH 5IVXA 3G9VA 2VISA 1N6QL 4JAMA 4C54A 3CN1A 4AW4A 2GYSA 4MJ5A 4KQ3L 1GYAA 3QI9A 4F9PC 4APXA 5KUMA 3W56A 2MEJB 4W1TA 1VFOA 3T4AB 2TRCB 1MVFA 3GNMH 4AIZA 5D4JA 2Q10A 3BFWA 3A21A 4QF1B 5MENE 3F00A 1JZJA 2GEEA 1ZT1B 3D4GA 4OB5H 1NKRA 2PXYA 3IGAB 4H88H 4U3SB 3AB0C 1XTMA 3PYCA 2FSEA 1K8KC 3T3MA 1MREL 2Q8AL 2KL6A 1DQLH 2MMXA 1UXMA 2F61A 4L4VA 1GGIH 1QABA 2VC2A 5HQGA 2F7PA 1I8MA 3E2HB 2X4QA 4MJIE 1ZVNA 3WL9B 3L3DB 4N8UA 5EU4B 3RGVD 4FEIA 5HYFA 3VWJB 4XCCL 1PI6A 3CX5K 1Q0YH 1P6AB 4U1KB 2DMBA 5D8JL 4PRIE 3DVNA 3HNSH 3KJ6H 3NIDA 1C16B 2E74C 3HC4L 3AFLA 4P2OB 3S5LA 4WK0B 4HJ1A 4URTB 5DJZB 3TWYA 3UAAA 4Z7WE 2FNBA 1H5BA 2IH1A 1OAXL 5CFHA 4GW4B 2HMID 2C1OB 1M7DB 1NANI 4MS6A 5GJTH 3RPBA 4DP1X 5IQ9B 4A2FA 2YN5A 4DGWC 1G84A 1LGVA 4PV8A 1HIML 4F2FA 3K5SA 5FGCB 1YECH 4LKXA 1JZHA 5TEFA 2PM6B 3OR6B 1HL4A 4UOJA 5I17B 3F04A 4TM9A 5DZJA 4ENEC 3IJYA 5JHDB 2IOMA 5EC2B 2VJ8A 5IF0B 1HEHC 4LZKA 5I8EB 1CVSC 1KJ2L 4XCNA 2IDCA 2NW2B 2DWEA 4Q6IB 2DLTA 3LNDA 4MGXA 2F54E 4PP2A 3IS1X 2G75B 1H2WA 4EN3B 3II1A 4HIIB 5EORH 2AQQA 2W38A 3VI3B 1MDAH 2CWRA 2H1XA 2UZXA 2ZKWA 3CAFA 3Q8FA 5CO1A 3HBPA 3F83A 1T83A 5IK3B 3GSWA 3SQBB 5L2KA 1UT2A 2FR4A 1KXQE 1KNOB 5BUGA 4PV9B 1DBKL 2VKXA 3RWIA 4CI8A 4K7PX 4RETB 3MJGX 3HS0A 4YQXH 1X4ZA 1XQ4A 2Z31D 4DEPC 4G11A 2CLVA 3SDYH 2JF1A 3QJHB 1FZMB 2BC4A 1JIBA 2HX9A 3FT3A 4WKXA 3PAYA 5BW7C 1LK3L 6CGTA 4R0LB 1RXLA 2WLIB 3TX4A 1M3IA 5F7EH 5GS0D 3HRZA 3SBQA 5FUOL 3J7HA 3B2XA 4X4KA 3I9GL 3NTCH 3NA9L 1LILA 4HMCA 4BSVA 4OF0A 4HUXB 3CZUB 4LMQI 3A47A 3D85D 4LG9A 2UY6A 3QQ4A 1S9WB 2QQKH 3F7VB 5EMMB 1ZV2A 5FOJA 3S97C 3DLQR 3BRDA 4QUOA 5EIVA 2NXZC 5FYJU 4AGPA 2B9BA 3O3BB 4DH2A 4M7LH 3CUPA 4H1LB 2R15A 1KXHA 1QBML 5F89A 4CW1A 5C0NC 3EKCA 3I9AA 4HS3B 4OD1H 4G7VL 5PAZA 1QUNA 2GW5A 1WCBA 1A12A 4Y5YB 4UANA 4K94H 3NDZE 4WWKC 3RFZB 4XNAA 1JJUB 4JRYB 4N5ED 5J57B 4P2RA 5DVPA 1COBA 1HL8A 4W9FC 3TA4D 3DO7A 1HJBC 3CHOA 1DJYA 2CXGA 4RDQF 2CJTA 1IGIH 3DV6B 3O6FB 4K5NA 3U7YL 3QORD 3UZVA 1O7SA 4L1HA 1DJIA 2DDQH 4P9HH 3SDDA 5F7UA 5CKGA 3VFWB 1XAKA 4YSUA 3O4JA 3DVIA 1L5GB 4YHIA 4HJJL 4HEPA 2AQNA 1ZHNA 4YHLL 2QL1A 1TTGA 3NCBB 5IR1A 1JGVL 1AR1C 5JIMA 5CUSH 4NKOA 5EZIH 1XGRA 1MCBA 5BVJB 2I24N 1UD6A 4GP4B 4FFWC 2JB5H 3O8XD 3QEUA 7TAAA 4UB0H 4OFKA 4LP8A 5I1HH 1OCOB 4QKXB 3L4WA 3LD8C 2DBLL 2BIOA 3SO3B 3VXME 4MWFB 4G56B 4U6VL 4LBEA 2KC0A 2Y06H 5JO5A 4ODXB 4Y7OC 2FL5B 1QBBA 1FZOB 4L2YA 4NQDD 3WXWH 1NKGA 4E54B 4FNQA 4KH2A 4XOCA 1UZ8A 2UZYA 4L0PB 5EU6E 5DMJB 1DVFD 4JBSA 1GC1H 2AQSA 1HXMB 2OZ4A 3HUJA 4MB3A 5INCB 3T0EB 1UB6B 1BVNT 5DHXB 4BFKA 1CFNB 1IAIM 1UM6H 3L7FB 3MV9A 4R26L 3TH4T 3DRQA 4MDJB 2EP6A 1X5KA 2YRBA 1VEPA 1YRKA 2DD8L 5DEGA 1ZJAA 2HTLC 3RNQA 3VXRD 5JPMB 1H3VA 3U9PH 4IBQA 5FB8B 1B0RA 2IWGA 2ZG2A 2ATPA 5EDSA 1IGCH 1SN2A 5DHVA 3SPIA 4Z77A 5JHMA 1K4DB 3BJ91 4RGNE 5A6MA 1A3LH 5J3HD 3KEHA 2VZ3A 3B1TA 1JCVA 3D3VB 3P3UA 1X7QA 4MAUH 1S4IA 1S5IL 1YN7A 5D2NE 3TH3T 1U8CB 4F80A 3ZO0A 2A3TA 4ZUWB 5MHSD 1REIA 3TA3B 1JXFA 4GAJH 4P2CG 1F4WH 3GMRA 3FM0A 5A2AA 5GRJL 1K8IB 2YMXL 3MLTB 5DVOA 4KQ3H 4HWZB 3CPLB 2Z2NA 3QQDA 3GEWB 4Y19D 5KVFL 1YEKH 2FYYB 3ZN6A 4H4NA 2B1HL 4KOCA 4W9GC 1CL7I 3FDWA 3T0DA 2IAAC 5HI3C 1IL1A 4DO6A 3BVXA 3O0LA 5H17A 1HYSD 2VRAA 4LVOB 5IV2B 4NUQA 1MREH 4XP9L 2Q8AH 3ETBF 3JV6A 4HWUA 4XN8A 2AMUA 4GQZA 1DQJA 3QFDA 3TS8A 4XC1L 1KGCD 3I85A 5CN3A 1DUZA 1ZLDA 2Y72A 3WKYA 5JA9A 3O2DA 3VO0A 4WUUB 2X3BA 5F2FA 5DS1A 4Q9CA 4G59C 4NSKA 4ZFFB 5CEYA 4GW5A 3PXWD 3P4OA 1CN4A 2P4AB 4N20A 4YBLB 4D8PB 1XR9B 3MV7E 1GZPB 4K7PY 3ZIMA 4XCCH 4K94C 1OGAA 4TTDD 5FYJD 2LV4A 2XJLA 4BFIB 2WB7A 2HFTA 2CN3A 3TBWB 3PWLB 3MBXL 1VCBC 5D2LB 4FMFA 2VABB 2ZUWA 3TYGL 4CVZB 3TF4A 2QGBA 4AVHA 3HC4H 3ZW3A 1ZSDA 4PJEB 4X99B 5C09B 1KBGH 2VLKE 1JPST 2ZOLA 1OAXH 2XYBA 4P9HC 3QULA 2AEOA 5AKRA 2J57G 4Q56A 1HSAA 2FUQA 3QEHB 1HIMH 2E7BA 1R24A 2J8UF 3PY9A 1FE8L 1WCQA 4JDVB 2XUWA 4FTVD 1T4KA 4IRZL 5H35B 4AC4A 2MTAA 3FB7B 3VD9A 4FADA 1F1AA 4FCHA 2PPFA 1TYEA 3MFFB 1KJ2H 5TH2B 1TCRB 4O00A 4XGZB 3S96B 1F45A 2AXFB 5KBPA 3SCMC 2RHEA 1A7QH 1OQXA 4AM0A 2XWTA 4QWWD 1U95B 1AC0A 3FONB 1E4XI 4KWUA 3U7AA 5E6IA 4KQ4L 1ZWIB 2WAQA 1SZNA 4NKMB 3CD4A 3WIHL 4AL8C 1GC1C 1E3XA 3C9NB 2AEPH 3MUY1 4PI0A 3CTTA 3WHE1 1USQA 2ZSWB 4CSZA 3BVNA 1Z9OA 5CJ5A 3O6LL 3ARSA 4JDEA 2DQCH 3NABH 3Q5TA 4DFHA 5SWZE 4V2BA 4JRLA 3BZ4B 3P4MB 2R4RH 4JW3A 4FB1D 4RNRA 3GFUA 5FUOH 4NQSA 3F64A 2EVFA 1J0HA 3NA9H 3LAFA 3ATEA 2TAAA 5CLXA 4YDKL 4FI6A 2WSPA 2A6KA 2HLAA 2UVFA 1S7XA 3BPOB 1H8LA 3Q9QA 4RMSA 4XVSL 1LO3L 4NHUA 1FFPA 4QQEA 1EZUA 4B9CA 3UBXB 2A9BA 5GGSA 1LEGA 4XEIC 3GMPB 3SGJA 4IIZA 2KQMA 4OQTH 1ECZA 4HIQA 3WFDL 1C12B 2X41A 1AG0A 2N56A 3ZTDC 1B6DA 4OVUA 1QBMH 3O9WD 2BSED 1H0DB 2FBJL 1OTSC 4OLZH 5GGSY 4BH7B 4XMUA 1RL1A 1PD0A 4G7VH 1ZMYA 4X42A 4HCRL 2NYKA 3HFMH 1HN1A 3U4EA 3A5VA 3L4CA 3OQ3B 5D1ZI 4XO4A 4K5LA 3BYYA 3HE6B 2A83B 2DQUL 4ZSOA 4FFVD 3KNBB 1QO3B 1B4TA 2D4DA 1G0DA 2VZSA 4MA1C 3TV3L 5BQ7B 2CKBA 3AXLA 1SLXA 3ECVA 1B2WL 1J7VR 2OTWA 1OP5H 4G7YL 1JZFA 4KGLA 3QJFB 2QHRH 4HAFA 1MY5A 4HJJH 4HEME 1J5OL 2HVKA 4P4KC 4YHLH 3MXXA 2PR9A 1N6DA 1E4JA 4LASL 3K4ZA 1PSKL 3MBEC 1ZLUK 3ZPDA 3UAFA 1JGVH 3JT0A 3O2WL 3ZYIA 1DJHA 3ZTEA 3BD5A 5IMKA 4JT6C 4DNLA 1E4HA 4N28A 4LEXH 5EU3B 4X6EB 4C83A 1NGQL 3CLEH 4M1CD 4JFDB 2JXMB 4DAGL 1N6UA 5KSBB 5EBMA 1I8KA 4QRTB 4XCEB 4G2AA 3VD3A 4U6VH 4F37K 5HXMA 4CZVA 2WSDA 5EBLB 1Z3GH 3TYFB 3BT0A 5F70A 1MFBH 4TVPE 5K39A 4GEIA 4GO8A 3F85A 3ULUD 2K8QA 2ED7A 2OCJA 2PXYD 4X98B 4BP9A 1VF5C 2NZ9C 5E4EB 1ZTXL 4TQIA 1A0QL 4UZGA 5FF6B 5I1DA 3F7QA 4L4VD 3G9AB 4NXSA 3LNHA 4LEOB 4ETQA 3D2UA 3RWGB 3ZSTA 3WO4C 5E08L 4FHLA 3UBGA 5BOPA 4BGDA 2YPKA 1PEVA 3PXHA 4DN4L 2XJKA 2B59B 3BEVB 2R7EB 2DD8H 4NQTA 5KBMA 3IXAA 1E5TA 4YSOA 1BREA 1JTTA 3GIVB 2KI6A 3M17B 4IDJL 1E9QB 3K74B 2CALA 3IJ0A 4Z7VE 2BP0B 1UC6A 3QVAA 4E0RB 5D7IB 3O3DA 4J1UB 3T8VA 4LGNA 1T7XA 4YDIL 2RMNA 2WW8A 1S5IH 2EQDA 2D3LA 4XX1G 5J6SA 3KWTA 1OSEA 4MLIA 1A6WH 3WTSA 3CXFA 5C0DB 4F93B 2HU5A 3GPEA 4DP0X 5GRJH 1U3JA 2AZAA 2NRDA 2YMXH 4GBXA 5FW8A 4LLDB 5L4MA 2NT1A 1JGLH 1WWAX 3WTUA 3DDFA 4LF3B 4H0LC 4FN0A 1FN4A 2QADC 2K0RA 3GJEA 3N42B 4S1RL 3BMVA 1CL7L 2AVGA 2J1KA 2DKUA 1OLZA 3GSNH 5KVFH 3BDXA 2Y25A 3PIQB 5C9JA 2AH0A 4N2KA 3RKDD 5CGBA 3CIKB 1P0SE 2B1HH 1WK0A 4Z7OB 2I0RA 1EXGA 2W9EL 3V4PA 4EXPX 5IKCB 3FB6A 2WQVA 1Z0NA 5EO0A 1RI6A 4N2EA 1OTTD 3OC5A 4LGPB 3QRFM 3REWB 1J8KA 2CIIA 4FXGC 4C56A 1W72B 5L2KD 1AQ8A 3BDYL 2G2NA 1L0XA 3KLAB 3QUZB 3P1VA 5A7BA 2XZGA 1ZLEA 4XC1H 1ZVHA 1Z5HA 4UF7C 4P57B 1J5DA 4JFQB 1AGDB 3VUAA 3VMOA 4MTMA 1CLCA 1YEDB 4U05A 4J3OG 3TJHD 4E42A 5D7IF 3QQ9D 1E90A 1U3ZA 5HP5A 2RQEA 1QFMA 3UXFA 3WUZA 4NS0A 3B43A 5CCJA 3MBXH 4LT7A 3TYGH 5DRXB 3V0VA 2Z4QB 1A1OB 1NPUA 1S46A 4OTXL 5F7HA 1ECYA 1VEOA 4RZCB 1FVCB 1NANH 5E99H 3FGBA 3TFKD 3F3GA 1T7WA 4X0NA 5IOPA 5TF1L 4UTAL 5L8KB 3MXWL 4I1PA 3V7AG 5EMYA 2JQMA 4AZUA 2HKMA 4A6YB 2JQZA 2V4LA 3L54A 1XF5B 2JWYA 4XMWA 1NEXB 4IRSA 2VDRL 1YA5A 4MCZA 3UTPD 4NN6B 5GGRY 3PWNA 4S0TD 2NXYD 5BRZD 3WJJC 1FE8H 4L48A 3MLRL 5FWQA 4IRZH 2AXHA 2OMVA 2XY2A 4YXLL 2VLRB 2ZWZA 2L7EA 4K71B 4WGKA 4G8GB 4U49A 5I1CL 3EGXB 4Z76A 1KACB 2ENPA 2R69A 5LBSA 3RIKA 3FFCE 3CFVA 3RY6A 5A1AA 4P2RD 1BZ7A 2E0PA 1P7KA 2BP8A 4LVNB 5I6NA 2H14A 3FH5A 1QSEB 5C6TL 4FZ8L 1K6QL 3M7FB 1BOYA 1AMXA 4XVOA 5HDBB 4PR5A 5ENWB 2W0LA 4OUOA 2AAVA 2LABA 2J4WH 4GP5B 1ZXQA 3WIHH 1UG9A 4EI5C 3PE9A 1DFBL 1TEGA 3ARFC 3LB6C 3CQPA 1V27A 1G7IB 2A6DA 3O6LH 4FQLL 3OW8A 1TQBB 5D1XA 2VMEA 3IF1B 1N3NB 3UAJA 1DQML 3B2VL 4BWTA 4XE0A 1L0QA 1CGXA 5JYMA 5CBAA 2O6DA 1G9ML 2PYEB 2ICEC 5DVMA 3RTLA 2J5WA 2NY2C 3CDFA 4QRPD 1R9FA 4NJAL 1LXMA 3MKKA 4N0RA 4CGTA 3UZEC 1LO3H 3CZSA 4QYAA 1YEEL 2Z34A 5C86A 4N9GB 1S8DA 2NUPB 4XR8C 2QELA 1D5XB 1YUKB 4S2SB 1KBKA 2W9DH 2KBGA 3QZPA 1YPZB 3WFDH 5FYKU 1FH2A 3EOAA 2EEBA 1DLHA 3V55A 2J1ZA 5JZ7D 3OKLA 1XHHA 1MJ8L 4N90E 2Q5BA 2Y6SC 3K4AA 4D0BB 5KSAA 2GSIA 2FBJH 1ZPUA 3MAWA 2DQEH 3W9EA 3MRBA 3WTXA 2WIIB 4WHTA 3FH8A 5K33A 4HIHA 3KYNA 5T1LA 5DQJB 4BUHA 5DYOB 4PSXB 2OMZB 3ISYA 4E5ZB 3MYJB 1XF4B 2DQUH 4NQCA 3VB9A 3LN4A 4AT6A 3CX2A 1FL6B 4HIJB 4GI6A 1WWBX 3MRCA 3ZTJG 2ROXA 2MNWA 3TV3H 3SY0A 1CE6B 4FHKA 1B2WH 1V5JA 4JFFB 4KO6A 4G7YH 5E2WH 1K3ZA 3TEWA 5CWSA 2WSKA 3L95B 4KKAC 3FQ1A 1BVKA 1J5OH 5CIPA 3OKOB 3HKFA 4G6KL 3UCQA 1BMZA 3APMA 4GG6B 5E8DL 3RNKA 4LASH 1XR8B 5IBTL 1QVOA 3AH8B 3O2WH 1KB5A 3LQZA 3KPTA 4YOKA 2NR6C 1IGFL 3KPMB 1R3JB 1ZDQA 1BYNA 3SGKA 1AIFA 1ZIAA 2Y5TB 5CP7B 1JHLH 1NGQH 2ROYA 3K0WA 4EIUA 4KMQA 3O0RL 3GMLB 1LMIA 1B88A 2AK4E 3DX4A 2OMYA 1JPFB 5F7NC 1HWHB 3T09A 4IKIA 3T0AA 3LH9A 3CMOL 2JNZA 1XGQB 1CD1B 3P4LA 1FVEA 5F72S 5JIHA 4MNQB 5F3HA 5D6CA 3VFGL 2LQRA 2ZSVB 2V5RA 5SWSD 3X13A 1CGSL 1S78D 4QCIA 3WUWB 5IB5A 4OCWL 2Z35B 2NW3A 4DN4H 3DNKA 1KSRA 3CFSB 4OCSL 5EOQH 3WEXA 1VA9A 1YEGL 3FSVA 4GKLA 2C7UA 5TF0A 4Y16D 2CLZB 4ZTOL 1OGAD 1A65A 4IDJH 4NAJA 3H0TA 2GFBB 43C9A 4M5YL 5DGRA 3FUJA 2WV3A 1I4FA 5LCVH 2HH0H 4YDIH 2ZUUA 2L04A 4KJYB 1IBZA 1HE7A 2WXJA 1TO4A 4ZQKA 4PB0L 4ERQA 1UCBL 1QFWI 4O02B 4FG4A 4HU2A 4AG4L 3VRJA 3ZX1A 4MS8C 3CN0A 4AC2A 4PJ8C 2IALB 1N67A 3LXUX 4S1RH 1T0OA 1DVZA 2CHXA 4R5XA 2HJKB 1TMQA 4DNVA 1CL7H 4FTDA 1NMBL 3OWRA 1NFDB 4Q52A 1FO0B 3EW3B 1T0NB 3SE3C 5T33L 4UOW0 1XL4A 2Z31B 3PRZA 1FL5B 3KPRA 4LLYA 1D5RA 2NX5D 3FB5B 4NYLB 4L3EA 2VL4A 3EG9A 1OZUA 4KROD 4DUWA 3EYQC 1CR9L 2FATL 4LLVA 5FO7A 3UDWC 4F9PA 1G9NL 4KJQC 2ZOUA 5E6ID 5DFWH 3HCVB 1AGCA 5GSVA 3W37A 3JZ7A 1UTDA 1BWMA 4XMPL 3AQYA 2YN3A 3V10A 1AHKA 5GGQL 3VE0A 4HKBB 3KLQA 1IAOB 2Y07H 3EFOB 3DETD 2OBGA 2DIJA 3ZDZE 3WMSA 5HHMD 2FWOA 3F7PC 1S9VB 4XMVA 5I0WA 5FYKD 3ZRCC 1C5BL 3NJFA 5DSCA 3D39B 3T6XA 1F4YL 2JELH 2Y9RT 1TSRA 1N4XH 1EV2E 4XH2B 4OTXH 3QQXA 1BQHG 1MAJA 1SQ2N 3MACH 5HVHB 1ORQA 5F1KC 2PWGA 4UV7L 5I74C 1VEMA 4HK3J 5FIEA 3MXWH 4MNGB 5HPMA 1MHEA 3BSZA 5B1BB 2W81C 3IIYA 3QWNA 3I9IA 1ORSB 1OM9A 2VDRH 2QPUA 1CDHA 4DGVH 1PZ2A 2IPUG 2YXVA 3ZVVA 4RAUB 3MLRH 4YXLH 2LE9A 3AAZA 4L3CA 5LB1A 5IB3B 5I1CH 3HC2A 3AXIA 2WUBL 4GSDL 3GSXA 1FV1B 2UWEF 1NGXB 4Q14A 2GHZA 4PJDE 4ZAKB 1E4XH 4DNWA 3QWRA 2J43A 4PVBA 2ED9A 4QHKI 2P5WE 3SOBL 5J13C 5I18L 1A02N 4FZ8H 1K6QH 2D31A 2DMKA 4CVXB 1SF5A 2KLSA 3L3GB 4FNUA 2VT0A 3P9LB 4NFCA 4GRWB 3O8XB 3ENEA 4MVBC 4IEFA 4P5MA 2NQCA 3C5XA 5DFAA 1DFBH 1RZFH 1D5BA 1UJ3B 2CUIA 2NY5H 4EDWL 2ZXDA 4L3FA 2OTUA 4FQLH 2N7SA 4IHOB 1AXSB 3EYSH 3Q01A 5IHBA 4QY8B 2XWRA 4NQDB 5IMOB 2OMNA 4A09A 1DJZA 4H8PA 3FHAA 5GRZA 3IM1A 1A0RB 2BHYA 2ZX9A 3VDAA 4J8BA 1ZHLA 3BISA 1WIPA 3QT2A 2YKKA 2YQBA 5GZNC 1L4IA 5MEPB 1G9MH 5IJDC 2PWDA 3O4OB 2J6EH 2WXOA 1DJGA 4O2WA 3FQNB 5F6HJ 2XKUA 2L7QA 1QQDB 2N59A 1KJ3L 2QFRA 3LZQA 4HAGA 4NJAH 1JV2B 1FNAA 2WWKT 4J3OH 5BW7A 4PSWB 1IQWL 5ECGA 2P8PA 4KVCL 3N1GC 3GYRA 4TSBL 4TF4A 1TZIA 4AV5A 3VXRB 2BIQA 1I8UA 1AGEB 4PCSA 5TDOB 1CURA 3NQIA 3QZWB 4BRJA 3EADA 4NP4H 3W2DL 3UTTB 4M61B 5I8KL 1NSNL 1MJ8H 2DQIL 4JFOB 4MCYB 5FAAA 3VI4B 2UY7A 3HPJB 3D2UD 3B7SA 4J2XA 3D0LB 4ZOCA 5FFGA 3UZQB 2OQJA 3V95A 4RMRA 2FB4L 5DC9B 1Q1JL 4XP5L 3VCLA 3CVHB 3PUUA 3WMPA 1EHKB 1WZMA 3LH2L 4QHMB 1UHVA 5HHXH 1SVBA 3H7BB 4F33A 1MG3C 3MZTA 3U79A 2AJZA 2QKIC 2X89D 5F1OB 3X1BA 2V2WB 1J0ZA 2JI3A 1R3HB 2J7LA 1GS8A 3MLUL 2YD2A 5KJ7E 2FLBT 4NOFA 3ZTNL 5JMOC 2RGSA 3QZMA 4I5BA 1RSFA 2TRHA 5HHQB 3OF7A 4G6KH 2NTFA 3U9UB 1E2ZA 2CPCA 4H7VA 5E8DH 5GS1C 4OZGE 4YX2L 4P4RB 4PRAA 3VQ1C 5IHWA 4M4RB 1MVUB 2A1WH 4GBXD 3NIGB 3AGVA 1IGFH 4IKLA 5C0CB 4MD4B 4Z7AA 5IHZB 2BIPA 3OGCA 2G9KA 1EAPB 2HFEA 2EDHA 3OVUB 5I28A 3HR5A 1JZ4A 1A4AA 1JVOA 4NM4H 4ZZKA 1QAWA 1MCLA 2H1LM 3K2MC 4OFQA 4GKNB 3B1UA 5I5IA 5CXCA 3MUZ1 4WFHD 5FA3A 2IUVA 2VXQA 1M53A 1C9SA 3CNKA 3PWPE 2IGLA 2V2XA 3CMOH 3L4ZA 4WI0B 3BAYA 4F57L 2EYSB 3RWEA 4D9SA 3LIZH 4JANA 4C56D 4X6FB 1MWAH 3KJ4B 1DL7H 2Y36L 5TE6H 3VFGH 3VXTB 3AY4C 3FBQA 3VVVA 1CGSH 1WC7B 3IFOB 3S2AA 1FLRH 2NDGA 5INDA 2CA4A 4OCWH 5I1LB 3CSGA 3QJQB 2H0PA 2JCWA 3VMNA 4WU5B 2OA9A 4NUJB 1DE4A 5FYLE 4HJUA 4OCSH 2QGEA 3KYKL 4MXWH 3ZQWA 2YEZB 4ZTOH 3W5NA 4AMZA 5EALA 4NO5A 1XH3A 2LFGA 4X6BB 1B4JH 1UQSA 3VXPA 4J8RB 3KPQB 5GQBA 4FTVB 3M45A 4OZIE 2WLZA 1EXUB 3WKQA 4NHCH 3QA3B 5M95B 1I1FA 3NIGF 1QFWL 5BQDA 4QXVA 3G6DL 3WTTA 4YSSA 1DQDL 1TXKA 1YN6A 2Z0UA 4KI5C 3Q8AA 4PB0H 1UCBH 4YHOL 1KY6A 3IT8D 5F44A 1JXKA 1UXSA 3TJEL 2NY5C 3FAXA 1G6RB 3BZFB 2I7SA 2A73B 1MHCB 2BNQE 1MDAA 4I4WA 1XEUA 4TL4A 4AG4H 3QG7L 4F8OA 4Z78A 2BSRA 1SJHB 1U6AH 1HXKA 1H3XA 5C97A 5H1MA 1E6OH 4LQFL 4A11A 1N9PA 3ZTJH 3T04D 3MCLL 5HDWA 1NMBH 1ONQA 4PJFB 1G9MC 3JT2A 4G5AA 3II3A 2H6OA 3QO1B 1NEPA 3NRQA 4M5ZL 4G6AC 1SOSA 3TEUA 4ZNCD 3E6FB 1DBML 4X4ME 1ETZA 4DKTA 3V2AR 3WY1A 4HOMA 4GYBA 4HUUA 2A4CA 3DVGA 4LKCA 4AEEA 1CDUA 3M46A 1CR9H 3HN8A 4OZHB 1NCCL 1G9NH 5HYEA 2P80A 2G30A 3EO0A 1WH0A 2VMJA 7PCYA 5DRWB 4OUUB 4CNIB 4AX4A 3UBXI 4HS6A 2PR4H 1KCVH 2IQAA 4XMPH 1AZCA 2PPAA 3OAYK 2CE6A 5GGQH 5E1HB 1MH5A 1QW8A 5D1ZC 2YIHA 3PS6A 5D1XD 3O4HA 4RE5A 4JJ5A 4X8GA 4ERYA 3UAJD 2AQ3A 1L6PA 4JFPA 4ZDHB 2A77L 1C5BH 3ALXA 1F4YH 4AYDC 4OV6F 4PREB 4P5RA 2BVOB 5ID0A 1P6FA 3O9WB 4ZFGL 5GXBB 4O45A 4YL4A 3LV3B 4H0IA 3DRTB 3STLB 4L8CA 5KAQG 3BDBA 5D6DC 5EO1B 3AG4B 3D0VA 3KHQA 1K4CA 2PF6A 1JZ3A 2QJDA 4IK6A 1WD9A 3V4VL 5LGYA 1ZLWK 4LPVA 3UTQA 1T7YA 5DS8B 5KSAD 5DC2A 3VFTA 1DQQB 4S0SD 2FX7H 2ZCZA 1XZWA 1PJ9A 3WY4A 3BLBA 2EXWD 2EH8L 1J88A 4GSDH 2VN4A 4O51A 1ND0A 5DD6B 4XN9A 5T1LD 1V7MH 2WZ5A 4G1MB 1QYGL 3LZRA 5DZLA 1CK0L 4RIRB 2MTPA 2XWDA 3DUSA 4NQCD 2GSMB 3RIAF 5I18H 4PJAF 1HNYA 4CBZA 5IVXB 2IUQA 1CGYA 5FX3A 4IU3A 3ZMEA 2VISB 2VIRA 4JAMB 4KXZI 1PDKB 1RKRA 1Z7JA 1NDMB 2WC7A 4MJ5B 4AQAA 5T5NG 3UMNA 3EZJB 3C5ZC 3BG1A 3QI9B 4IMMA 4APXB 1HKLH 1AD0A 1MAML 4Q9BA 3SCMA 4EDWH 4EIGB 5B7MA 1J87A 2QT6A 3LPGA 4JB9L 4GIOA 5FPIA 1J5IA 2NY6B 4XYIA 3LKOA 5ALBL 1ET5A 2CM5A 2XG4B 3NEEA 1J0YA 3H2WA 4GKSA 2RQ8A 3FCUA 4JO4L 1EZVX 4X9BA 1PQZB 3X1NA 1EZSA 3T3PE 1I75A 2AQ5A 4IRJA 5D7JC 2DI9A 1SDDB 4Y9FA 3L5WA 4X6DF 1NGYA 5GHWL 1HC1A 3MGTA 4XBEL 5CM1A 1SXCA 3STBA 1KJ3H 2H6QA 1INQA 2X4QB 3LS4H 3GQFA 1OCWL 4YHYB 3KYMA 1IQWH 1ET7A 3Q1SL 4KVCH 1MEXH 4X3EA 2GSGA 5JW3L 3GS4A 1BVOA 1U8PA 1T89C 1D5MB 3N6YA 2LAGB 4CU6A 3W2DH 2A6JA 1NSNH 3IDMB 1ZT4A 4WFFD 3DVNB 5AVSB 3NIDB 5L8JB 5BS0E 3CVIL 1NIEA 4OLEA 1RAMA 2J1YA 4WTWA 5C0BE 3S5LB 3VB8A 2B1OA 3V4UL 1H5BB 2IH1B 2BS71 1Q1JH 2Z7UA 3CGTA 3JWNE 4ODSL 4XP5H 4BA8A 2ZCHL 3V0AC 2P45B 1F13A 4RA0C 2VLLA 4X9HA 4PV8B 4JO3H 5DXWA 1H9VA 4LKXB 2YPVL 4BRVA 4GGCA 1ZVYA 4P46C 3L6FA 1G9NC 1NM9A 1UA3A 1XD1A 3MLUH 4Z8LA 3IJYB 1OAUH 1XZ0A 3ZTNH 2F53A 3U25A 5KW9L 1G9EA 3OTTA 3GMQA 2DWEB 3C5JA 3Q5OA 4NSXA 2R0ZL 2HYEA 4HHAA 4PP2B 3UBXG 2GBTA 3R0MA 2GJ6E 1MI5E 4A38A 1XH1A 3OF6A 4JFUA 4U1JA 1FSKB 3RUGA 2NLJA 3BPNB 2UZXB 2Y24A 4PJ6A 2WQRA 4MB1A 1WFOA 3PV7A 3GSWB 5L2KB 4N24A 3SDAC 2H26A 1RUPH 4P4KA 2FR4B 4N0YL 2V9RA 3RWIB 1KJVA 3HS0B 4P48A 3KVQA 4TTGA 4AQ1C 1CGUA 1N18A 2EXYC 3CXHK 2VLJA 2DN7A 4TL5A 5GIRA 1WBYA 3KPRD 4P5KA 1MJUL 2JLLA 4L3ED 5IWLC 2OVPB 2BC4B 5I75C 1OE1A 3FT3B 3GJFK 4JG5A 2AAAA 4Y4FB 3ZDWA 5C71A 3LPFA 2Y36H 2J56H 2ESVE 1R6VA 2WQSA 3APCA 7FABH 4GM9A 2BVYA 1O6SA 3V9EA 3QDJD 1XSOA 4NZFA 4Z7QE 3BPLB 4W70A 4BSVB 3O4IA 5ADOL 5HSFA 4U31A 3HG3A 4WI2A 1T20A 2UY6B 3QQ4B 1JHKL 1P5VB 4WEBH 5AVTB 2CRMA 2CO7B 2WBKA 4PRPE 3TBTA 4APQD 4NNYA 4TUKL 2AJXH 2NXYB 3NIFE 3VH0A 3S4SA 3GSVA 1E28A 4NENA 2OYLA 3E38A 4CDGC 1ZA3A 3CUPB 1SEBB 1QFWH 4LPUA 3KLSA 4QTIL 4CW1B 4PJHA 4WK2A 1DQDH 2YRLA 1OF2A 3NVNA 1KJ2A 5AW9B 1RFDH 2I9TA 2LLLA 1QUNB 4YHOH 1UD2A 1TFPA 3EGDA 4Y1SA 3TJEH 1T7VA 5DK0A 1PNDA 3V5DA 2K9FB 4HZAA 4P2RB 4RGOL 3OGOE 5C3TA 3D51A 4YZWA 2VDMB 4LQFH 3Q2VA 1KLUB 4F91B 3RBSA 3N91A 2EXTA 4F1ZA 3UZVB 2GK0A 3I8CA 4JDZA 4PJIF 3RTQD 3WLWC 3SDDB 5DJYA 4N2AA 3IFNL 2VN7A 5D1QB 4I8DA 4X5PA 4M5ZH 1HYRC 3QWRD 4R5TA 1M6UA 1DBMH 1J8RA 1PJWA 2OV0A 3MUJA 4WI3A 4YHIB 4LOVA 5F71A 4TSAH 3X2QB 1IC5L 3HG1E 1I9EA 2CXKA 3OJMB 4XAWL 1PY4A 1AACA 1NCCH 2V9UA 2CQVA 2X70A 4U1NA 3U30B 4U6HA 4OU3A 2EDRA 3KH4A 4NKOB 5CD3A 1XGRB 4Y1AA 5KG9B 3UAEA 3QEUB 5DVLA 2QBWA 2UZIH 3QZLA 2R2CA 2I5YL 1DBJH 1YUHA 3BIBX 3FCTA 3K7UA 5LNEA 4MB5A 1U3HD 1RJZB 3WFHA 4LBEB 5EDXA 2OI9C 1AZZC 4ZO8A 3TP4A 2PO6C 3U0WH 4FXGA 5K1CC 2ZNWA 4E36A 2A77H 4GAGH 4XNZB 2OJ1A 1LQBC 4YSAA 1GKOA 5TEEA 1UZ8B 2UZYB 4CC4C 5KYYA 4N22A 2CPUA 4PJCA 4JZJC 2V5MA 5CHNA 4ZOXA 2HWZL 1FLTX 1N0LA 3QUMB 1JTDB 4PJ5E 4ZFGH 2IUPA 5LGJA 3FSOA 5DTFA 4YBQC 3MV9B 3QK0A 4QHLA 1IM9B 3DRQB 1LHZA 2BVQA 1TENA 3B2UC 4J73A 1D9KC 1K3IA 1NFIA 2ZTBA 4TUOA 5IQ7L 3RNQB 1RMFL 2AEIT 1AZRA 4ORZC 4NRYA 1B0RB 5DO2D 4NZTL 2ATPB 4GQ2P 3V4VH 5DHVB 1NIFA 4Z77B 3VH8A 1NOLA 1IC0A 3CK0H 3HE7C 5I15H 1FYTA 1X7QB 2EH8H 3P2TA 5FKPA 3QFJE 3B7YA 4AMYA 1YN7B 3VGEA 2GQHA 2NXZD 4UAOC 3WJJA 3ZE2E 1RY7B 1CK0H 3JTSA 3LNEA 4ZFZB 5IUCA 4HJEA 2P9RA 3MZKA 4LSUL 4PUBH 1TVBA 5ISZA 3GMRB 5C0ND 3ZRSA 2IWEA 2QV2A 3FOMB 5E6YA 3QPKA 2ZYHA 1VFBA 4N87A 3PWVB 2IO5A 2P8LA 1ZT7B 2A4EA 2LOEA 1YQ2A 4HX1A 1MAMH 3QQDB 1QFPA 1GYWA 1SHSA 1ZE3C 2OMTA 4U6YB 3I6LD 5ALBH 5DUMH 1F18A 1SXNA 2HUHA 3QDME 2IQ9L 1BF2A 4GY4A 4PFEA 5C0IA 1IL1B 1GCFA 2V5TA 5D2NC 4EI5A 3IMVA 1QWUA 2BNRA 4R8WL 2XTLA 1NCBL 3ARFA 4G80A 4B53A 1QKZL 1Q47A 4BHUA 5K9JL 2X7LA 1S5HB 5GHWH 4XBEH 3V0HA 3QFDB 5BZDA 4EZKA 4FFZL 4B9JA 1DUZB 4GP8B 3RZCC 3V9FA 4HFUL 4ZOZA 4R2GC 1OCWH 1OK8A 1MOEA 1WWWX 4NSKB 5CEYB 4OR1A 4C4KT 4GW5B 4AENA 3P4OB 4H25A 3M1OA 5B1KA 5JW3H 1MCWW 2D7OA 1XB3A 2Y7NA 4PV1C 3RVWC 2ICEA 1TITA 1BPLB 3P0YL 5HYJD 1AGBA 1WS7A 3BUPA 3L4VA 4KTDL 4WFEE 1XB6A 2YRPA 3UZEA 2DV6A 2WBJA 3CVIH 3UEQA 4WNQA 3A6CL 3RL1A 4RSYA 2ZOLB 5KVGL 3QO0A 1M42A 4ODSH 3U46A 3QULB 3K3QA 1GGUA 1YJDH 1HSAB 2ENYA 4IMKA 1KZQA 3BAEL 3KL0A 4LDCA 1R24B 5D93C 5T3ZD 2YPVH 4P2QB 4OF6A 5DZPA 2R8SL 1DQVA 2GPZA 2MWCA 1A9EA 1T0PB 4ZMOA 4BUGA 3DXMC 2QPSA 1JERA 2M1KA 1WPCA 1V3JA 2FJGB 1TYEB 1WQVT 3CIQA 5KW9H 4Y2DA 2FJHA 2R0ZH 5TTRA 3MA9L 2BFGA 1R3IL 2A9DA 1WD8A 4I9XA 4MDIA 3VG0H 4AM0B 3K6OA 5DHDA 1NFAA 2XWTB 4PWFA 5F3BA 4KROB 4P8QA 3ZDYA 4YDZA 5E6IB 1H3PH 5I24A 1WZLA 3TO2A 4N0YH 5DK2A 4OIAA 1V10A 5EMLB 5HI4C 3BVNB 2C7FA 1AI1L 2NR6A 4I0CC 1URZA 2CHNA 4WGVB 4XXCC 1AOZA 5HHMB 3DUHA 1YNKL 2P80D 4I9WE 1RPUA 3FJTA 4PS7A 3ODTA 3R18A 4RNRB 3JB9L 1XKSA 2PCFA 5FGCE 3OKYA 5HHPA 3IUJA 4QAWA 5AVWB 5AWNL 5K5YA 4U7AA 2WINA 2HLAB 2A6KB 1S7XB 4OGXH 4PS8A 3KWXA 2DWDB 4PTUA 5HHOA 4L1LA 5JHDE 1A3RL 1JHKH 1KCBA 1FFPB 3EGSB 4KPHL <