3SBRA

Pseudomonas stutzeri nitrous oxide reductase, p1 crystal form with substrate
Total Genus 174
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
174
sequence length
581
structure length
581
Chain Sequence
QKIHVGPGELDDYYGFWSGGHQGEVRVLGVPSMRELMRIPVFNVDSATGWGLTNESRHIMGDSAKFLNGDCHHPHISMTDGKYDGKYLFINDKANSRVARIRLDIMKCDKMITVPNVQAIHGLRLQKVPHTKYVFANAEFIIPHPNDGKVFDLQDENSYTMYNAIDAETMEMAFQVIVDGNLDNTDADYTGRFAAATCYNSEKAFDLGGMMRNERDWVVVFDIHAVEAAVKAGDFITLGDSKTPVLDGRKKDGKDSKFTRYVPVPKNPHGCNTSSDGKYFIAAGKLSPTCSMIAIDKLPDLFAGKLADPRDVIVGEPELGLGPLHTTFDGRGNAYTTLFIDSQVVKWNMEEAVRAYKGEKVNYIKQKLDVHYQPGHLHASLCETNEADGKWLVALSKFSKDRFLPVGPLHPENDQLIDISGDEMKLVHDGPTFAEPHDCIMARRDQIKTKKIWDRNDPFFAPTVEMAKKDGINLDTDNKVIRDGNKVRVYMTSMAPAFGVQEFTVKQGDEVTVTITNIDQIEDVSHGFVVVNHGVSMEISPQQTSSITFVADKPGLHWYYCSWFCHALHMEMVGRMMVEPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords Nitrous-oxide reductase
publication title N2O binding at a [4Cu:2S] copper-sulphur cluster in nitrous oxide reductase.
pubmed doi rcsb
total genus 174
structure length 581
sequence length 581
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.7.2.4: Nitrous-oxide reductase.
pdb deposition date 2011-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
A PF18764 nos_propeller Nitrous oxide reductase propeller repeat
A PF18793 nos_propeller_2 Nitrous oxide reductase propeller repeat 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3sbrA02
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3sbrA01
3UR4A 2FWLB 2DYSB 3QPKA 3IN0A 2PCYA 3T6WA 2IAAA 2PM9B 5IC7A 3RFHA 3RSEC 4J82A 2HJ4A 1OF0A 3DKHA 3FSZA 3VA6A 4FA5D 3WKQA 4Q89A 4YSDA 3S3BB 4F7KA 1K8KC 1SHXA 5LDUA 2IUVA 3EI4A 4GMBA 2W8CA 1L9PA 2RACA 2H9LA 2XYIA 2UZYB 3JAMg 4RH4A 1JZGA 1V55B 2EILB 2HX9A 4PSWB 4J84A 4X3EA 3AG4B 4GXFA 2GSMB 1ET8A 1EHKB 1GR7A 1N68A 1PZAA 2E86A 1GP2B 3C5MA 5CXCB 4CZYA 1JVOA 4X60B 5FKQA 5EMJB 2N0MA 3SLED 1JZFA 1L0QA 2YMUA 1KGYE 1W8EA 3TBCA 2P9KC 1WS8A 1PLBA 3FYIB 3X1EA 2Z2NA 4J78A 5CYKA 1BEXA 4QKTA 3WI9A 5B3SB 1XHMA 2YB8B 1AS6A 1QHQA 1XB6A 2HXCA 3SN6B 3UVOA 3PVUB 1DZ0A 4BH6A 4DP7X 4Y7RA 4GQ1A 3MXXA 4E9TA 2B5MA 2AH1A 4XEIC 1AAJA 5FKSA 3VH0A 2DWTA 4X4KA 3D12B 2IDUA 2AGYA 4JHUA 2UX6A 4CC9A 3QJVB 1JOFA 4YSRA 1JZIA 4J0WA 4LG8A 2FTAA 3QJRB 3OMIB 1ILSA 5I28A 3A0FA 1WA1X 5D4JA 5IY5B 4JSNC 4CI3A 3CDZB 5FQDA 2FT8A 4KNUA 1SHWA 2O9KA 2PM7B 5B1AB 3OM3B 5HE3B 4KO9A 2OIZA 1GS6X 1U2VC 2P9SC 5AFU3 2AVFA 2EIKB 3NJFA 2UX7A 1JVLA 1GXRA 1SHYB 2P9LC 1J9RA 3I2NA 4O3UB 2AGLA 5TK2A 3MZKA 4N14A 5I6PA 3RRMC 3SXTD 4GYBA 2UZXB 5I5JA 1ET7A 2HZHA 3SJLD 5IGOA 2HLEB 4E9QA 2H68A 4FA1D 4A0BB 2XUWA 3U4YA 3OKYA 2CN3A 3FS9A 1TEFA 3OMNB 2YBAA 3V7DB 1ADWA 1NPNA 2PPAA 3DIVA 5HYNB 3CIKB 3GREA 1TBGA 4E9SA 3ABLB 4J8GA 1E5YA 1RZPA 2B08A 1NWOA 3AH8B 1ILUA 4J79A 4A08A 2GC4A 5CXBA 1ASPA 2BZ7A 2IDFA 2YAOA 3EH4B 2HRHA 3X1GA 3WKPA 3X1FA 1IC0A 3ZWLB 1MZZA 1JXGA 3PAVA 2YXWA 3UVKA 4PNKB 2B3IA 4KOBA 1KCWA 5F7BA 3NVXA 4A67A 1S4UX 1HAWA 3HFQA 3JB9L 4KOCA 3I89A 4H5JA 4R7AB 5B7MA 1I53A 4L3HD 3X1BA 2IDSA 1XKSA 2P80D 1K32A 1F56A 1J9SA 3BWSA 2P80A 1IKOP 2TRCB 1ZDSA 4Q8BA 5PAZA 3BQVA 4M4RB 1RZQA 3MBWB 3V9FA 1SJMA 1WAEA 4XYIA 4A09B 1TEGA 2BWIA 4NB7A 4IA9A 4ES0A 2I0SA 3BG1A 4G71B 4YVUA 4CSZA 2CJ3A 3FGBA 3AL8B 4AI7A 1PZCA 3QQXA 4CY2A 1KV7A 4ERZA 1JMZB 4HZ1A 3V5WB 2UXTA 2ZOOA 1JERA 5B1BB 5TF2A 2PPFA 1AOZA 3AFCA 5EM2B 2CCWA 2FNWA 2VSMB 1BQKA 3DTUB 4G7SB 5B7FA 2HJBA 4X63B 2I85A 4DPAX 1SDDA 2YNPA 3DM0A 3SCYA 2P9PC 2PLTA 3NJLA 4QT8A 2WO2B 3FU8A 3IKOA 2X87A 3ULEC 3IJ1A 2IWEA 2PP7A 4FA9D 1AACA 1L9OA 3T71A 3I7NA 1R5MA 1XIPA 1PY0A 1L9RA 3EH3B 3IE9A 2IDTA 1J9QA 3TBBA 1CUOA 1PBYB 4O3TB 5EMMB 2YNNA 5FA5B 1KBWA 4PAZA 4LGNA 3H4HA 4JKNA 4ENZA 1BYPA 4W9ZA 7PAZA 3FU7A 4HALA 2B5NA 2H6NA 4HDJA 3SMRA 3IEAA 4YSQA 4JD2C 1ERJA 3TU6A 4J81A 3PVWB 2P9UC 4L9OA 4BXSV 1GSKA 4E5ZA 4PC0A 3RLMD 1TKWA 4TXVB 5B1JA 5GMKn 5EHFA 2W18A 3UKUC 3AG3B 4NSXA 4GY4A 4X61B 2YAHA 1N6EA 2AGXA 1NICA 2Y69B 3EI1A 3EWEA 2NRDA 2JFCA 1DYZA 2PBIB 5FLXg 3C9CA 4KFMB 1Q47A 2W88A 3JROA 4CY1A 3EI3A 4ERQA 4FA4D 2BW4A 2XL3A 4GP5B 4KO5A 4Y5RD 2OCCB 3PCYA 2AQ5A 4JSPC 4CSPA 2J5WA 3L4MD 1PI6A 1BQ5A 1E65A 4YSUA 4HAKA 1FA4A 3DSMA 3OKTA 2XXGA 4HCIA 4A7JA 1NIAA 1SNRA 1J9TA 1NIDA 2HKRA 1PMYA 4EF3A 5I6NA 1B3IA 2XVBA 1V54B 3FU9A 3JPXA 4ERYA 1EZLA 1MZYA 1A8ZA 1XMEB 1WS7A 2I7SA 2HESX 5H17A 1PF3A 5A2Qg 1SQ9A 5K1CC 3N2JA 3GYRA 4MK0B 4E54B 1KCBA 1JZEA 2OJ1A 2AH0A 2H47A 1RKRA 2J55H 3OL2B 4QQEA 3JZHA 4ZOZA 3NJIA 4L0PB 3QJTB 3VGZA 2IH8A 4AKQA 1MDAH 5C2WB 4A0AA 3UGEA 2TSAA 2B5LA 5JWZA 3RFGA 4QL1A 4DPBX 1NIFA 2CNXA 2AZUA 4G70B 2I3SA 4BL0A 2FJSA 3CVCA 5AKRA 1RI6A 3EI4B 2PPEA 1OCCB 5D4IA 3JT2A 3ABGA 2B4EA 4Z8LA 4IMMA 2J56H 1E67A 2ZONA 3NJNA 4ZOYA 4XYHA 1GS7A 3FSWA 4AEZA 1AQ8A 3FQ1A 4OZUA 3NT0A 2VSKB 3GFCA 4DP6X 2YNOA 1QNIA 1L9TA 5B1JC 4AKOA 3EMHA 2VM4A 3X1NA 5CYKB 1GG2B 4A68A 2IAAC 2UXFA 1E5ZA 1AZUA 2I3TA 1URIA 5TDHB 3FYEB 1AR1B 3SFZA 1CYXA 1R1CA 3SBPA 4O9DA 3AY2A 2HX8A 4YVNA 4ZK8A 2DV6A 2PPCA 2IWKA 2WSDA 3FPXA 5GXIA 2XX1A 9PCYA 1ZV2A 4P5SA 4E9XA 1CYWA 4BDVA 5C2VB 1M56B 2XWZA 1WA2X 2XU9A 3U25A 4AZUA 4BK5C 4JSXC 1VLXA 1AIZA 4MFHA 5AFAA 3V9CA 2HYEA 2AZAA 5AMSA 1A4CA 1MG3A 5HE2B 4GM9A 4CI2A 4GP4B 3CZUB 2BW5A 3K26A 4GP8B 3EHBB 2YXVA 1N70A 2Q5BA 4DP2X 2EINB 3K27A 5TEEA 4N4YB 3J81g 1OCOB 2BP0A 4FAND 3SWSD 1FFTB 2H47C 2BBKH 5HQGA 2H9NA 3PXWD 5EARA 2AGWA 3FQ2A 2BHFA 1HFUA 3I8CA 2EIJB 1SFDA 3T6VA 3ASNB 3OD3A 4KNSA 2AGZA 4BWTA 4A2MA 1X9RA 3CG8A 2YAQA 5PCYA 3FM0A 3OKYB 5IJ8E 3MKSB 1BYOA 4U7AA 1NDTA 1PNDA 2Q9OA 2YQBA 1IBYA 2H3XA 3S3DB 1IBZA 2MTAH 4FHLA 2BP8A 2TSBA 4A11A 3AG1B 3V9EA 5TK4A 6PCYA 2IUPA 4JSVC 2I0TA 2VM3A 4DP9X 3NVQA 3L45A 2QC5A 2CO0A 3EU7A 4A08B 2J57A 2QPDB 1OOWA 1OE1A 4L3GD 5CXBB 5FKTA 3JZGA 1OE2A 5EAMA 4EWRA 2OK4A 2MRYA 4PSXB 1A4AA 2GNQA 2OK6A 2GHZA 1M57B 2UXVA 5EALA 1X9UA 3H56A 4ESGA 3NP4A 4YSSA 4YVDA 3ZBMA 3RN1D 3ZDWA 2GC7A 3ASOB 1KDIA 4HIPA 3PSLA 1NEXB 4F2FA 2CE9A 3B7FA 4CZXA 4D6VA 2R7EA 2YAMA 3F3GA 1TYQC 2XX0A 1SF5A 2UXGA 2VN3A 5AJAA 3IIYA 1AZCA 2YAEA 3I8EA 4O1QD 3J80g 2PM9A 2AFNA 1M9WA 1JOIA 1ZIAA 2HKMA 4DP4X 3N55A 4GM8A 3T6XA 3PXLA 1XB8A 4FB1D 3DWLC 2GC4C 5AZUA 3UVLA 3KRXB 4U1EI 4QLWA 3FT0A 3SBQA 3UKRC 3NJHA 3AW5A 2J55A 2IDQA 4CI8A 1FWXA 3UACA 1AS8A 4K9JA 2XV0A 1MG3C 2PM6B 3S8FB 1YLBB 4GQ2P 5FC9A 1SF3A 5I26A 1GYCA 2H14A 3H4FA 1U4CA 1NPJA 5CXCA 2QPEB 4PXWA 3EI2A 2P9NC 2YARA 5B1KA 4BWUA 3UVMA 2AANA 3EI2B 3EG6A 4FAAB 4J87A 1NWPA 1SDDB 1L9QA 3MMYA 1E30A 1JZJA 2XV3A 3NJJA 3OQRA 4G72B 2VW7A 1AG0A 4N8UA 1A65A 3UADA 3DXKC 3ORVD 1NZRA 4ZOXA 2J56A 4ZN4A 1ASOA 1HAUA 2EBSA 2Z2PA 1AZNA 2BWDA 4YSAA 4GGAA 3RMZD 4CZVA 3L4OD 4NERA 3WNJA 4KO7A 4J73A 1IUZA 2H3XC 1VYHC 1BXAA 3GXUB 3OKWA 4YSEA 2VMJA 1AS7A 3CFSB 1PAZA 3FSVA 3KW8A 3NSCA 5I6LA 3WNIA 2A3TA 3FU7B 1A3ZA 2HX7A 1GY2A 4H5IA 4PCYA 4YSOA 3AZUA 2CO0C 4YSPA 3NJGA 5FXYA 3IBOA 4J0XA 4E5ZB 4AKPA 2PCFA 5HE1B 3BG0A 3CDZA 3SHFA 2FQFA 2FQGA 3MX0B 4DPCX 1NINA 1JXDA 1KYAA 2IUQA 5EAPA 3PAUA 2GC7C 4G7QB 4A2DA 2VW4A 8PAZA 3EI1B 1KDJA 5IJ7E 4WTQA 2H13A 3BVDB 3EI3B 4A2HA 4GGDA 3PSCB 6PAZA 1PZBA 1TU2A 1ZIBA 3ERXA 1N6DA 3N0DA 3JTBA 2FQEA 1P22A 1JZHA 3C75H 2Q7QA 2J57G 4A0BA 4NAJA 1SFHA 1A4BA 5FKRA 4J8BA 4GM3A 1JMXB 3SQRA 3ZIYA 4DP5X 3DXMC 4KNTA 3NJMA 1L9SA 3OW8A 2FQDA 2XV2A 2XXFA 4HCFA 4JHVA 4AX3A 4BWWA 3IIWA 3MZLA 3NJKA 2FT7A 4HHWA 2H6QA 3X2QB 3RN0D 2CUAA 4CY3A 2X88A 1UATA 1MG2A 1OMWB 2CN2A 4D0KA 3CFVA 2XLLA 2H9MA 5I6OA 1OCRB 5I6MA 1GOTB 5C9ZB 4CI1A 4L1QD 5B7EA 1PEVA 2MTAA 3I7OA 2GIMA 1PLAA 4E9WA 2QXVA 3EF4A 3SBRA 4G56B 5THAA 2JXMA 1ID2A 3ABKB 3WIAA 1YFQA 4GZ8A 2ZXWB 1OCZB 1OE3A 3T9WA 2XU7A 3QJUB 3KW7A 4A0AB 5EMLB 3NP3A 1BAWA 1AANA 1J5DA 2QDWA 5A7EA 3FQYA 4BUJC 1PLCA 1B9YA 3AL9A 1BQRA 3AG2B 1ASQA 1CC3A 3JZNA 1CURA 2GB2A 4JT5C 5ANHA 1PCSA 2OVRB 4A09A 3GDCA 1W6LA 2BCJB 4A2EA 1BXUA 1XB3A 1J5CA 2XL2A 2YAPA 4YSTA 3AL8A 1W6WA 3TA4D 3JRPA 4JT6C 3OMAB 5EMKB 3SVWD 5SXMA 5D4HA 1PNCA 2CAKA 3RYMA 4W1TA 2FT6A 3NYKA 4UI9R 1AG6A 2XYBA 1NIBA 2QT6A 3PAZA 1JXFA 4YL4A 1NTDA 4DP0X 4FWWA 4JXMA 4TZ4A 5EM2A 1SQJA 3IN2A 5I5MA 4G7RB 4A2LA 4CY5A 2HRGA 1ET5A 2BO0A 3HB3B 4E9VA 7PCYA 1BXVA 1NR0A 4UF7C 1T5KA 3PPSA 4A2FA 4O45A 5GSAA 4HCGA 3E0CA 3ZX1A 4BDVB 3ODTA 2Z2OA 4QRJA 4A2GA 4PBYA 3I7LA 4J77A 4K3ID 5KDOB 2PP8A 4F2EA 3NVNA 2LLNA 3TASA 2G9AA 3F3FA 5HE0B 5IGQA 3OTTA 2DY2A 3UVNA 1GS8A 2Y1AA 1V10A 1A0RB 3PXTD 4PBZA 4P5RA 4KO6A 2H9PA 2G99A 3T6ZA 3F3PA 1MG2C 4GQBB 5TEFA 5H14A 3UAAA 5B4WA 4I79A 2IURA 2CBPA 2JKWA 2CE8A 2IH9A 2BP0B 2VW6A 3FSAA 2WO3B 3ABMB 2H5UA 2DYRB 3FRXA 3IJ0A 1PGUA 4E9YA 4ZOVA 1GY1A 1OV8A 3HEIB 5I6KA 2I0RA 3UAEA 4AOWA 3CVBA 2DWSA 2ZWNA 5F7AA 1N6FA 2OJYA 3I7HA 2CALA 3I7KA 4UANA 3P4FA 2QDVA 3NSYA 2IWFA 2YAFA 2PP9A 4HHGA 4M3HA 4FAVD 2BZCA 2GBAA 3UABA 4BXVA 1ZPUA 3PXSD 3CVDA 1ETJA 1KBVA 4FA7B 5IT9g 5E9NA 3NSFA 4A11B 1ZDQA 1NIEA 2BP8B 3KRWB 4GGCA 1MDAA 2GI0A 3QJQB 2H6KA 4DP8X 2HXAA 1AZRA 3FPYA 2I7OA 4A66A 4E9RA 2P9IC 3N0EA 2OVPB 4J86A 1JJUB 4OWRA 3MKQA 4LG9A 3NSDA 3QJSB 4UAHA 3C99A 3WG7B 1AZBA 1OLZA 1WA0X 4WKXA 5H1MA 3W15A 5GXHA 4K3JB 1QLEB 3PE7A 3C75A 3PLYA 1RCYA 1B9XA 2OV0A 3S3CB 4YSCA 4DP1X 5K19A 5I5IA 3IJCA 1GW0A 3EH5B 2OVQB 4E54A 2EIMB 2PPDA 3S8GB 3OL2A 2R7EB 3I7PA 3G5WA
chains in the Genus database with same CATH superfamily
2OMBA 2IXQA 1ZANH 2D7PA 2YC1A 2WNKA 2LU3A 4HJJL 5SV4A 4XBPB 2RA1A 4ZFFB 4BEIA 3I02A 3M8OH 3QO0B 3DPBA 5DHYA 4UTBA 2ADIB 1U91A 4LGSB 2KLRA 1CFBA 1SEQL 5C0AD 3KPNB 1FSKB 5C0AA 5IHLB 3ILEA 3FCUB 1GRWA 4P2QE 4DTGH 4ZMXA 4IK7A 1WP6A 2BNUB 2XACC 3H9SB 3E8UL 5FKQA 5MEPB 5C0JA 3MYZA 5TGBA 1KN4L 3P2BA 3PWUA 3TBCA 1KCVH 4XE5B 1XEDA 1MCFA 4ZAKD 5T3ZL 2HT3D 3RX7A 4BKTC 2CGYA 3A3YB 4NWTH 4ZAKA 2EACA 3IS0X 3OWEA 5ERWA 1IU1A 4UQ9A 4APQB 2CO3A 1HHGA 4LP8A 8FABA 1IQWH 1T3FB 2FO8A 3MNZA 4R4BB 2OMYB 3DSNB 2DLGA 4ZUWA 1FNHA 3MGTA 3NA9L 4X9GA 2WN3A 1KT2B 2NXZB 1HNGA 4BE6A 2Z65C 3K6SA 3NH7L 3PWLB 5GZOD 3QFGA 1CDUA 4FLHA 4W9HC 4W9LC 2FIRT 4UILL 5GZOA 4NCDA 3ESPA 1N8OE 4N2FA 4PQXA 3FULA 4P0DA 1CPUA 5INDA 1MHCB 4HH9A 2Z7WA 4F8NA 1PQZA 2OYLA 4U6TA 1SHYB 2XY1A 3L16A 4X4ME 3SGDH 4J4PC 2Q6WA 3T3PA 2GJ6B 3ZKXB 1OPOA 2A73B 4OQTL 2XUWA 1MUJB 1N10A 1IGCH 3JT0A 4Q74A 3GFUA 4BFIB 4N2HA 4PJ6A 4XNUH 3SDDC 1YEHL 4DKDC 2CRZA 3TBTB 3TCXA 1GJIA 2R0KH 2Y1YA 4BK4A 5IEHB 4PTUA 2OXHA 5CXBA 3EH4B 4MB1A 2QPFA 1FL5B 3WUWA 5HI3D 4IBUA 1QQDB 5FYJL 2DQTL 1J12A 4XX1E 1P9MC 1P2CA 4WWKB 4XP6L 4I2XE 3U36B 4BZ2A 2G0KA 3IDYB 2RFXA 3CIQA 4LSSL 4O2EB 4PVNA 5DZLA 5FKAB 4F7PB 4H5JA 4R7AB 2F9BT 1NUGA 5EZLB 5F9AC 1XR8B 3BLPX 4ZXBC 4DKFL 4MQ7A 1QI5A 2XG4A 4M4RB 1NUNB 3KPMA 3MBWB 3ARSA 4QY8B 1OAQL 1Q4NX 5DJ8B 5ITFB 1WAAE 2QHLA 3RFZC 1FGVH 5JQ6L 1HTYA 2QTEA 3AVEA 3N9GL 2FD6L 3RHWF 1VKXB 3HCVB 4X0KB 3IXTA 4BCXA 1BQKA 3ULVL 4TTDC 4X63B 2FRGP 1UKTA 1WC7B 3JWNC 1KPRB 3C6LD 1KFAH 4BSWA 1HOEA 5BV7H 2FWOB 1E28B 2ROXA 3C6LA 1RAMA 3IKOA 3ULEC 1Q9WB 1I8MB 2NY6D 2FWUA 1PDKA 1H0DB 4OD3H 1UCBH 2D3LA 3EH3B 1R6VA 3W0WD 1CUOA 2ENPA 2NLJB 5HJGA 3W0WA 2X4RB 2PCXA 2Y7QB 5L8KB 1T89C 4AIZA 4AUJA 5DYOB 4M6NL 3P02A 2P9UC 3MYJB 5EU6D 3F05A 4XHJD 4AQAB 1NCDH 1VE6A 1XIWD 1TKWA 5J56B 5B1JA 4P5MB 5EU6A 1U0QA 1UACL 1XIWA 4MSWB 2IPUG 3ULVC 2YAHA 3LYRA 4PWJA 2F5BL 2NUPB 2Y69B 1N4XL 1QHPA 4OCRL 1RK1A 5KVDH 3ESOA 5AVWB 3FZUC 3FTWA 4Y1AD 4GP5B 3C6EA 4WK0A 4Y1AA 5F7WC 3ZE0B 4JSPC 1CIDA 4HC1A 1I3RB 3H9SE 4L1SA 3IWUA 4G80B 2P5ED 3RVTD 4YXLL 3P2DA 3PGDB 2X4TB 4H5SB 1V54B 3EOAA 1U8LB 2K9UA 3VXTA 8CGTA 1B4JL 4PVMA 5J3HC 4LOUD 1WS7A 1OAKL 4LU5H 3DECA 4TUOA 3RGHA 3ZQWA 5TPWH 2YPVL 1UD3A 2W9LA 5L7XH 5HDLA 1KJ2A 2VDMA 1FYTD 2AH0A 5J1SC 3OL2B 5KAQF 2J21A 1JF1B 3NJIA 1FZOA 4KJWD 4F7EB 5HI5D 1C9SA 4KKZA 4KFZC 3ATDA 5F7EH 3TX4A 1RJZA 2TSAA 2X9ZA 1IRAY 2GBVA 1WISA 4IBYA 4PBDA 4S2SB 1UZ6E 1VESA 3ZYZA 5EB9A 2X6CA 3SDDB 3D6GA 4FJ6A 5SX5H 4Z8LA 1SYVB 2P24B 3VFTB 1GYAA 1K8DA 4MCYA 4ERSL 1PJWA 1M4KA 4DP6X 3R7RA 3KXFA 1FRGH 2BMKA 4MTMA 1U92A 3S8WA 1EZVX 4WI4A 5IUSA 3QUXD 4JEGB 1JRHH 3MRRB 3QUXA 3HC0B 4D9LH 4YXHH 1A6AB 1D5MA 1E50A 3K1KC 3Q1SH 5I1EH 2PPCA 5FWRA 5I0ZA 1H5BC 4MNQA 4ZXBB 4N8VB 2Z34A 4JZNB 2DMCA 5DFAA 4BDVA 3KYNA 4GW4A 5E9DB 2XU9A 4C4KO 3OKLB 4K4KA 4MHHG 4JJ5A 4JSXC 2CBMA 2BSSB 2R56L 2DQUL 4GRLD 3UCRA 3KLQA 2J1ZA 1BDYA 5IB3A 4GRLA 4WI3A 3S6CA 5JW4Q 4RLDA 3MCLH 4LSTL 5HJ3A 5DEFA 1NGWA 3HLAA 1I7ZA 3PHOB 4N6RA 4XNXH 3HI5L 4ZSOA 4QXUH 3PXWD 3GMNA 2B1OA 4MB4A 3RRQA 2D31A 3UROR 2CDFA 4KNSA 1V7ML 1KG0A 5FM5M 5C86A 2XWBB 1A1OB 1X9RA 1COBA 5DD3L 5FYLD 3OLGA 3IJ9A 5D1XA 4U7AA 1WAAF 3X11A 2ATAA 2AJVL 4R97C 4TL4A 3MKKA 4M93C 2CHDA 3T3MF 2VLRA 4PHXA 2JJVA 3UP6A 4LLQB 2J57A 3IU3B 5C07D 4Q9QH 4BZ2L 1JNLL 1ZK9A 3O41B 3OXRB 3UG5A 4EWRA 5C07A 2CJUL 4XVJL 1HHJB 4NCC2 3D69A 1GJUA 1PCXA 4C56D 4C56A 1FFNA 3FUDA 2R29L 2J8UA 4WW1B 3IGKA 1BEYH 3HB3C 2DS4A 2WNXA 3DXAA 5DJCB 3B7SA 4R7LA 2AHIA 1H6FA 5CZXC 3EO0A 3EXJA 5D5MA 3GIVB 3O3BA 4H8PA 5FDYA 4MD0B 2CXGA 2IAMC 4RMSA 3NIGF 1DR9A 1IAKA 4LDCA 4S1DC 4CI8A 1S9WB 1U2CA 4JMXA 3UACA 1AS8A 3MRDA 1UASA 2KL6A 1YLBB 3Q01A 1NGPL 2C4FU 3L2NA 3CDGA 4Q9CA 3G6DH 1JZ3A 4U1LB 1I82A 4OJDH 2AAVA 4L4TB 4UQEA 1G1OA 5TE4L 4HUKB 2F58H 4N8UA 3WNPA 1A6TA 4GMSL 2G75B 4OB5L 1B2YA 3Q5TA 4OZHA 2ENQA 4TVSa 5D1QD 1YY8A 3ZDYA 1HAUA 4PYGA 4UNIA 5AW5B 3RMZD 3KCPA 1IL1B 1BBDH 3ROLB 2H3XC 5FO9B 3K74B 4NN5C 4DEWA 4PWIA 4TUKL 1AS7A 2KI6A 3CFKA 1IZJA 3FSVA 1MCWM 4PSRA 3RG1C 3WNIA 1P1ZB 3FB8A 32C2B 1NBZB 1WTLA 2HLFD 3AZUA 4XCFL 5BOJA 1CL7L 5E70A 5T3ZE 4UQ2A 2E7DA 2OXGB 5I1KL 3WFEL 1WIOA 4WVRA 2X1WL 4RISH 4KK8C 2ARJA 2WANA 2GC7C 2QBWA 4EEEA 4PS7A 3I9PA 2JJTA 2XE4A 4IOFC 3BVDB 1A21A 4ODXA 4BV1A 1UZ6F 3SD2A 2XWCA 4HK0B 2JB6B 4JDZB 1H5BB 2UZXA 4U6VH 2CGRH 3MV7A 1FH5H 3O3EA 4JDEB 3AABA 4XPTL 3EGDA 3RKDD 4G42A 4I85A 1JMXB 1V3KA 1PY4A 1OAXL 3NJMA 4JZOA 3UTPD 5ADOH 4M7KL 3FUIA 4FA4D 3F12B 1AVAA 3N1MC 3K0WA 4HUUB 3ZUCA 1KJ2L 3X2QB 2VDML 5D93B 4CY3A 4D9SA 5FAAA 3LH2H 3QHYB 1U36A 3QQ9C 3IXAA 5TQ2H 1QSZA 3Q13A 4JO1L 1AGCB 5C9JA 5THAA 2RJMA 2Z93B 1URZA 4KK6D 1OCZB 2XU7A 2AMUA 4RMBA 5EZIL 1UXLA 4IK6A 2ALWA 3HA0A 4Y5XA 3SJVB 4OI9A 4G55A 2R0ZH 3ZTDC 1B9YA 3AL9A 3X14B 3AWFA 1ZD6A 1PG7W 3V4VL 2B39A 4Z76A 1BGXH 1HCFX 4O2FA 2VDQH 4R97B 4M93B 5FYJE 1X5IA 3O2WH 3JWNE 2XFXA 5TFSH 3CZSA 3CZLA 2G3XA 3LZNA 3K5RA 2XBTA 2C1PA 3D2TA 1T2QH 1E5AA 2L4OA 1IBHA 4RNRB 2H6PB 4LSRL 3ZR5A 2ADJA 2AV7B 3HB3B 4JUSA 1TJIL 5AWNH 2YKKA 3AROA 5DHEA 5EU5B 3M17A 4F20A 4TSBL 3WFZA 1CF8L 3SKOB 2CHWA 4QRJA 4IGBC 2IAMB 2LFGA 2PP8A 2WNGA 4J6IA 1R5IA 4HKXB 3C2SA 1A0QL 2ZUWA 4TM9A 1ETZB 5T1LB 2EZ0C 1AMXA 1RIHH 5CN2A 1I1YA 5DWUL 2IURA 3VFOB 1BAFL 3QA3B 4GFXA 3FSAA 5EOTA 1UWGH 1CD0A 3MLPA 5BZWA 4WJG3 4HIIA 4MA8L 4OZFA 1P7QD 1OF2A 3T2LA 4C4BA 2OCJA 4HWBA 2IEPA 1P7QA 4CNIB 4IBSA 2ZAGA 2OJYA 1PX8A 4ABUA 3HS0C 1CMOA 3NSYA 2B15A 1B0GB 4HHGA 1UB6B 4HPYL 4OJFL 4EIGB 1YQVL 4HFUL 3S34H 1OT2A 1HINH 2GI0A 4NLHA 1RZIA 2H2SD 5EC2B 1F18A 4MVBD 3NIFA 3DX6B 4KKAC 4UOJA 4X8XA 4F92B 1V3MA 3DVGB 4FI7A 3AITA 3DIFB 4FQCH 2AV1A 1BP3B 1U8HB 3MCKA 2DI9A 1DLHA 2RCSL 4RMRA 2ZSWA 4CU6A 1CZ8L 5M5UA 4KHTH 2DMKA 5CJBA 3EO9H 3T6WA 4JREB 3RGVD 1JXKA 5AG9A 4N2NA 3JWOL 1WRFA 3RGVA 5A6IA 5I1JL 1K8KC 3KWVA 4IRJB 1L9PA 3EGSB 2UZYB 4M43H 1T66D 3FFOA 1EXHA 3SQOL 1JPSL 5FF6A 3C5JA 3AG4B 2GSMB 1N68A 2AABL 5AOLA 4RBPK 3L1GA 4R7NA 4MXWL 5JMOC 1PLBA 3V0VA 1A8JH 2NNXA 3DX8A 1T83C 4E2OA 1QHQA 3FCTA 3UXFA 2WLLA 1DZ0A 5AYTA 1MJ7L 1SOKA 1HXMA 3MXXA 2IALB 1CGSL 4TVPH 3S96A 1D7BA 3RX9A 4PBWD 2A9DA 5BJTA 3JWOC 3KPLA 4AVKA 1L6XA 3LKNA 4HSCX 1N5AA 1MSPA 2IDUA 3G5YB 4M1GL 1WFJA 4NC4A 2F7RA 4I18C 4ZTPH 3U4EB 4XNDA 5E6ZA 4IRSC 2WXJA 3KYAA 3OMIB 5GGQL 5EEWA 5KOMC 3GSQA 5D4JA 4P5KB 2YRPA 1DSFL 2VERA 3GWJA 4H0GA 4W9EC 1MRDH 1IAMA 4DK5A 1X44A 1X4ZA 2KKQA 4KX7A 4YFLI 5J6GA 5I17B 1I85A 3SJVE 4ZNEE 2WQAA 2P9LC 2DQEH 2XTJE 1GPOL 3PREA 5L4MA 2QVTA 3D52A 4CDGC 3OHXC 3G3LA 4M8QA 2K6ZA 1TETH 5I5JA 2EDNA 3GIZL 3OMNB 4IGBB 3SY0B 4ACTA 2FHCA 3UBGA 4MS6A 1S78D 3V4VB 2YEZA 4BQCA 1QP1A 5JLZA 5DJYB 3MBXH 1RZPA 3LIZL 3IGFA 4WFHD 4OJAA 5KVFE 4LVNC 4IW4C 1CWVA 3NFNA 3MAWA 2F8IA 5HHQA 1M1XA 4AJ0A 2IDFA 4Y4FD 4HQQL 3PP4H 2FIKB 5DJ2B 3GS0A 3SQBB 3WHE1 1DJZA 2IPTH 4Z7UA 4OM1L 4CVZA 3UVKA 5HY9A 1CTMA 3U1PA 1TTRA 3QQDA 3KM1A 3DA0A 5GRUH 1S4UX 4M4PA 5CBAA 6TAAA 5GS0H 3HS0B 2PTTA 3X1BA 5LGKA 4UB0L 1MHPL 1F86A 3BT2L 3ULVF 4ZFZB 2IH1B 1M2VB 1IKOP 3KPRD 3BE1H 4Q8BA 5JXED 3KPRA 5A2AA 1WAEA 5JXEA 4YR6B 1Q9OA 3MLXL 3WDJA 1UM4L 3ZT7A 1UWFA 4IA9A 1T1XB 3IF1B 3ZDXB 3MGOB 3NACH 2O5ZL 1KB5B 2J72A 4X9IA 1F4HA 3EJYD 5EA0H 3UTZB 3L08A 1TPXC 4MXVF 2VSCA 3UJIH 3S4SB 4P9HL 1KG0B 4JVUA 2F8OA 4R90H 4CC4A 5B8CC 1MJ8L 2P8LA 4Q97A 2BVPB 5E6RB 1C5DA 3DJZA 2DD8L 3MOBL 2VLRB 4HS3B 1AACA 5AOIA 1DN2A 3KPOA 2IDTA 3BO8B 4O9HL 3HAEH 2WLKA 4K7FB 2YNNA 3S7GA 5EMMB 3ESUF 1RUKH 4JFZL 4PAZA 1OWWA 1SMDA 3L5JA 4KTDH 3DDGA 1THAA 1BYPA 7PAZA 3KDMA 5KS9B 4J81A 1XF4A 1PX3A 1C8PA 1UOOA 1GSKA 2OR7A 3OJDB 2W07B 4HT1L 3DXAB 3P9MB 3MCYA 5F96L 4JHWL 4LARL 5EZJA 2C9QA 4FL4C 3ETTA 2IV8A 2J5LC 4NHCL 4LAJH 12E8L 5FK9A 3VXRB 3IJEB 1Q38A 5AW0B 3JROA 5DC0A 3HRPA 4WI8A 5I73B 4XPBH 5I71C 4XP9H 4CSPA 5GSRA 4N1CA 2JJUA 4ZS6C 2BC4A 2DQCL 3A6OA 1KTRL 3RFRA 3LKSA 3TFKC 1IM3D 4I18B 3O6KH 5IW1A 4IRSB 2G2NA 1VAHA 2Y23A 1IM3A 3WJLA 1UGNA 3BGMB 1I2MB 3BWUC 4JCLA 2F7PA 1ANUA 2JKNA 3F00A 2XN9D 4H0HB 3ALWA 3CTTA 2X5PA 1EZLA 4UV7L 5MEOA 3JPXA 2D7NA 2XN9A 4E5XA 3DI2B 1UGKA 2R4SL 4JFQA 1D7DA 4XCNB 3VWKA 2X6MA 4EN2A 5EBWA 4ZX4A 5LJYH 3CUPA 5DJZA 1E4KA 1R3JA 1TF4A 1T2XA 4B9FA 3B9EA 2MMXA 3OHXB 1A4JB 5I8OL 4A38A 4AV5A 3D4GA 4P46D 3EJTA 2MKLC 1OY3B 1IEAB 4W9IC 3GBNL 4NFCA 4P46A 1DQQB 2Y24A 1A9BA 4RMQA 4L37B 4M5ZL 3VXPB 1TENA 4AGQA 1KYOJ 3CH8A 1CS6A 4YE0A 4ABVA 1QEWB 4IMMA 3FUMA 4LVNB 4X7TB 3DIDA 3IJ8A 1MRFL 4LVOC 1UM6L 5FYKD 1AQ8A 3H3KA 4RCAA 2CMRL 3GMRA 5IM7A 5ECGA 5TTRA 3VWJD 3LTVA 4TLKA 4Y4HC 3VWJA 5CSZA 2XA8H 1QACA 2VR8A 3RWGB 1AHWA 3HR6A 1R1CA 1N64L 4PJGA 4Q14A 3L5WB 4DGYH 4KMQA 4OLVH 4MDJA 3WO4C 2VZ3A 3RNKB 4TULL 3QXAA 2XETA 1ZV2A 2IDCA 2GSGA 3AAZA 1M56B 2CLRB 2DTMH 3FU0A 4XB7A 3UO1L 1WBYB 3FN3A 2FLRT 3ARRA 2K8MA 2A1WH 3EJQA 1A4CA 3WS6C 3ARDB 4PGCB 3BWAB 1BZ8A 4HPHA 3P0VL 1TPXB 2FGZA 1HDMB 1W15A 1XF3A 4DKEH 1SJEA 4IJ3C 3QAZC 5B8CB 4KJQC 3RHWK 2ESVB 5EIIA 5DC4B 3ZJAA 2WCPA 4QHUB 1VHPA 4JUTA 4BCBA 2EXWD 5SWZA 1VKXA 2WC7A 4B3VA 1KN2L 1JS4A 1RJLB 5I30H 5IVZA 1WBZA 1KXQA 4OCXL 2ZUQC 4Y5VC 2NY3C 1WZLA 2DMBA 4BGLA 5KBLA 3BW9B 3D25A 2Y06L 3LDBC 5ACMA 4G3YL 3OZ9H 1AMYA 3JZGA 3CAFA 4OZGB 2JJSC 3MOAL 3GKWH 5AW9B 3IDNB 4IU3B 1J8HB 3ILQD 4TLTA 2KT6A 1KB9J 1RZJH 1YUHA 2V3FA 1X5XA 1Q9LB 3KPSB 4FL4B 2J5LB 4MJID 4ZUVB 4OIBA 3KHOA 4XNZC 1IKNA 4MJIA 2DWEB 5J12C 2QELA 1T4WA 5DUPL 4Z7NE 3BUTA 2EO9A 5I71B 5KS9E 3TBWB 4NZUL 3NZ8B 4U1IA 4MB3A 5HYIA 3L3IB 4N9GA 1KYOK 2EP6A 1ZANL 5AZUA 3UKRC 2KPNA 3AW5A 4PFEA 3M8OL 1GCFA 4UDUB 4N20A 4L18A 2CHNA 2AJZA 4A7QA 3VXRE 1LILA 3Q43A 2VZSA 4DTGL 3NSXA 4BWUA 2QMKA 4JN2B 3PABA 4W9GC 4XCYB 1WAPA 5FUZL 1KIPB 1A65A 1F5WA 2YPKB 4HUCA 2ZP9A 4CMHC 1JCVA 1KCVL 3NIFB 4NERA 5F7FA 2EDTA 4NWTL 4YZFE 3M6DA 4WHDA 4OAWA 3D0VA 4QOKD 4QAMA 3IS1X 1IQWL 4QOKA 3EJCA 3QXVA 5ABAA 5T33H 1SXCA 1O7DC 2DJ4A 1DVTA 3CVHB 3F62A 5KBMA 5DUMH 4LVOB 3IDXH 4W9CC 5C0GB 4XOCA 3VG9C 1QMUA 3S5YA 1NINA 4FNQA 3RWFB 4ZPVA 2Q7NA 4Y4HB 4Z9KB 3IPEA 3EI1B 1A4KB 5JW4N 3NTCH 5AOKA 3QEHA 4JAMA 1NGXA 4RA3A 3UTSA 1AGDA 1EEQA 3BAIA 4IMLB 1PG7H 1TTGA 1TU2A 3WO4B 5DQJB 4LB8A 2I69A 3GSXA 3H6JA 4NFBA 5GPRA 5JHLA 2EDDA 4OIAA 5ESVA 3RIFK 5CCHE 3MRBB 4KJYA 5DRZB 2YKLH 3VH8B 4GM3A 2MHAB 1T7ZA 5KEZA 4I13B 3OKEB 3RVVD 4R2GD 2P5WD 4FQQA 1S7WB 4EI0A 3MRFA 4KTGA 3RN0D 2P5WA 2CUAA 4HJTA 3FSOA 4XNUL 2WLLB 2CN2A 5JYMA 1LLAA 2JCCE 4XC1H 5HHOB 1YNTB 1WDAA 1OTUC 3QAZB 4YGVA 5DO8A 3C5ZD 1NL0H 1PIGA 1KB9K 3G08A 1SVZA 4HZAA 4LCYA 4N86A 4HD9A 3DX7A 5CILH 5E08H 3KMDA 5CIPH 4A0AB 1VRSA 4U6YA 4IBTA 3SBWA 3RURA 1A9EA 1KTDA 4XNMA 4FTDA 1SJXA 1KLFB 2VABA 4Y5VB 2YFNA 2NY3B 3AS1A 1U8JB 5HBBA 2F0CA 4AITA 3VWKC 3LDBB 1XB3A 1MKFA 1E4KC 2ESVE 4GRWB 1UXMA 3SVWD 3ZKSD 3UMTA 2Y2TA 4ZW7A 2PR9A 4BD4A 4Y9BA 4OJYA 1FGVL 1BWWA 3ZDXF 4U1NA 2YLKA 4XNZB 2WBXA 3RE0A 4BHUI 3IDJA 5J12B 2AXFB 2OTPA 3L48A 4KK9D 2OMUA 2MEJB 3PPSA 3LS4L 4GJTB 4LEXH 3OGOE 5IQ9A 5BV7L 4OZGE 2IG2H 3LRSB 2EVGA 2ZXAA 5DRNB 4F9LC 3NVNA 3LNFA 1J8HE 2H4EA 2DY2A 2LHAA 5T1KD 1CXLA 4QDGA 1UCBL 4TUUA 3KPSE 5T1KA 5CEZE 4F1SA 3CSFA 2DQGH 3VI3B 1DHKA 1M05A 1V7NH 2X9XA 3GK8H 5C0FB 5IQMA 2AJUH 3T1FB 3PE9A 4MZ3A 2APVA 4QTHA 3HI6H 3F7VA 3IMTA 3P4MA 4G8FB 3I6LE 1CGTA 3APFA 3EDKA 1H6EA 4QRUA 3SSGA 4ZMQA 5J89A 3MLRH 1OV8A 1U8NA 4J3UA 4QRPB 1NCDL 4RGNC 5KS9F 4F24A 2I0RA 4KTEL 1J1XH 4CMHB 2QDVA 4U1KB 3HUJA 2ZUYA 1BD2D 1G6RA 1JYVA 2ADFH 2GBAA 1CGXA 1BD2A 1ETJA 1FL6B 2PMZA 5LNGA 2AERT 5DLMH 5KVDL 5BV7C 5L9DH 5ILTH 4A11B 1DFBH 3BVWA 4PSPA 4XP1H 2HJLB 1WIPA 3WLWD 2AKRA 1GSMA 5CFHA 3MR9A 4IKNA 4XN9A 2E7MA 2OR9L 5CJQH 5HYFA 3VVVA 1TVDA 1VGKA 1WA0X 2WBWB 1Z5LB 3TP4A 1NCHA 1OALA 1R34A 5HJDA 3B9KB 4PY7B 3VRJB 4ZMTA 4IYKA 5F97E 2I9TB 3ILPA 4YZFF 2DEYX 4LU5L 1OAYH 2BNRE 3QUYD 2JQZA 4LEEA 5TPWL 2MOGA 1HWWA 5L7XL 3QUYA 3STLB 3E3QC 2EKJA 1T80A 3AS0A 1KJ3H 1KXTB 3QZOA 4XMPH 1G7MB 1L9NA 2OMNA 5F7EL 1SHXA 2D3VA 3DETD 2VRQA 1V55B 3BFQG 5GRVL 3KL5A 4OW6A 3STBA 3KYMB 3NRPA 4JDVB 3GXTA 1KMGA 3FOMA 3PDDA 2NW3B 4GI8A 5DVNA 1EAPB 3VD0A 5I1HH 3GJFH 3WYRA 4HD5A 3H1ZA 3QAQA 4HBCH 2VDQA 1UT2A 2X1XR 3FT3B 1FRGL 1F1GA 5FFLA 2E5EA 1R47A 2XQBH 3RX8A 5IW1B 1JRHL 2MQGA 3HZVA 3KEDA 3IRPX 2CA4A 5CZKA 4U7MA 4D9LL 1P7HL 3VH0A 2YS4A 4Z0XA 1HEZB 1UKSA 4YXHL 1XZ0A 3VD7A 3S3JA 5TDOA 2OMZB 5I1EL 3Q1SL 3THMH 4UMSA 3G6AA 1UVQA 3PP3H 4J0WA 3NABH 3QJRB 1M7IB 4KY2A 2EABA 3ZXAC 1QEXA 2VDLB 4J2QA 5IY5B 1UXSB 1JWSA 3OM3B 3QI0A 3T0EC 4DGIH 3TPKA 1HH9A 4B7LA 2CK2A 3TZVA 3MCLL 4XVOA 5EH1A 4FNLH 4PJXB 3TV3H 4BSJA 1MI5B 2BVOA 4XNXL 3QWNA 3W1ZA 1MCQA 1FAIH 1T4KA 4QXUL 2HLEB 4X5XB 5TDNB 4GRWE 4XRCB 1HXYB 4KUCF 1ADWA 4RIRA 3DIVA 5LKNA 1KLGB 1RIUL 1HKFA 1YEEH 1NWOA 4UU9B 1YY9C 1YA5A 3ZPDA 4IDLA 1XSOA 2GC4A 1C8QA 2WTPA 3TF4A 3AMKA 4LEBA 3UIZA 1NGQH 4G8IA 4IS6B 3NCFB 4WFED 3RTQC 2PF6A 4Q9QL 2OK0H 1W0WA 2B3IA 4RGNB 1QPXA 2BVEA 1HAWA 4NXKA 4OH2A 4OZGF 4AYFB 4JMNA 1FE8H 5IMLB 1IJNA 4L3HD 2KC0A 1NFDB 2IWGA 3DOSA 4NQSB 3VI3E 1WSST 4KGJA 1CICC 4R0LC 5BV7B 1BEYL 1JWUA 5LVEA 4K8RC 5DMGD 2XIIA 1CQYA 3H2WA 3CFBA 1OB0A 3D39B 5IKCB 4QRPE 1G7JB 2ZP8A 1AZZC 4CY2A 1D9KD 3COOA 4Y1TA 2G5BB 4OCYH 4HZ1A 3V0IA 3V5WB 1D9KA 4XPHH 1A12A 1JGUH 3EHBC 3BHBA 3QCVL 5L2JA 3FQXA 4MKTA 1RJYB 3G6DL 4NQQA 4WSJA 3WEXA 1UOVA 1KENH 2F58L 1R3LA 5GSVB 4FA9D 5ES4B 1U8PA 2D9QB 1BZOA 1Q9KA 1N18A 3WJMA 5FLUA 1QAWA 3SDCD 1TFPA 1CK0H 4QF1B 1L0YA 2MJWA 1BBDL 3SDCA 1VGEH 4A6YB 1F2QA 1EXUA 1O6SA 3CXFA 5A7BA 4HDIA 2E6JA 1UEYA 3MLTB 2VZUA 3MRQB 4J6RH 4XE0A 1T7XA 4D7PA 1RXLA 4IU2B 4H2AA 3ZMRA 3WNKA 5CD5C 5GMKn 4JHNA 1MLBA 1MY5A 3EFFB 2WKOF 1G7LA 2JFCA 4RISL 4WCYL 1JK8A 3IDGB 3MUZ1 4ERQA 3DTXB 1RI8A 5G5DA 1FO0B 4F8PA 4K9EH 4PJIB 3H9YA 1N19A 2GCYA 5IMMA 1Z9LA 1HILA 1XMWA 1LDSA 1E65A 2AJZB 4F27A 4U6VL 3BVUA 1FH5L 1XAKA 3TH3T 3QQ3B 3BN9C 1ID5I 1XMEB 5ADOL 3T0EB 3BVNA 4JO8A 1SXNA 3FTVA 3PDOA 3S36H 5JIQA 2Z4QA 3L3DB 2H47A 3UYPA 1U21A 4L0PB 4OAWB 2GEEA 1DANU 3FCBA 4ZUUA 4RRPG 4ZRGA 3EYVB 4WO0A 1OGAD 3UP1A 1DVFD 2YMOA 5TQ2L 4D0CB 4ETQB 4ZMOA 1YNTF 1OGAA 2VAJA 1DVFA 3QJHA 4PRDB 5DZNA 2BIQA 2FBOJ 4PI2A 2W80C 5FLVA 2R0ZL 5AZEH 1U4FA 5J13C 5EDXA 4TNGA 5GS0D 3ZN6A 1E9OB 1AGEB 4PJXE 1BGXL 4AIEA 1XCTB 5GGSA 1MI5E 4OD2A 1E5BA 3O2WL 4AKOA 2WVUA 3A0OA 5TFSL 5LAXA 3RTQB 1E5ZA 3WKYA 1RIVH 4HZLB 2PR4H 2OL3H 3FYEB 4GRWF 1CYXA 4H8WH 4LIQH 4AMKL 4MCZA 1I8IB 1RV6X 1T2QL 4PJDB 1IARB 3ECVA 5IJKC 1CICB 4R0LB 3CHRA 3RX5A 1N3NA 3QPQC 5AWNL 4OJCA 3TIDB 5IVXA 1TZAA 3ECWA 1MCCA 1SLVA 2VM9A 4UDTA 4RGNE 1P84J 4TUJB 4Q9BA 4GP4B 4N2LA 4PJ9C 1B0RB 1VZIA 3GM8A 3HN8A 2OYPA 4LLAA 1OXYA 1R4XA 3EHBB 2ERJC 1FVEB 1KCUH 3P40A 1NFDE 2IGLA 3P4OA 4F7TB 1G1CA 3WTYA 3HAEA 3R18A 2BIPA 2J1WA 4IRZH 3VI3F 3B7UX 4IDJH 4Q7DA 4N3TA 1UWGL 5IHUH 3GLAA 2VXSH 5AG8A 3WTUA 5L8LB 2OMXA 4BSVA 3EOTL 1T5WB 3B3IB 2I9LB 3MXWH 4PIRF 4ZX6A 1RMFH 2MKWA 1IBZA 3FTXA 1F97A 5C7ZA 2Q7YA 1E5TA 1S7QB 5TK4A 3F58H 4WHYH 1EZSA 3BX7C 4ZMNA 1YMHA 2GBUA 3QORD 1HINL 2VQ4A 4HMDA 4LQ1A 3IDMA 1GYVA 3QORA 1F11B 1MVFA 2R69H 2VLME 3H56A 2B77A 1JI1A 3N1PC 1LEIA 5DA0B 3BSHA 1XSIA 3LKQB 3QH3B 4X50A 4QT5B 2WWMC 5CXPA 2F53D 3G7TA 5FKPA 3H9HB 2F53A 2A0LD 4AL8H 2DOCA 3BPLC 5C0ND 3T6XA 4KHTL 3LOWA 2GC4C 5IMKA 3EO9L 3MJ9A 3QJOA 2Q20A 5ESQB 3MTRA 2GW5A 2UWEB 4L8BB 3PJLA 3W2DH 5LQBH 1MG3C 5F9DC 1ZT7B 2QR5A 1VSCA 1UURA 5ICZB 4M43L 5JZ7D 3KNBB 3ZDZB 4PJIE 3CFMA 3EG6A 4FAAB 2F1BA 1X5HA 2G5UA 4FG6C 3WAKA 4I0KA 1G5GA 3CX5J 5IIEA 2QGCA 4MMXA 2WCSA 2VXQA 3BDBA 4BYHA 4Z7VA 3GD1I 4NC2B 1TJGH 2X4QB 3U4KA 1EUUA 4EOWH 3T0EE 4RGMC 3KW8A 4TVPL 3LXBA 5J13B 2HX7A 1BM3H 1S46A 4XXDB 1JTOA 4C57C 3HZYB 2D0GA 4I5BA 1ACCA 1S9YB 2F15A 3VI4B 1AYOA 2W65A 3CFDA 3BUYA 4ZTPL 4Z3GA 5J1AB 4GQQA 3TXAA 3O9WD 3PJNA 4RDBA 3VU1A 3PAUA 3O9WA 2HCZX 1I1AC 3U7WH 1MRDL 2XTJD 4WTQA 3KPQB 2VGLM 4ICWA 4JFOA 5LN4A 4M1DH 1FFQA 2DQEL 3EKCA 4FOMA 1MW0A 3Q5OA 3QJFA 4I48B 1BJ8A 1A4BA 4PJXF 1TETL 1QFOA 1OM3H 2P49B 3EYSH 5IV2B 4AX3A 1XVSA 2N7SA 5DFTA 2EDLA 5FHAL 5IFJA 4PJ9B 1A1MA 3DROA 2IOIA 3MBXL 4PJDE 2ERJB 2EVJA 2BIOA 1A64A 1Q1PA 3ZYOA 3FQ4A 3I7OA 5BUGA 1CLYH 3PL6D 1OW0A 4JFEA 2JXMA 1ID2A 4Z0XB 3KGUA 3PL6A 4IOSA 2ZXWB 3PP4L 4MLSA 3CWGA 2JIXB 5EMLB 5FXCH 1IGYB 5CLZA 2HMIC 2IPTL 2BOLA 4UIMB 4OUUA 4JFFD 2VMFA 3D34A 3WN6A 5FYKU 2BHUA 4HF5H 4JFFA 1U58B 3ZO0A 5GS0L 5H94B 1CURA 1A2YB 2MNUA 3CN1A 4YHZH 1P5VB 4A09A 3PGFH 1NFDF 3TEXA 3BE1L 1N8ZA 1YYCA 3AL8A 4N90D 1UJTA 2UV3A 1QSED 4JFSA 4PMEA 1PNCA 5DZVA 3E6HA 1QSEA 2Y25A 1ZJAA 4XWOD 3NACL 1AD9B 4HIJA 4NOBA 5EA0L 3QNFA 2WZAA 1ET5A 1GGCH 4I4WA 5EEYA 4KKBD 3CX5K 5ABDE 3RPIB 3UJIL 2CR3A 1G43A 4A2FA 5JW4M 4R90L 5DRWB 4EKJA 1AP2A 2WXGA 5ANMB 3BPLB 4PP2A 4MMYA 2PW2A 1FN4B 2DRUA 1KYUA 2W0PA 1WHOA 5BVPH 2XZGA 5IGQA 1BSIA 4JRXD 43C9B 4RZCA 5B1CA 4DQAA 5D1ZD 5B39A 3PXTD 3UX9B 4JRXA 4P5RA 5IB2B 3QQ4A 1RUKL 3QUGA 5D1ZA 4KTDL 2DQFB 4XWGH 3RWHA 5IROD 5EBLB 5TE7H 1UA6H 3Q6FB 4AGMA 2CE8A 5IROA 1F4WH 1CDCA 1TIUA 3ZKMD 3F6LA 3DRQA 2VRAA 3PIQA 2DJSA 1Y1UA 5J0BA 4UANA 1CBVH 2DF3A 5EEZA 2YAFA 4IRJD 1MQKH 1RUQL 2UWEE 2BZCA 2AXGA 3PU7A 3CVDA 4KDWA 2X2UA 2H6UA 4N0FB 2VL5B 1K85A 4JW3A 4RGMB 5CR8A 3ZDZE 6CGTA 2FEEL 4BH8B 4XPBL 4HCRH 4XP9L 5E0QA 1S7UB 2YXFA 3OR7A 4PJIF 4J86A 1NCAH 4DCQB 5ESAA 3O6KL 2YGPA 4KXAA 3HPLA 3CQFA 2CIKA 4H88H 4OY9A 1B9XA 2WXMA 1I1AB 2OV0A 3NPZB 1MW1A 3L7FA 1A9VA 3QO1B 1Y1DA 1BLNB 2R7EB 3L5HA 2HU5A 1KY6A 4WEEA 1K4CA 2R4RL 3EO1B 3QHZH 3EBHA 4JL2A 5B22A 2JNZA 1JZ6A 5IOPB 3A22A 3IMBA 3VI4E 2EVIA 3DKHA 5SX4H 3FQWA 3IULA 1RZGB 4GI6A 2W8CA 1WWAX 2C3XA 4FRWA 1X6LA 4DGUA 5CCGE 1JZGA 3MGAA 4X3EA 1J5OH 2R9HD 3NFPA 3UPRB 4F7CA 5CYKA 2Z35A 2GUOA 3MLWH 4J78A 3FB7B 5K1NA 1AS6A 2PW1B 2RQEA 1FZJA 2TRHA 4NSKB 5EOQH 4QWWD 1AIFA 1M7DB 2C3VB 4PIBA 3KWWA 4RAUA 5HHNB 2P8PA 4FI6A 3VXNA 3QHTC 4GKZB 2ZAIA 4UM9D 2JKSA 2G3ZA 4UM9A 4DGYL 4M48H 4MWFB 4JHUA 2DDQH 2R2EA 3B3BA 2BLFA 3QJVB 4OLVL 4PJDF 2R1YB 4C4UA 1FNGB 1OP5H 2DTML 3RVXD 4G82A 3OKOA 1PZ3A 3OKKA 3CHOA 2ZG3A 2N7BA 3O0RH 1OSYA 3POCA 4NO2A 5A3IC 2NOYA 2A1WL 2V7HA 4U3HA 4LLUB 3B9DA 3B9AA 3FONB 5C0BB 4YEFA 1NEZA 2N3JA 4U6HB 2XWTB 4ZMAT 4KHXH 5DEZA 3BKYH 3VXOA 4DKEL 1PTZA 1TLKA 1U6AH 3RY6A 2XRAH 4J3OG 1KIUA 3MA7A 2GSIB 2V3DA 1EJ6A 4MX7A 4QIRA 2C9RA 4S11A 5DQ9A 1DVYA 2F68X 2CN3A 1TEFA 2HUEA 1JDCA 1UG9A 2AQNA 5DUBB 2DIBA 3ZR6A 1II4E 3MNMA 4PJAB 4M5YH 5I30L 3J2PA 4P5TC 4A08A 2CO1A 3FO9B 4NO5B 2ZCLH 4M8UA 3K2IA 4GMTL 4AQEB 3WKPA 3KS0J 3BSZA 1S7RB 4B9YA 3OZ9L 5ANME 3UEQA 2YXWA 3ORJA 5IF0B 2QTVA 1KNOA 4WI7A 1ZK5A 2D3NA 3GKWL 4MB5A 3DVFA 3KHQA 3H0TB 5CINL 2CIIA 4KOCA 3B7YA 5AAPA 5I18H 4JY5H 3RZCA 1K5NB 4OSUH 1RZJL 2EYSB 4HX1A 3VFUA 5HSFA 2TRCB 5I8KH 5GJSH 4Z7NA 2X3AA 3RU8H 3HHSA 4PJ7B 1A7BA 1JAEA 3ARFC 4G71B 4ISVB 2CHZA 3FGBA 2APXA 1JIBA 5G4OA 3IUMA 3EJRA 3IFNH 3BIBX 3MRIB 1JMZB 3OVUB 5JHAA 5DTFA 5CGTA 5C0DB 4KKLD 1R3HB 4A7GF 2VSMB 1QFWI 2UWEF 1WD9A 2IVFC 4A2LA 4GW1A 2O61A 5EBMA 3LRHA 3SCYA 1NFIB 2P9PC 3NJLA 3OKMA 1BX2A 1MRCH 1HOCA 3TN0C 5AEAA 3ZDZF 1RSYA 2PP7A 1RZJC 2DWYA 3V6OA 3SO5A 5FGSA 3SKUD 3DUSA 4U49A 3TYFB 4MDRA 3F7RA 3BKMH 5EU4A 4CJ1A 2QQLH 1JFQH 3ILDA 2FBJH 4K5PA 3MRJA 3CXHK 3IEAA 2IAND 4AQOA 2R8SH 3REVA 4FLRA 2IANA 3DJTA 5F6HJ 5FHBH 4TXVB 2HU7A 3W39B 2LABA 2PCPA 5DUML 3IDXL 1C16B 2AGXA 2R39A 1NICA 1FVCA 3VI4F 3L9EA 3BLBA 2X70A 5E5RB 3UAFA 4FQXD 5HGAA 1TMQA 3RPBA 3C9CA 4JKLA 3TV8A 1FI8C 4FQXA 4PMFA 4AQ1C 4D9RE 4EAEA 3NTCL 1P5UA 4QJ4B 4G8EB 2CH8A 3TC9A 3GS7A 3X3GH 3OKTA 3DSMA 3SGJA 1F1AA 1PG7L 2ZKWA 4WO4B 4WRLA 1XHHA 2ICES 5IK3A 2XKSA 2J1YA 2XVBA 3FOLA 2G3MA 4YPGA 1NCGA 3GLDA 4BUHA 2YKLL 2PN5A 2WZ6A 1MZYA 4IMKA 1W16A 4ZTEA 4QRQB 2QADD 4MD4B 1DUZB 1RH8A 3GGWB 1DJXA 1K8IB 3GYRA 5EO1A 3DMMC 1ZPLA 2JCCA 4R83A 2KPWA 4XC1L 3U46A 4X5WA 4GAYB 5AAMC 2NSQA 2OYMA 3QZMA 2AVGA 4J3OH 1NL0L 5A2KH 1YEDA 2H9GB 1ZSDB 5FW6A 3ARDD 4I5BB 5CILL 5E08L 1TCRB 2PWEA 2FECL 4X6FA 2UUDH 4H13C 3SYAA 3LVTA 5IP4A 1ZY9A 4LHUG 1EFXB 2QPSA 4P5TB 5B38A 4XX5A 3GMOA 3OPUA 1XCQB 3NT0A 3I9AA 3VFVA 1QNIA 4JVPA 4H1LG 3X1NA 1GG2B 3FRUA 2VN7A 3BEWA 4MAUH 2ICWB 1ZHLB 3SGEI 2V2TA 4UZUA 4X6BA 1ONQB 3GB7B 4WK4A 2K3HA 2ZIDA 2EE0A 4WV1C 2B0SL 3ML8A 4PJAE 5I23A 4AENA 2NQCA 3KYOA 4MYWB 3UBXG 4PLNC 2XX1A 3IDIB 3KD4A 9PCYA 4PLKC 2XWZA 3ZDXA 4NJAH 4NIKB 1X5AA 1XT5A 3ARFB 1F6FB 1RZ8A 1ITCA 4LEXL 1NAMH 4U05A 3P9LA 2IG2L 1XL4A 5IBLC 3KPSD 4TYUA 4ODWA 5CEZD 4EQ3A 3VJ6A 4PRID 4DP2X 1UB5B 1OP4A 5T1MA 3V4PH 4PRIA 2DQGL 4PJ5E 3F7YA 1V7NL 3PV6A 3GK8L 3I6LD 2AJUL 2J44A 3MFGB 4L2LA 3UTTB 5DA4A 4BFRA 1QW8A 3HI6L 2CZNA 1P7KB 3TN0B 4UQDA 2DQDL 3CLWA 3MLRL 1JD9A 2DJMA 1J1XL 2Q9OA 2MTAH 2Y3NA 4LSQH 5J4MA 3HKZA 2ADFL 1S7SB 5HGDA 4I3RH 1XR9A 4P99A 5DLML 5ILTL 1S7XA 1DFBL 4AV0A 5L9DL 3G5XB 4XP1L 4TOYH 4L3GD 3VXUB 3T4YB 3BPCB 5D4QA 4O5LH 5CJQL 5D7JD 1ZHKA 5KYYB 3BZ4B 5D7JA 4OZ4A 4N25A 5LNEA 4CZXA 3B7FA 1Z3GH 1T21B 3VDCA 2JI3A 1ZVSA 2BNRD 4AQ1B 4NI3A 2Z64C 2E7LC 1AZCA 2BNRA 4JY4B 1M9WA 1OAYL 4YE4H 3U6RB 3N55A 3QQ4B 2QV2A 3QDGB 1XB8A 5E2JA 4Y5YA 3OC5A 5IW6A 2YBRB 3UVLA 3GMMA 4R4ND 3I9GH 3MNDA 1HL8A 1E43A 4AXWB 1KJ3L 4Y4HD 3RUGB 3RKPA 4XMPL 4AJYV 1GYCA 4WWID 5CXCA 25C8H 1NBCA 4JLRA 3IJYB 3SPCA 3B6SB 1LK2A 3OKNB 4N3UA 3UVMA 4TNWF 1BZEA 3EI2B 5JA8B 3DMMB 2XV3A 3NJJA 1KGCE 3T65A 2VW7A 2VDPH 2HVKB 2ENSA 4ZN4A 3BWZA 5I1HL 4GGAA 1T20A 4NKMA 4U1MB 3GKZA 4HBCL 1KY7A 2OTWA 4J73A 4G6AC 2X4OB 5LG1A 1YEWA 2HJKB 1TZHA 4HFWA 4ANWA 1EGJA 5I6LA 1KIQB 4P3DA 4YS4A 1S8DA 5LO7A 2OL3A 2BSRA 3R0NA 3WN5C 4D0BA 4J0XA 3THML 2WTRA 4KMTH 3VQ1C 3AXLA 5D6CA 2OMWB 1NOAA 1BVNT 1Z0MA 2DBJA 4DPCX 3NABL 3CZFB 5JDJA 4ENED 4H1LH 1WCBB 3O2DA 4FC3E 1QWNA 1U8CA 5EIQA 3NEEA 4HUXB 1NFKA 4DGIL 5H4ZA 4R26H 2EADA 4WV1B 4Y4KA 3IVKB 1YJDH 4QHPA 1WPCA 4PS4H 3JTBA 2FQEA 1QFUH 5EO9B 5ID0A 1IFHH 1JZHA 4FNLL 1IVTA 2W60A 3TV3L 5LBVA 4PN6A 5CIPB 4YBLC 1HXKA 3V5KA 4XMVA 1GAFH 1FAIL 3NCXA 3O45B 2VR5A 4IRZA 1TTCA 4JHVA 1D2OA 2VITA 5CP7B 1I8LC 4HIXH 5GS1C 2Y1ZA 2X88A 1UATA 1H9VA 2MCPH 1YEEL 3SOBH 1ZGLP 4PJHA 4PJAF 3EF4A 3WUZA 2KYIA 4J1UB 4UNUA 3K6NA 1NGQL 3T9WA 3FUFA 1IC1A 4Y9FA 3B9VA 3IWVA 2V5SA 4KMLB 4CMMB 4KQ3H 1FLTX 5BNXD 3LKRB 2R69A 3D3VD 1FE8L 4PRPD 4TNVF 2VDNL 2GB2A 3D3VA 1AXIB 1WE5A 2NT0A 3QXWA 4PRPA 4B60A 4L9DA 3OXSB 3UTTE 1ZJBA 2K7PA 3TA4D 4UV4H 1UM5H 3CDYA 1WH0A 2J88H 1JXFA 1VF5C 1FZMA 2K9FB 2BOBB 4LVEA 3PUUA 1M42A 1RFDH 4MJ6A 5ID1B 4OCYL 5DU7A 3W2DL 3DUHA 4XPHL 3FH7A 3S3SA 1JGUL 1NR0A 4UF7C 5GZND 1T5KA 2GK0A 3QI9D 4LLWB 2P28B 5GZNA 3QI9A 1J1OH 2XQYG 3VXUE 4B9GA 3L17A 1AQKH 4M02A 1KENL 3MRHA 2BNQB 4ZYKB 3TASA 2F19H 3UVNA 3B9KD 4WUUB 4XI5D 4OUOA 3EAKA 1MCDA 2G99A 5FUCC 3IT8D 3UAAA 2CNYA 1Y18B 3MKGA 1U8OB 1VGEL 3MRGB 4AT6A 1J9CT 1QSVA 3HC2A 3MZGB 1T1YB 2FJGB 4D8PA 3FRXA 4APXA 1ZE3H 4FULA 4UINH 3QDGE 1D5BA 4NUMA 3VQLA 3IJHB 1KTCA 5EEVA 5F7AA 2FLMA 3HHSB 3IPFA 2PP9A 5EFIA 3RUGE 2OTUB 1J0ZA 2J73A 5DHXB 5IT9g 2A9BA 4R3SB 4M3KB 1NIEA 2BP8B 2FSDA 3QDMB 5C0EA 2FSEA 2I7OA 3INOA 1EA9C 3WN5B 4HWUA 4YXKH 4OWRA 2X4SB 4LG9A 1BQLH 1IAIM 4LGRB 2H26B 1QLEB 2XXMB 1T0MB 4WW2C 2B5IC 3C09C 5GGUB 5K19A 3NZHH 4QTIH 3GSRA 4XXCC 1T0NA 3S88H 4EIBA 1U42A 2NY2B 3OAYH 1EMTH 2FB4H 3GJFB 1EEYB 4BBWA 3QXDA 4EI6A 4TQIA 4LASH 4YBLB 2GABA 3BZ5A 3VA6A 3U7YH 1RERA 2Z8WC 3GSNA 2BIMA 3FJTA 4CADA 4QJ5B 3FXIC 4BFGA 1KPUA 1T1WB 5KANG 4HJ0D 3PWPD 2HTKC 4MJ5B 1DBKH 5GS1B 5DGRA 3PWPA 2WLYA 1NH6A 1JVOA 4ONFH 5H35B 5K69A 4OCSH 4UT9H 3IFPA 3T0BA 4JB9H 3X1EA 4BP8A 3APCA 3SN6B 4FYSA 2YB8B 3D48R 5T1DH 3WMQA 2BSDA 3CLEL 2C9XA 1GKOA 3HE7A 4BH6A 3CZGA 3CGTA 3HLKA 4MLIA 4Y5YC 1PY9A 4FF9A 3W9EA 3ARGC 2CCVA 4LXFA 2V2XB 3ZTCC 1RIVL 4QXTA 1OP3K 5BVJB 2PR4L 2OL3L 4H8WL 4LIQL 2Z31C 5EU3A 4PV9A 5FB8B 1BIIA 4MJ2A 4V1DE 4NAMA 4JKMA 4BUQA 4B97A 5ACZA 1JZIA 1ZHNB 5HGHB 2FTAA 4DZ8B 1ILSA 3ZL4H 4JJHA 4PCKA 1N6QH 1EHLH 4JGUA 5D7EA 5C08B 1DBJL 4KNUA 1X5GA 2E7BA 2WBJD 3TPUA 1GS6X 4IOIB 2WBJA 3HZKA 2IPKA 1TEYA 2OX5A 1THCA 3QIWC 1GMIA 3GI9H 1KCUL 5I6PA 1BMGA 4Q9RH 5E8NB 1KB3A 4L29B 3MV8B 4IRZL 3H3BC 4E9QA 1N9PA 4H8WC 4OKVA 2NZIA 2Y7MA 5F3HA 3GMOB 1D6EA 2PPAA 1GOFA 2VDNB 3BZFB 5IHUL 1IBGH 2DICA 2VXSL 1TBGA 1MVUB 4GNKB 3ZQXA 4XNQB 1DUYB 1ZLDA 5FOJA 3P73B 2C9VA 5IJVA 3X13B 3MXWL 5I2IA 4MDIB 3T8XA 4PV8B 1AQMA 2YAOA 3F58L 5F89B 2BXZA 5F21B 5ETUB 5GIRB 1XF2A 4RGOH 5KSVB 2ZXBA 3BVTA 2VLMD 2FX8H 2WKGA 1GTNA 1YDPB 2BNQE 2R69L 4PRAB 2ZE0A 4HCRA 3POHA 3K72A 3WU1A 4WUUE 2IDSA 2X2JA 3D9AH 1UFGA 3AUWB 4HEME 1BF5A 2JTDA 3H7LA 3JWDH 1NCOA 2VISA 1HJBC 2H8PB 1HQRB 1EZUA 1SJMA 4K5OA 3RNQA 4AL8L 4ZDHB 4GOSA 2PYFB 3DX9B 4BRJA 1QLRA 5GS3A 5IT2H 4Q4EA 2Q2EB 1HIMH 4G1EA 4WW2B 4YHOH 2Y07L 3C09B 3B8SA 5D1ZI 5T3XE 5LQBL 5EM2B 2ZX7A 3N5AA 3RUGF 1DDHB 4HKJA 3CZKA 4ZO7A 2DL2A 4RX4D 5GRVK 1E4HA 4KKCD 5F9JB 4YNYA 2FR4A 4RX4A 4I88A 3S2CA 4ZS7H 1CBJA 1MCRA 1L9OA 3L1FA 1R5MA 3KLDA 4RAVA 3IE9A 1REIA 5FCSH 3H6AA 4KK5C 1I7UB 3SCMC 4BZ1H 1U95A 4W9ZA 1WFNA 3S35H 1TJGL 3JYBA 1KWGA 2WP3T 1PFOA 4EOWL 3PVWB 4GAAA 1BM3L 2WLZA 1WJ3A 3EJSA 1ZSHA 3VFNB 3GUTA 1HQ4A 2JK5B 4H7VA 2WXHA 3DGGB 2UY6B 1UOKA 4R96B 5C09B 2ZQKA 2PKDA 1DE4B 2PBIB 3OMZA 3GSUA 3ARGB 1YYLH 4KO5A 1LNUB 1RPQA 1YY9D 3HC4H 2FL5A 2Z31B 3P0GB 5AAWA 1BF8A 4ECNA 4ZOAA 2D73A 4HJUA 1U41A 4N2DA 4M1DL 4WEBH 3VFSB 3OGCB 5E4EC 4LCCA 1MREL 2EJ1A 3UBHA 4LRIA 3VFGH 3QR1A 1FG2B 1OM3L 4Y16C 1P4IH 4PS8A 1CXHA 3EYSL 3GLEA 4DN3H 2HN7B 5A2Qg 4GXUN 4MK0B 2OJ1A 1UD6A 3QIWB 3AWEA 4P57A 4ELKA 1I1CA 4U1SB 2IH8A 1FC1A 4K8RD 1JV2B 4YGAB 5D7IB 4D94A 3FN0H 4UBDD 1CLYL 4XBEH 4FKEA 1MJUH 1QVOA 3RWDB 1PKQB 1UQSA 5C08E 3BD4A 2W59A 5ICYB 3VCLB 2UYLA 5D6CB 2YWZA 2DIAA 1OCCB 1Z2KA 5I8EA 1M53A 2WXIA 1K2DA 3Q0HA 4HF5L 1BHGA 2IPUK 4ZOYA 1FYHB 3TM6A 3GFCA 4YHZL 4CGTA 1E4JA 4JPIB 3H2QA 1JYNA 3PGFL 1ZWIB 4B9JA 3MV8E 3PFUA 4HIHB 4YBQD 5C9KA 4LCWB 3LN4A 1QWHA 5JPMA 2CKBH 3SBPA 4QYOB 5IMOA 1MDTA 5HDOA 1QD0A 3BUBA 1EZVY 2WSPA 4MAZA 4R4FH 3GEWB 2NUTA 1AD0A 1M71B 2HFFB 4QAWA 2H1XA 1GGCL 1MAKA 2AW2A 5FUCE 3SN6N 1ORQB 4KKNA 5CD3A 2VDKA 1M6OA 4NQCB 3U25A 5CU5A 2I24N 4I89A 2EXSA 3ISWA 1CD1A 1O5DT 1P4UA 1WLHA 3AACA 5EEXA 5BVPL 3QRFM 3CN0A 1QFMA 5HQGA 2O6FA 4XWGL 4C8XA 3J27A 1UA6L 5HHMB 1ORSB 2D2OA 2MTPA 3N43B 2EIJB 5MENA 3I8CA 1F4WL 4LBEB 1IM9B 4RFEB 3LKPA 1NGYB 1OTTC 4W6WB 5JW3L 1CFQB 1CBVL 1R0AH 4MNHB 1MQKL 2B9AA 3SCMB 5HPOA 3LN5A 4JG5A 1JPST 5I16A 1MIMH 5LGYA 3NJXA 1YN6A 4Z78B 1YZZA 3G5VB 3O4LB 2HKHH 4PCSA 1LM8V 4HCRL 3P4LA 4Z7OB 2AAAA 1NCAL 4YHNA 4YSSA 2FJHA 2A6KB 2C26A 1C5BH 1NGZA 2A83A 1ZHBB 4H88L 5HD8D 2YAMA 3I9IA 1SUHA 1MHEB 3CBJB 5EC1B 4O1QD 1N0LA 1JOIA 4FDWA 2CE6A 5D96C 5DD6B 3BCDA 4NRXA 4AMXA 1XGRB 3JUYA 1ZKAA 3BP4A 3SBQA 4RETB 3VX0A 1ZV9A 5E4EB 2IADB 2ZXDA 3RJOA 1PIFA 4K9JA 5C09E 2H14A 1G7PA 3H4FA 4Y16B 3T77B 5DJXB 3VXMB 4PXWA 1OAJA 1W91A 4FNRA 1GZHC 4N26A 5JDSB 3EQ7A 3QULA 2FEJA 1J5OL 5C7XH 3MMYA 2NY4C 2YN3A 3PJSB 5I9QC 4X99B 1QZNA 3RA7H 1HX0A 4XN4A 4ZOXA 1MCBA 2IH3A 3DO7A 3MO1B 3WE6A 1E9PB 3HE6C 2Z2PA 4YSAA 3MLWL 4NAAA 2X7LB 3E7JA 1VB9A 4QXGH 5CU9A 3QEQA 5EOQL 3L9RB 3MNWA 5INCB 1OB1B 1QR4A 2VMJA 4E41E 2N1KA 3EGXA 2WQVA 4DNUA 2YZ1A 5KJRH 5ISZB 3SPVB 2AQQA 4M48L 4BK8A 4ZMVA 2DDQL 3U2SB 3OLIA 4OTXH 5D7IE 2WXOA 4GG6B 3Q48A 3BP6A 4X6EA 3VM7A 3ZHKA 1HHHA 4LPWA 5DJDA 2IUQA 1ZEAL 3ARBD 4DFIA 1PKQE 3BP7A 3ARBA 3P3SA 2FCBA 5AB2A 4O51A 3O0RL 2JE8A 5IJ7E 3EI3B 4PR5A 5EO0B 2DKUA 1B4TA 2FE0A 3L13A 1P4BH 1KGXA 43CAB 3GSVB 4ALAH 4NKDB 2EE2A 5TE6H 4KHXL 4NAJA 3WAJA 4HS6A 3BKYL 4F2MB 2Y7LA 4A0BA 2VNCA 5J06A 4BCDA 4P23C 1U6AL 3ZIYA 2XRAL 3GMQB 3IVMA 4ATTA 4L2YA 2FQDA 2GFBA 4LCWE 5ADPH 2EDQA 1NC2B 3ZZSA 4Y2LA 2QQKH 2BVYA 3W5NA 2HA1A 4F33A 1AQHA 4M5YL 3CSYA 1JHLH 1VFOA 2MTAA 3D08A 3CNKA 4ODHH 2EE3A 2ZCLL 4HIEB 1MFCH 4GPVA 2Q3XA 4X8JA 2CQVA 2ICEB 2OI9B 4NQCE 3WL9A 4HLZH 1T22B 5L6YH 3O6FB 4PJCA 1I7RB 3CPUA 5I18L 5E4OA 1NCJA 1NCBH 2OJEB 4JY5L 1GA2A 5CEYA 3MVDK 4OSUL 1IX2A 2F61A 2WXFA 1QX1A 3JV4B 2R2HA 4FQHA 4YO0B 5IWLA 3HZKB 5I8KL 5GJSL 2A6JA 3RU8L 5HHME 4GSDH 4OF6A 2CAKA 2KHAA 4XBGB 1KJMB 2XYBA 3LV3B 4ATWA 1OSZA 1DJSA 2EC9U 3IFNL 3W11C 3ARWA 5I5MA 2FK9A 1I1RA 3DRTA 3QDJB 5F9OL 3TEUA 2ODHA 3CK0H 1BZ9A 2VE6B 1FIGH 1Z5YD 5IHZA 2GVYA 4WW2F 2YD3A 4MNGB 5GGVY 4KU1A 3U4BH 3Q9PA 1USZA 2OBGA 5D96B 4QRTA 2C7UB 2COQA 1MRCL 4Y7OC 3O4LE 3CH1A 4XZUA 3T2NH 4F2EA 4Z7OE 3W38A 4Z95H 2VJ8A 1JZ8A 5H4YA 2JKTM 3VUAA 3D2UD 1BVLB 2VDPA 1I1AD 2B59B 4D2NA 3D2UA 3BKML 3H85A 3KLHD 5MHSE 2QQLL 1JFQL 2FEDD 5DS2A 4YEEA 3BAWA 4F37F 5KSBB 2SEBB 4NGHH 4N0CD 5C97A 2NY4B 4WNSA 2R8SL 1LEKB 5I9QB 1C08B 1JNHA 1MFDH 4TNWK 2CGZA 4AOWA 5CZVH 3HE6B 1XL6A 3L5IA 4OIIH 3IETA 4FG0A 4JGNA 1R5WB 4LLYA 4BXVA 1AKJA 4D9RD 1ZDQA 4H1LA 2HG5A 1MDAA 1J88A 2ZKXA 1AGBB 1Z9SA 2VXTH 4PUBH 5TDPB 4GRMA 4A7SA 2OSYA 2OVPB 2ITDB 1JJUB 3X3GL 1HE7A 5D8JH 2GIXA 5K39A 1OLZA 3H55A 1QUNB 2VMCA 5GXHA 2DL9A 4JRFA 5BQ7A 1A6ZB 1E7VA 2IIJA 3MFFB 2B1HH 1DP0A 4X6CA 1GW6A 3G5ZB 2E6QA 1UT9A 4OM0H 4FCHA 3HMWH 3I7PA 5IEKA 2CDEA 5ISZE 4NPYB 4J82A 1MIEH 2CLZB 1I9EA 3L1OH 4NZTH 3MXVH 5DSCA 4G11A 1Z0NA 2CDGA 3HZMA 4MRBA 4P23B 1F3JB 3STZB 3WNOA 2O5NA 4EN3D 4GG6E 4L4VD 5D7IF 4EN3A 3R06B 1OAZH 4JQVA 1E2WA 4L4VA 5JOFB 4WSKA 1HE8A 1GR7A 2QGBA 5BUAA 2I32A 4GKLA 4ZW6A 3EF7A 4BGDA 4JFYA 4AE0A 4WJKB 3W81A 3HG1B 4QKTA 5B3SB 4F2ME 2OMTB 3VYOA 2Y2WA 3HVNA 3UVOA 1YPZE 4WDIA 5CWSB 5DR5H 2HTLC 2FATH 1U8IB 1A02N 1F4XH 3IJSA 4HWZA 5D7LE 5F2FA 5EZOH 5HGBA 1PW3A 4J3OC 4H20H 2X4UB 4Z3HA 4GG8B 3F5WA 3WHXA 5CEXA 4DN4H 2RAMA 4JSNC 5M5SA 2PXYD 1D3CA 3IKCB 3UDWC 3CDZB 4NJAL 4CI3A 2PXYA 4B6ZA 1N6VA 5B1AB 2QV4A 4ZFOA 4XO8A 4KO9A 1ZLVH 1NAML 4HIQA 1YMMB 1TYEA 2P9SC 4NNXB 4EUPG 5K9QI 1A3RH 5FCUH 4PJ5D 4JFUA 4NQDA 2WIIA 3V4PL 4AEEA 3C9NA 3MCG1 3S48A 4GBXC 2A7BA 3MRNB 5AW4B 2ENYA 2XQ0A 2BCKB 3L3OC 3I2CL 4L9LA 5JQHC 3OKYA 4XB3A 5DO2D 2YSSA 2DLEA 2ICWJ 4PM1A 1HSAB 3N43F 4PREB 2OQJA 2A6IB 3V5HA 3R7QA 4ADIA 3QDJE 3QNZA 4FXLA 1K4DB 1TZOA 4LSQL 1W8OA 1D5IH 3KH3A 2NTFA 3E0GA 3OWRA 2PETA 5CJXC 5EULV 4YHIB 2HRHA 5BRPA 4ETYA 4MNGE 3KWTA 3B5TA 4I3RL 5FA3A 3TURA 3FUEA 2DN7A 4EBQH 1CO1A 4TOYL 3A6BH 3RL2A 5JHDB 4O5LL 4PCTA 1EX0A 4PRHB 3WLBB 5JHBA 1CT8B 1CLVA 5D2LA 4Z7OF 2WB7A 1XKSA 5I1AA 3FH5A 2EDRA 2NYYD 4NPKA 1FVDA 1Z3GL 1GH7A 4RE5A 1EEZA 2CHXA 3KJ4B 3QIBD 4LK4A 5KSBE 1OEZW 3LRKA 3QIBA 3FB5A 4ES0A 4LOEA 4AN1A 4WI0A 3HG2A 2MNJB 4YE4L 3S37H 2XN0A 1U8MB 4HSAC 3QNXA 4DNLA 4WK2A 4ZG1A 1IGTA 2AQ3A 4JY6A 3I9GL 2HSIA 4LMQE 4LLVB 4GSUA 5TF2A 1IEBA 2Z0BA 3N40P 3Q8AA 5GGTH 1HHIB 3L1EA 4ADGA 1ZLSL 4KXZI 1SDDA 1ZVHA 3WFHB 1ZTXL 25C8L 2VKXA 5CMAA 9CGTA 4QT8A 2W5PA 1KGCD 4NT6A 1BYNA 4JN1H 5EUOE 4K94H 4WO4D 2V5MA 4I0PC 4DZBB 3QZLA 1ACXA 3SKNA 2VDPL 1BM7A 4UT9A 4KROD 1PBYB 1B88A 4OLXL 1I7TA 3RGBA 5FA5B 3TO4C 5M5TA 2B2XH 2RD0A 3FU7A 2H6NA 1IKFH 3FUHA 3MACH 3TU6A 3GTNA 5IG7A 3UJTH 3WKMH 3CMOH 1TJHH 4ZUSB 2ITCB 3LAFA 4NQTA 5FIEA 4BCYA 1YO4A 5E0FA 3UMNA 4KMTL 1SHSA 1ZT1A 4M62H 1SVBA 5AYUH 2YUWA 2YXMA 3NPSC 4J3VA 4DW2H 1A47A 3BXNB 1A1NA 4GG6F 4Z3EA 2ED7A 1UT1A 5J1TC 2R2BA 4P4KC 3PCYA 1DQJB 1EFXD 2AQ5A 2ATPA 3FB6A 1IVLA 3MV9B 4R26L 4Y9GA 1ZGLA 3UJJH 1YJDL 3WUWG 4PS4L 3JUZA 1QFUL 1X5JA 4X83A 1IFHL 1TSRA 4EF3A 3I6KB 3FCSA 1FIEA 4UZSA 4YAQA 3HG1E 3DPDA 2FHBA 1BQHA 3IFOB 4QRAA 4WUKH 1OTSC 2Y9RT 1JN6B 1GAFL 1UWEH 2CO6A 4JZJA 3FTGB 2HESX 1NLBH 5GGRB 1KWKA 3F01A 4HIXL 1JZEA 2MCPL 5E8DH 2X4PA 3C08H 4GBXB 4W9KC 4XVUC 5E94B 1KIRB 3SOBL 1HYSD 2J6EA 1MCKA 4U31A 5KG9B 3UGEA 3ARFD 3L3OB 3L4XA 2B7DT 3QWQB 4KDTA 2YQ2A 4PEEA 3SY6A 1NKOA 3TT3H 4G43B 4KQ3L 1IGJA 3Q8CA 3FHAA 3UPAA 3NCMA 1ECZA 1YMME 3OG4B 3PAYA 2A6DB 3J7HA 3A67H 3O11B 4F93B 2ZX5A 5IHBA 1GGYA 1SYSA 2AF2A 1GOGA 2ALAA 3FSWA 3QFDB 2VSKB 1Q0YH 4HETA 3MRCA 4LPUA 3AU1A 1M1SA 4PR5B 4E9LA 2NNAA 1NAMB 5T5FH 3VGDA 3L8QA 4KQ4H 2WZPA 4ZD3H 1UM5L 1GYUA 2CM5A 5C0CB 4P2RB 2D3JA 2IQAB 4RFOH 3FQTA 1T1ZB 2J88L 4UTBH 5D6DA 4UM8A 4G9FE 3V4PB 5AW8B 5FECA 4G6KH 4WU5B 5IUCA 1QO3A 3HI1B 4JQVC 1I9RH 2NW2B 4YQXH 5FPIA 1NBVL 4G8GB 4MBOA 1LE5A 2DLIA 3SGKC 1BVKA 1F00I 5E1QA 4OLWH 4QRSB 1TVBB 3UZEA 5FM5O 4ZFOL 1J1OL 2X1QA 4XBMA 2HYEA 2HRPL 3PNWB 4TNFA 4YDNA 1AQKL 3CU7A 5AUMA 2VIRB 3L4VA 1X9LA 2FYVA 2Y5TA 4PRHE 2F19L 1JZ5A 1LP9B 3TBVA 4P2AA 4MA7H 4PJBB 5FFGA 2I26N 1FHNA 3N06B 2BHFA 3QDGD 4GXUM 3D0LB 2D7TH 3T2PA 4I0PB 5KSBF 4A2MA 4UINL 3MV01 3VFWA 3PWNB 3BFOA 3HHMA 4OZIA 4Y19B 3VXQB 5F7NC 2HH0H 4QCIA 2IBZX 3ARED 2DQIH 2UY7A 1JD7A 1UADC 2EDHA 3TO4B 4Z3IA 3AREA 2PWHA 4NLAA 1MCWW 2CO0A 5JYLA 3EU7A 2QPDB 5JO5A 2QKIA 3SE3A 4TSCH 5EAMA 4FNUA 4KRPD 1TZIB 3QZWA 1S9VA 2DTSA 1D5ZA 3O6LL 2UXVA 4YXKL 1ETB1 1Q94A 5EUOF 5I1GL 3NP4A 4F5CA 2G9HB 3CDCA 3QGVA 3FO1B 4L8CA 4PVLA 3NPSB 4MYPA 4QO1A 3UGXA 2VAAB 3TL5A 3QRLA 4WFFE 2UXGA 2XI9A 3NZHL 4QTIL 4Z77A 3NN8B 1J8RA 1ZE3C 4LDOB 4O2CB 4P4KB 3S88L 1ZIAA 3CFEA 4LVHC 4XMLL 4FQJH 3IGAB 2C4XA 1FZKB 3WJJA 3IMWA 5E9AA 2FHFA 3V6FA 5C71A 3FUKA 4LASL 1K9TA 2X05A 1AI1L 4U3XA 1WF5A 3U7YL 3ZE1A 1RK0A 3F8UB 5I1DB 4ZFGH 2H0FA