3ODTA

Crystal structure of wd40 beta propeller domain of doa1
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
297
structure length
296
Chain Sequence
FTGYQLSATLKGHDQDVRDVVAVDDSKVASVSRDGTVRLWSKDDQWLGTVVYTGQGFLNSVCYDSEKELLLFGGKDTMINGVPLFATSGEDPYTLIGHQGNVCSLSFQDGVVISGSWDKTAKVWKEGSLVYNLQAHNASVWDAKVVSFSENKFLTASADKTIKLWQNDKVIKTFSGIHNDVVRHLAVVDDGHFISCSNDGLIKLVDMHTGDVLRTYEGHESFVYCIKLLPNGDIVSCGEDRTVRIWSKENGSLKQVITLPAISIWSVDCMSNGDIIVGSSDNLVRIFSQEKSRWAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Nuclear protein
molecule keywords Protein DOA1
publication title WD40 Repeat Propellers Define a Ubiquitin-Binding Domain that Regulates Turnover of F Box Proteins.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 84
structure length 296
sequence length 297
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3odtA00
3P4FA 3EI4A 2HYEA 5TF2A 5K19A 4E54A 4A2MA 4JT5C 4A0AB 4J82A 4A11A 4JXMA 3UVMA 4J0WA 3EI4B 5HE1B 2I0TA 3DXMC 2IUVA 4U1EI 4E5ZB 3EU7A 5GXHA 4CY3A 3PXSD 4PNKB 4A11B 3OKTA 1GOTB 3MKSB 2HXCA 2EBSA 2AH0A 4J0XA 4J73A 3OL2B 1JMZB 2H3XA 3SBQA 4AOWA 2B5NA 2AGWA 3J80g 4ERZA 4Y5RD 3IJCA 3UVNA 1U2VC 1FWXA 5IGOA 3SVWD 3L4MD 4O45A 4Z8LA 2AGZA 4ZOXA 5IT9g 3U4YA 3ZWLB 5IC7A 2AQ5A 5I5IA 2W18A 3EWEA 3NVQA 2IAAA 3BG0A 1XHMA 2H6NA 4AEZA 2P9PC 5EAMA 4D0KA 2XL3A 5CYKA 3IJ0A 3ODTA 4GM3A 4NSXA 3K26A 5FXYA 2H6QA 4H5JA 5FKRA 4K3JB 3EI1B 3OKWA 4FA1D 4QRJA 2H47A 5GSAA 1TBGA 5SXMA 4XYHA 5EALA 4L9OA 4ERQA 4ZN4A 5HYNB 4D6VA 3AL8B 4ZOYA 4FAVD 3CIKB 5AJAA 5B4WA 1P22A 2IWFA 4CI3A 4GGCA 3FM0A 1JJUB 4GMBA 4GQ2P 4X63B 5CXBB 5FKTA 2G99A 5TDHB 2H6KA 3EI3A 3JZHA 4K3ID 4JSNC 2OK4A 2HJBA 2GC4A 4JSPC 5FQDA 4FB1D 1MDAH 2O9KA 1ERJA 1SHYB 1MG2A 3B7FA 2CN2A 2GNQA 4A0BB 2YNOA 2QXVA 3EI3B 4A0AA 2MTAH 3OKYB 4GGAA 2PM7B 3UKUC 2G9AA 3GFCA 5CXCB 2XYIA 2I3TA 4L1QD 4J86A 4E5ZA 3MZKA 3JAMg 1OMWB 5EM2B 3CFVA 1PI6A 2PBIB 4FA9D 4FWWA 2AGLA 3CFSB 3OL2A 4J77A 3C75H 2B5LA 3IIYA 3BG1A 4ERYA 5FKQA 1TYQC 1XKSA 5TEEA 2P9UC 4A7JA 5FLXg 3JROA 5HQGA 4YVDA 3F3GA 3JRPA 1PGUA 1N6DA 2J56H 3JPXA 2UZYB 3V5WB 2I3SA 3I7LA 4GZ8A 3SXTD 4JSXC 4XYIA 2AH1A 4CI8A 4Y7RA 5EMMB 2YNNA 2H68A 4N14A 1A0RB 5IGQA 2OK6A 4J87A 4PBZA 4PXWA 5C2WB 3DM0A 3VGZA 3SBPA 3EG6A 4X60B 5EMKB 5H1MA 2CO0A 4I79A 1NR0A 3PSLA 5GMKn 3SN6B 3EI1A 1GP2B 3I7KA 3AL9A 2XU7A 4J8BA 3I7PA 4J81A 1R5MA 3AFCA 4GM8A 2BCJB 3GREA 1JOFA 1GG2B 4BL0A 4CY2A 3AL8A 3C9CA 3SCYA 2P9KC 5TEFA 3C5MA 2Z2PA 4LG8A 3NVNA 2H9LA 4L3HD 5CXBA 1Q47A 4CI2A 4QQEA 1GXRA 3I8CA 5FKSA 5C2VB 4O3UB 4O1QD 4CI1A 5AFU3 1OLZA 2Z2OA 4A0BA 2P9NC 2IURA 4TZ4A 2B5MA 4EWRA 5EMLB 4GGDA 1MG3A 5I5MA 3FGBA 3OKYA 3MKQA 2AGYA 4CY1A 5CXCA 4OZUA 4U7AA 1B9YA 1SQ9A 4PSXB 2HKMA 2J55H 2OVQB 5JWZA 3RSEC 3PVUB 2OVRB 2OVPB 4JD2C 4ZOVA 5IJ7E 2CE9A 2IUQA 4FHLA 4CZYA 3DXKC 1K8KC 5EM2A 5FA5B 3UKRC 2Z2NA 3I89A 2HKRA 2P9IC 4A08A 3I7HA 4BUJC 3HFQA 3SFZA 3N0DA 3V7DB 3PSCB 2HESX 3SLED 3MXXA 3RN0D 4OWRA 4A08B 4LG9A 2XL2A 3I7OA 5IJ8E 2CN3A 4CC9A 2UZXB 3N0EA 4ZOZA 2H13A 3VH0A 3UVLA 1QNIA 3KRXB 3EI2B 3F3PA 4J8GA 1PEVA 5I5JA 3UVKA 2H9PA 2PM9A 4FA4D 4E54B 4MK0B 4CY5A 3EMHA 3AH8B 3V9FA 3RRMC 4FA5D 4O3TB 5C9ZB 1NEXB 3J81g 2PM9B 3I7NA 4LGNA 2IWKA 4L3GD 5GXIA 5HE2B 4A2LA 3RFGA 3A0FA 3IIWA 5THAA 3FRXA 5HE3B 3RFHA 2H14A 3PXTD 2OIZA 4ES0A 5EAPA 3W15A 2H9MA 1B9XA 4CZVA 2P9SC 2YNPA 4IA9A 3I8EA 1VYHC 2QC5A 5HE0B 4J79A 3IJ1A 1SQJA 4X3EA 2YBAA 3UVOA 3JZNA 4QT8A 3ORVD 5A2Qg 3RN1D 3VA6A 5EMJB 3PE7A 3SWSD 2CNXA 2GC7A 3F3FA 3JZGA 4PBYA 2CO0C 4JSVC 3PXWD 1XIPA 4UI9R 1RI6A 5EARA 1N6EA 2J57G 2OJYA 4J84A 5CYKB 3NVXA 4G56B 4IMMA 3MZLA 1YFQA 3SJLD 4QL1A 3RLMD 1PBYB 2AGXA 5K1CC 2H9NA 4A09A 2I0RA 4J78A 3RMZD 4XEIC 3PVWB 4GM9A 1L0QA 3SBRA 4PC0A 3SMRA 5KDOB 1N6FA 4KFMB 5AMSA 4FAND 4GQ1A 4A09B 2YMUA 2HJ4A 1S4UX 2B4EA 1U4CA 3K27A 3DWLC 4GQBB 3C99A 2IUPA 3KRWB 4BH6A 2Q7QA 1JMXB 3MMYA 2CE8A 2I0SA 2P9LC 4PSWB 3SHFA 4X61B 3ULEC 3E0CA 4HDJA 2PM6B 2BBKH 3UR4A 4ESGA 2YB8B 3BWSA 3IKOA 4H5IA 3OW8A 5H14A 3OTTA 5H17A 1K32A 4CZXA 4R7AB 3JB9L 3DSMA 3I2NA 3EI2A 3L4OD 4O9DA 4JT6C 2TRCB
chains in the Genus database with same CATH superfamily
3P4FA 3EI4A 2HYEA 5TF2A 5K19A 4E54A 5M5VA 4A2MA 4JT5C 3K71A 4J82A 4A0AB 1E8NA 4A11A 4JXMA 3UVMA 4J0WA 3EI4B 5HE1B 2I0TA 3DXMC 3GC3B 5M5TA 2IUVA 4U1EI 4E5ZB 3EU7A 4Z7OA 5GXHA 4CY3A 3PXSD 4G55A 4PNKB 4A11B 3OKTA 5C86A 2HU8A 1E8MA 1GOTB 3MKSB 2HXCA 2EBSA 2AH0A 4J0XA 3ZDYA 4J73A 4NAAA 3OL2B 1GOFA 1JMZB 2H3XA 3SBQA 4AOWA 2B5NA 2AGWA 4UM8A 4AMYA 3J80g 4ERZA 3FCUA 1U8CA 4Y5RD 2WQ8A 3IJCA 3UVNA 1U2VC 1FWXA 4BCCA 5IGOA 3O4GA 3ZDXA 3SVWD 3L4MD 4O45A 4Z8LA 2AGZA 4ZOXA 5IT9g 3U4YA 3ZWLB 5IC7A 2AQ5A 5I5IA 3QHYB 2W18A 4RE5A 3EWEA 3NVQA 2IAAA 3BG0A 1XHMA 2H6NA 4AEZA 2P9PC 5EAMA 4D0KA 2XL3A 4G1MA 3EQ8A 5FFGA 4WK4A 5CYKA 3IJ0A 3ODTA 5HDBA 4GM3A 4AX4A 3IVMA 4MMXA 5M5RA 5E6UA 3K26A 4NSXA 5FXYA 2H6QA 4JHNA 4H5JA 3MVDK 5FKRA 4K3JB 3EI1B 3OKWA 4FA1D 4QRJA 2H47A 5GSAA 4O2WA 1BPOA 1TBGA 4UM9A 5SXMA 4XYHA 4DNUA 5EALA 4L9OA 4ERQA 4ZN4A 5HYNB 4D6VA 3AL8B 4ZOYA 1M1XA 3IUNA 4FAVD 3CIKB 5AJAA 1VZ2A 1P22A 5B4WA 2IWFA 3T3MA 4CI3A 4GGCA 3FM0A 1JJUB 4GMBA 4GQ2P 4X63B 5CXBB 1H2XA 2VDQA 5FKTA 2G99A 5TDHB 2H6KA 3EI3A 2VDOA 3JZHA 4K3ID 3ZE1A 4JSNC 2OK4A 2HJBA 2GC4A 4JSPC 5FQDA 4FB1D 1MDAH 2O9KA 1ERJA 1SHYB 1MG2A 3B7FA 3ZDZA 2CN2A 4BP9A 2GNQA 4A0BB 2YNOA 2QXVA 3EI3B 4A0AA 2MTAH 3OKYB 4GGAA 2PM7B 3UKUC 2G9AA 3GFCA 5CXCB 3MUOA 3NIDA 2XYIA 2I3TA 2VDPA 4L1QD 4J86A 4E5ZA 3MZKA 4BCDA 4Z7QA 3JAMg 1OMWB 5EM2B 3CFVA 1PI6A 2PBIB 3O4JA 2XDWA 4QAMA 4FA9D 4DNWA 4Z7NA 4FWWA 2AGLA 3CFSB 3OL2A 4J77A 3C75H 2B5LA 1UOPA 3IIYA 3BG1A 4AN1A 4ERYA 2VC2A 5FKQA 1TYQC 1T2XA 4NC4A 1XKSA 5TEEA 3V4PA 2P9UC 4A7JA 5FLXg 3JROA 5HQGA 4BCBA 4YVDA 3F3GA 3JRPA 1PGUA 1N6DA 2J56H 3JPXA 2UZYB 3V5WB 2I3SA 5M5UA 5E6SA 3I7LA 4GZ8A 3SXTD 4JSXC 4XYIA 4G1EA 2AH1A 4CI8A 4Y7RA 5EMMB 2YNNA 2H68A 4N14A 1A0RB 3ZE2A 5IGQA 2OK6A 4J87A 4PBZA 4PXWA 1QFSA 5C2WB 3DM0A 3VGZA 3SBPA 3EG6A 4X60B 5EMKB 2VDRA 4MMZA 5H1MA 2CO0A 4I79A 3ZE0A 1NR0A 3PSLA 5GMKn 2XE4A 1C9LA 3SN6B 3EI1A 1GP2B 3I7KA 3AL9A 2XU7A 4J8BA 3I7PA 3EQ9A 4J81A 1R5MA 3AFCA 4GM8A 2BCJB 3GREA 1GOGA 1JOFA 1GG2B 4BL0A 4CY2A 1A12A 3AL8A 2EIBA 4JHPC 3C9CA 3SCYA 2P9KC 5TEFA 4AN0A 3C5MA 2Z2PA 4LG8A 3VI4A 3NVNA 1C9IA 2H9LA 4L3HD 5CXBA 1Q47A 1UTCA 4CI2A 3GD1I 4QQEA 1GXRA 1H2ZA 3I8CA 5FKSA 4DNVA 5C2VB 4O3UB 3IJEA 4O1QD 1JTDB 4CI1A 5AFU3 1OLZA 2Z2OA 3QI0A 4A0BA 2P9NC 2IURA 4TZ4A 2B5MA 4EWRA 5EMLB 4GGDA 1MG3A 1VE7A 3FGBA 3OKYA 5I5MA 3MKQA 2AGYA 3VI3A 4CY1A 3IURA 5CXCA 2EIEA 4OZUA 4U7AA 3V4VA 1B9YA 1SQ9A 4PSXB 2HKMA 2J55H 2OVQB 1L5GA 3RSEC 5JWZA 3PVUB 2OVRB 2OVPB 4JD2C 4O02A 4ZOVA 5IJ7E 2CE9A 2IUQA 4FHLA 4CZYA 3DXKC 1K8KC 5EM2A 5FA5B 2BKLA 3KCIA 3UKRC 4D9SA 2Z2NA 3I89A 2HKRA 2P9IC 4A08A 3I7HA 4BUJC 3HFQA 4NENA 3SFZA 3N0DA 3V7DB 3PSCB 2HESX 2VDLA 3SLED 3MXXA 3RN0D 4OWRA 4A08B 4LG9A 2XL2A 3I7OA 3O4HA 1TYEA 5IJ8E 2CN3A 3IUQA 4CC9A 2UZXB 3N0EA 4WK0A 4WK2A 1YR2A 4ZOZA 1K3IA 1QFMA 2H13A 3VH0A 3UVLA 1QNIA 3KRXB 3EI2B 3F3PA 3OF7A 4J8GA 1PEVA 5I5JA 3UVKA 2H9PA 2HU7A 2PM9A 4FA4D 4E54B 4MK0B 4CY5A 3EMHA 3AH8B 3V9FA 3RRMC 4WJKA 4MMYA 1H2YA 3K72A 4FA5D 2JKXA 4O3TB 5C9ZB 1NEXB 3J81g 1UOQA 1VZ3A 2PM9B 3I7NA 4LGNA 2IWKA 4L3GD 5GXIA 5HE2B 4A2LA 3EQ7A 3RFGA 3A0FA 3IIWA 3NIGA 4NBMA 3FRXA 5HE3B 5THAA 2EICA 3RFHA 2H14A 2EIDA 3PXTD 2OIZA 4ES0A 3O4IA 5EAPA 3T3PA 3W15A 2H9MA 1B9XA 4CZVA 5FFOA 3MUNA 2P9SC 2YNPA 4IA9A 3I8EA 1VYHC 1O6GA 2QC5A 5HE0B 4L1MA 4J79A 3IJ1A 1GOHA 1SQJA 4X3EA 2YBAA 3UVOA 3JZNA 4QT8A 3ORVD 5A2Qg 3RN1D 3VA6A 4IRZA 2VDNA 2VZ3A 5EMJB 2QZPA 3FCSA 4RE6A 3PE7A 3SWSD 3IUMA 2CNXA 2GC7A 3F3FA 3JZGA 4PBYA 4BP8A 2QR5A 1JV2A 2CO0C 4JSVC 3PXWD 1XIPA 4UI9R 1RI6A 5EARA 1N6EA 2J57G 2OJYA 4J84A 2VDKA 3NVXA 1VE6A 5CYKB 4G56B 4IMMA 3MZLA 1YFQA 1UOOA 3SJLD 4QL1A 3RLMD 1PBYB 2HU5A 2AGXA 5K1CC 2H9NA 4A09A 2I0RA 4J78A 3RMZD 4XEIC 3PVWB 4GM9A 1L0QA 5E6RA 3SBRA 5M5SA 4AMZA 4PC0A 3SMRA 5KDOB 1N6FA 4KFMB 5AMSA 4FAND 4GQ1A 4A09B 2YMUA 2HJ4A 2VZ1A 1S4UX 2B4EA 1U4CA 3K27A 3DWLC 4GQBB 3C99A 2IUPA 3IUJA 3KRWB 4BH6A 2Q7QA 1JMXB 3MMYA 2CE8A 2I0SA 3K6SA 2P9LC 4PSWB 3SHFA 2XZGA 4X61B 3ULEC 5M61A 3E0CA 4HDJA 2PM6B 2BBKH 3UR4A 2VDMA 1E5TA 4ESGA 2YB8B 3BWSA 3NIFA 3IKOA 4H5IA 3IULA 1O6FA 3OW8A 3DDUA 5H14A 5C92A 3OTTA 5H17A 1K32A 4CZXA 1H2WA 4R7AB 3JB9L 3DSMA 3I2NA 3EI2A 3L4OD 4O9DA 1I2MB 4JT6C 2TRCB
chains in the Genus database with same CATH topology
3P4FA 3EI4A 2HYEA 5TF2A 5K19A 4E54A 4A2MA 4JT5C 4A0AB 4J82A 4A11A 4JXMA 3UVMA 4J0WA 3EI4B 5HE1B 2I0TA 3DXMC 2IUVA 4U1EI 4E5ZB 3EU7A 5GXHA 4CY3A 3PXSD 4PNKB 4A11B 3OKTA 1GOTB 3MKSB 2HXCA 2EBSA 2AH0A 4J0XA 4J73A 3OL2B 1JMZB 2H3XA 3SBQA 4AOWA 2B5NA 2AGWA 3J80g 4ERZA 4Y5RD 3IJCA 3UVNA 1U2VC 1FWXA 5IGOA 3SVWD 3L4MD 4O45A 4Z8LA 2AGZA 4ZOXA 5IT9g 3U4YA 3ZWLB 5IC7A 2AQ5A 5I5IA 2W18A 3EWEA 3NVQA 2IAAA 3BG0A 1XHMA 2H6NA 4AEZA 2P9PC 5EAMA 4D0KA 2XL3A 5CYKA 3IJ0A 3ODTA 4GM3A 4NSXA 3K26A 5FXYA 2H6QA 4H5JA 5FKRA 4K3JB 3EI1B 3OKWA 4FA1D 4QRJA 2H47A 5GSAA 1TBGA 5SXMA 4XYHA 5EALA 4L9OA 4ERQA 4ZN4A 5HYNB 4D6VA 3AL8B 4ZOYA 4FAVD 3CIKB 5AJAA 5B4WA 1P22A 2IWFA 4CI3A 4GGCA 3FM0A 1JJUB 4GMBA 4GQ2P 4X63B 5CXBB 5FKTA 2G99A 5TDHB 2H6KA 3EI3A 3JZHA 4K3ID 4JSNC 2OK4A 2HJBA 2GC4A 4JSPC 5FQDA 4FB1D 1MDAH 2O9KA 1ERJA 1SHYB 1MG2A 3B7FA 2CN2A 2GNQA 4A0BB 2YNOA 2QXVA 3EI3B 4A0AA 2MTAH 3OKYB 4GGAA 2PM7B 3UKUC 2G9AA 3GFCA 5CXCB 2XYIA 2I3TA 4L1QD 4J86A 4E5ZA 3MZKA 3JAMg 1OMWB 5EM2B 3CFVA 1PI6A 2PBIB 4FA9D 4FWWA 2AGLA 3CFSB 3OL2A 4J77A 3C75H 2B5LA 3IIYA 3BG1A 4ERYA 5FKQA 1TYQC 1XKSA 5TEEA 2P9UC 4A7JA 5FLXg 3JROA 5HQGA 4YVDA 3F3GA 3JRPA 1PGUA 1N6DA 2J56H 3JPXA 2UZYB 3V5WB 2I3SA 3I7LA 4GZ8A 3SXTD 4JSXC 4XYIA 2AH1A 4CI8A 4Y7RA 5EMMB 2YNNA 2H68A 4N14A 1A0RB 5IGQA 2OK6A 4J87A 4PBZA 4PXWA 5C2WB 3DM0A 3VGZA 3SBPA 3EG6A 4X60B 5EMKB 5H1MA 2CO0A 4I79A 1NR0A 3PSLA 5GMKn 3SN6B 3EI1A 1GP2B 3I7KA 3AL9A 2XU7A 4J8BA 3I7PA 4J81A 1R5MA 3AFCA 4GM8A 2BCJB 3GREA 1JOFA 1GG2B 4BL0A 4CY2A 3AL8A 3C9CA 3SCYA 2P9KC 5TEFA 3C5MA 2Z2PA 4LG8A 3NVNA 2H9LA 4L3HD 5CXBA 1Q47A 4CI2A 4QQEA 1GXRA 3I8CA 5FKSA 5C2VB 4O3UB 4O1QD 4CI1A 5AFU3 1OLZA 2Z2OA 4A0BA 2P9NC 2IURA 4TZ4A 2B5MA 4EWRA 5EMLB 4GGDA 1MG3A 5I5MA 3FGBA 3OKYA 3MKQA 2AGYA 4CY1A 5CXCA 4OZUA 4U7AA 1B9YA 1SQ9A 4PSXB 2HKMA 2J55H 2OVQB 5JWZA 3RSEC 3PVUB 2OVRB 2OVPB 4JD2C 4ZOVA 5IJ7E 2CE9A 2IUQA 4FHLA 4CZYA 3DXKC 1K8KC 5EM2A 5FA5B 3UKRC 2Z2NA 3I89A 2HKRA 2P9IC 4A08A 3I7HA 4BUJC 3HFQA 3SFZA 3N0DA 3V7DB 3PSCB 2HESX 3SLED 3MXXA 3RN0D 4OWRA 4A08B 4LG9A 2XL2A 3I7OA 5IJ8E 2CN3A 4CC9A 2UZXB 3N0EA 4ZOZA 2H13A 3VH0A 3UVLA 1QNIA 3KRXB 3EI2B 3F3PA 4J8GA 1PEVA 5I5JA 3UVKA 2H9PA 2PM9A 4FA4D 4E54B 4MK0B 4CY5A 3EMHA 3AH8B 3V9FA 3RRMC 4FA5D 4O3TB 5C9ZB 1NEXB 3J81g 2PM9B 3I7NA 4LGNA 2IWKA 4L3GD 5GXIA 5HE2B 4A2LA 3RFGA 3A0FA 3IIWA 5THAA 3FRXA 5HE3B 3RFHA 2H14A 3PXTD 2OIZA 4ES0A 5EAPA 3W15A 2H9MA 1B9XA 4CZVA 2P9SC 2YNPA 4IA9A 3I8EA 1VYHC 2QC5A 5HE0B 4J79A 3IJ1A 1SQJA 4X3EA 2YBAA 3UVOA 3JZNA 4QT8A 3ORVD 5A2Qg 3RN1D 3VA6A 5EMJB 3PE7A 3SWSD 2CNXA 2GC7A 3F3FA 3JZGA 4PBYA 2CO0C 4JSVC 3PXWD 1XIPA 4UI9R 1RI6A 5EARA 1N6EA 2J57G 2OJYA 4J84A 5CYKB 3NVXA 4G56B 4IMMA 3MZLA 1YFQA 3SJLD 4QL1A 3RLMD 1PBYB 2AGXA 5K1CC 2H9NA 4A09A 2I0RA 4J78A 3RMZD 4XEIC 3PVWB 4GM9A 1L0QA 3SBRA 4PC0A 3SMRA 5KDOB 1N6FA 4KFMB 5AMSA 4FAND 4GQ1A 4A09B 2YMUA 2HJ4A 1S4UX 2B4EA 1U4CA 3K27A 3DWLC 4GQBB 3C99A 2IUPA 3KRWB 4BH6A 2Q7QA 1JMXB 3MMYA 2CE8A 2I0SA 2P9LC 4PSWB 3SHFA 4X61B 3ULEC 3E0CA 4HDJA 2PM6B 2BBKH 3UR4A 4ESGA 2YB8B 3BWSA 3IKOA 4H5IA 3OW8A 5H14A 3OTTA 5H17A 1K32A 4CZXA 4R7AB 3JB9L 3DSMA 3I2NA 3EI2A 3L4OD 4O9DA 4JT6C 2TRCB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P4F A;  3EI4 A;  2HYE A;  5TF2 A;  5K19 A;  4E54 A;  4A2M A;  4JT5 C;  4A0A B;  4J82 A;  4A11 A;  4JXM A;  3UVM A;  4J0W A;  3EI4 B;  5HE1 B;  2I0T A;  3DXM C;  2IUV A;  4U1E I;  4E5Z B;  3EU7 A;  5GXH A;  4CY3 A;  3PXS D;  4PNK B;  4A11 B;  3OKT A;  1GOT B;  3MKS B;  2HXC A;  2EBS A;  2AH0 A;  4J0X A;  4J73 A;  3OL2 B;  1JMZ B;  2H3X A;  3SBQ A;  4AOW A;  2B5N A;  2AGW A;  3J80 g;  4ERZ A;  4Y5R D;  3IJC A;  3UVN A;  1U2V C;  1FWX A;  5IGO A;  3SVW D;  3L4M D;  4O45 A;  4Z8L A;  2AGZ A;  4ZOX A;  5IT9 g;  3U4Y A;  3ZWL B;  5IC7 A;  2AQ5 A;  5I5I A;  2W18 A;  3EWE A;  3NVQ A;  2IAA A;  3BG0 A;  1XHM A;  2H6N A;  4AEZ A;  2P9P C;  5EAM A;  4D0K A;  2XL3 A;  5CYK A;  3IJ0 A;  3ODT A;  4GM3 A;  4NSX A;  3K26 A;  5FXY A;  2H6Q A;  4H5J A;  5FKR A;  4K3J B;  3EI1 B;  3OKW A;  4FA1 D;  4QRJ A;  2H47 A;  5GSA A;  1TBG A;  5SXM A;  4XYH A;  5EAL A;  4L9O A;  4ERQ A;  4ZN4 A;  5HYN B;  4D6V A;  3AL8 B;  4ZOY A;  4FAV D;  3CIK B;  5AJA A;  5B4W A;  1P22 A;  2IWF A;  4CI3 A;  4GGC A;  3FM0 A;  1JJU B;  4GMB A;  4GQ2 P;  4X63 B;  5CXB B;  5FKT A;  2G99 A;  5TDH B;  2H6K A;  3EI3 A;  3JZH A;  4K3I D;  4JSN C;  2OK4 A;  2HJB A;  2GC4 A;  4JSP C;  5FQD A;  4FB1 D;  1MDA H;  2O9K A;  1ERJ A;  1SHY B;  1MG2 A;  3B7F A;  2CN2 A;  2GNQ A;  4A0B B;  2YNO A;  2QXV A;  3EI3 B;  4A0A A;  2MTA H;  3OKY B;  4GGA A;  2PM7 B;  3UKU C;  2G9A A;  3GFC A;  5CXC B;  2XYI A;  2I3T A;  4L1Q D;  4J86 A;  4E5Z A;  3MZK A;  3JAM g;  1OMW B;  5EM2 B;  3CFV A;  1PI6 A;  2PBI B;  4FA9 D;  4FWW A;  2AGL A;  3CFS B;  3OL2 A;  4J77 A;  3C75 H;  2B5L A;  3IIY A;  3BG1 A;  4ERY A;  5FKQ A;  1TYQ C;  1XKS A;  5TEE A;  2P9U C;  4A7J A;  5FLX g;  3JRO A;  5HQG A;  4YVD A;  3F3G A;  3JRP A;  1PGU A;  1N6D A;  2J56 H;  3JPX A;  2UZY B;  3V5W B;  2I3S A;  3I7L A;  4GZ8 A;  3SXT D;  4JSX C;  4XYI A;  2AH1 A;  4CI8 A;  4Y7R A;  5EMM B;  2YNN A;  2H68 A;  4N14 A;  1A0R B;  5IGQ A;  2OK6 A;  4J87 A;  4PBZ A;  4PXW A;  5C2W B;  3DM0 A;  3VGZ A;  3SBP A;  3EG6 A;  4X60 B;  5EMK B;  5H1M A;  2CO0 A;  4I79 A;  1NR0 A;  3PSL A;  5GMK n;  3SN6 B;  3EI1 A;  1GP2 B;  3I7K A;  3AL9 A;  2XU7 A;  4J8B A;  3I7P A;  4J81 A;  1R5M A;  3AFC A;  4GM8 A;  2BCJ B;  3GRE A;  1JOF A;  1GG2 B;  4BL0 A;  4CY2 A;  3AL8 A;  3C9C A;  3SCY A;  2P9K C;  5TEF A;  3C5M A;  2Z2P A;  4LG8 A;  3NVN A;  2H9L A;  4L3H D;  5CXB A;  1Q47 A;  4CI2 A;  4QQE A;  1GXR A;  3I8C A;  5FKS A;  5C2V B;  4O3U B;  4O1Q D;  4CI1 A;  5AFU 3;  1OLZ A;  2Z2O A;  4A0B A;  2P9N C;  2IUR A;  4TZ4 A;  2B5M A;  4EWR A;  5EML B;  4GGD A;  1MG3 A;  5I5M A;  3FGB A;  3OKY A;  3MKQ A;  2AGY A;  4CY1 A;  5CXC A;  4OZU A;  4U7A A;  1B9Y A;  1SQ9 A;  4PSX B;  2HKM A;  2J55 H;  2OVQ B;  5JWZ A;  3RSE C;  3PVU B;  2OVR B;  2OVP B;  4JD2 C;  4ZOV A;  5IJ7 E;  2CE9 A;  2IUQ A;  4FHL A;  4CZY A;  3DXK C;  1K8K C;  5EM2 A;  5FA5 B;  3UKR C;  2Z2N A;  3I89 A;  2HKR A;  2P9I C;  4A08 A;  3I7H A;  4BUJ C;  3HFQ A;  3SFZ A;  3N0D A;  3V7D B;  3PSC B;  2HES X;  3SLE D;  3MXX A;  3RN0 D;  4OWR A;  4A08 B;  4LG9 A;  2XL2 A;  3I7O A;  5IJ8 E;  2CN3 A;  4CC9 A;  2UZX B;  3N0E A;  4ZOZ A;  2H13 A;  3VH0 A;  3UVL A;  1QNI A;  3KRX B;  3EI2 B;  3F3P A;  4J8G A;  1PEV A;  5I5J A;  3UVK A;  2H9P A;  2PM9 A;  4FA4 D;  4E54 B;  4MK0 B;  4CY5 A;  3EMH A;  3AH8 B;  3V9F A;  3RRM C;  4FA5 D;  4O3T B;  5C9Z B;  1NEX B;  3J81 g;  2PM9 B;  3I7N A;  4LGN A;  2IWK A;  4L3G D;  5GXI A;  5HE2 B;  4A2L A;  3RFG A;  3A0F A;  3IIW A;  5THA A;  3FRX A;  5HE3 B;  3RFH A;  2H14 A;  3PXT D;  2OIZ A;  4ES0 A;  5EAP A;  3W15 A;  2H9M A;  1B9X A;  4CZV A;  2P9S C;  2YNP A;  4IA9 A;  3I8E A;  1VYH C;  2QC5 A;  5HE0 B;  4J79 A;  3IJ1 A;  1SQJ A;  4X3E A;  2YBA A;  3UVO A;  3JZN A;  4QT8 A;  3ORV D;  5A2Q g;  3RN1 D;  3VA6 A;  5EMJ B;  3PE7 A;  3SWS D;  2CNX A;  2GC7 A;  3F3F A;  3JZG A;  4PBY A;  2CO0 C;  4JSV C;  3PXW D;  1XIP A;  4UI9 R;  1RI6 A;  5EAR A;  1N6E A;  2J57 G;  2OJY A;  4J84 A;  5CYK B;  3NVX A;  4G56 B;  4IMM A;  3MZL A;  1YFQ A;  3SJL D;  4QL1 A;  3RLM D;  1PBY B;  2AGX A;  5K1C C;  2H9N A;  4A09 A;  2I0R A;  4J78 A;  3RMZ D;  4XEI C;  3PVW B;  4GM9 A;  1L0Q A;  3SBR A;  4PC0 A;  3SMR A;  5KDO B;  1N6F A;  4KFM B;  5AMS A;  4FAN D;  4GQ1 A;  4A09 B;  2YMU A;  2HJ4 A;  1S4U X;  2B4E A;  1U4C A;  3K27 A;  3DWL C;  4GQB B;  3C99 A;  2IUP A;  3KRW B;  4BH6 A;  2Q7Q A;  1JMX B;  3MMY A;  2CE8 A;  2I0S A;  2P9L C;  4PSW B;  3SHF A;  4X61 B;  3ULE C;  3E0C A;  4HDJ A;  2PM6 B;  2BBK H;  3UR4 A;  4ESG A;  2YB8 B;  3BWS A;  3IKO A;  4H5I A;  3OW8 A;  5H14 A;  3OTT A;  5H17 A;  1K32 A;  4CZX A;  4R7A B;  3JB9 L;  3DSM A;  3I2N A;  3EI2 A;  3L4O D;  4O9D A;  4JT6 C;  2TRC B; 
#chains in the Genus database with same CATH topology
 3P4F A;  3EI4 A;  2HYE A;  5TF2 A;  5K19 A;  4E54 A;  5M5V A;  4A2M A;  4JT5 C;  3K71 A;  4J82 A;  4A0A B;  1E8N A;  4A11 A;  4JXM A;  3UVM A;  4J0W A;  3EI4 B;  5HE1 B;  2I0T A;  3DXM C;  3GC3 B;  5M5T A;  2IUV A;  4U1E I;  4E5Z B;  3EU7 A;  4Z7O A;  5GXH A;  4CY3 A;  3PXS D;  4G55 A;  4PNK B;  4A11 B;  3OKT A;  5C86 A;  2HU8 A;  1E8M A;  1GOT B;  3MKS B;  2HXC A;  2EBS A;  2AH0 A;  4J0X A;  3ZDY A;  4J73 A;  4NAA A;  3OL2 B;  1GOF A;  1JMZ B;  2H3X A;  3SBQ A;  4AOW A;  2B5N A;  2AGW A;  4UM8 A;  4AMY A;  3J80 g;  4ERZ A;  3FCU A;  1U8C A;  4Y5R D;  2WQ8 A;  3IJC A;  3UVN A;  1U2V C;  1FWX A;  4BCC A;  5IGO A;  3O4G A;  3ZDX A;  3SVW D;  3L4M D;  4O45 A;  4Z8L A;  2AGZ A;  4ZOX A;  5IT9 g;  3U4Y A;  3ZWL B;  5IC7 A;  2AQ5 A;  5I5I A;  3QHY B;  2W18 A;  4RE5 A;  3EWE A;  3NVQ A;  2IAA A;  3BG0 A;  1XHM A;  2H6N A;  4AEZ A;  2P9P C;  5EAM A;  4D0K A;  2XL3 A;  4G1M A;  3EQ8 A;  5FFG A;  4WK4 A;  5CYK A;  3IJ0 A;  3ODT A;  5HDB A;  4GM3 A;  4AX4 A;  3IVM A;  4MMX A;  5M5R A;  5E6U A;  3K26 A;  4NSX A;  5FXY A;  2H6Q A;  4JHN A;  4H5J A;  3MVD K;  5FKR A;  4K3J B;  3EI1 B;  3OKW A;  4FA1 D;  4QRJ A;  2H47 A;  5GSA A;  4O2W A;  1BPO A;  1TBG A;  4UM9 A;  5SXM A;  4XYH A;  4DNU A;  5EAL A;  4L9O A;  4ERQ A;  4ZN4 A;  5HYN B;  4D6V A;  3AL8 B;  4ZOY A;  1M1X A;  3IUN A;  4FAV D;  3CIK B;  5AJA A;  1VZ2 A;  1P22 A;  5B4W A;  2IWF A;  3T3M A;  4CI3 A;  4GGC A;  3FM0 A;  1JJU B;  4GMB A;  4GQ2 P;  4X63 B;  5CXB B;  1H2X A;  2VDQ A;  5FKT A;  2G99 A;  5TDH B;  2H6K A;  3EI3 A;  2VDO A;  3JZH A;  4K3I D;  3ZE1 A;  4JSN C;  2OK4 A;  2HJB A;  2GC4 A;  4JSP C;  5FQD A;  4FB1 D;  1MDA H;  2O9K A;  1ERJ A;  1SHY B;  1MG2 A;  3B7F A;  3ZDZ A;  2CN2 A;  4BP9 A;  2GNQ A;  4A0B B;  2YNO A;  2QXV A;  3EI3 B;  4A0A A;  2MTA H;  3OKY B;  4GGA A;  2PM7 B;  3UKU C;  2G9A A;  3GFC A;  5CXC B;  3MUO A;  3NID A;  2XYI A;  2I3T A;  2VDP A;  4L1Q D;  4J86 A;  4E5Z A;  3MZK A;  4BCD A;  4Z7Q A;  3JAM g;  1OMW B;  5EM2 B;  3CFV A;  1PI6 A;  2PBI B;  3O4J A;  2XDW A;  4QAM A;  4FA9 D;  4DNW A;  4Z7N A;  4FWW A;  2AGL A;  3CFS B;  3OL2 A;  4J77 A;  3C75 H;  2B5L A;  1UOP A;  3IIY A;  3BG1 A;  4AN1 A;  4ERY A;  2VC2 A;  5FKQ A;  1TYQ C;  1T2X A;  4NC4 A;  1XKS A;  5TEE A;  3V4P A;  2P9U C;  4A7J A;  5FLX g;  3JRO A;  5HQG A;  4BCB A;  4YVD A;  3F3G A;  3JRP A;  1PGU A;  1N6D A;  2J56 H;  3JPX A;  2UZY B;  3V5W B;  2I3S A;  5M5U A;  5E6S A;  3I7L A;  4GZ8 A;  3SXT D;  4JSX C;  4XYI A;  4G1E A;  2AH1 A;  4CI8 A;  4Y7R A;  5EMM B;  2YNN A;  2H68 A;  4N14 A;  1A0R B;  3ZE2 A;  5IGQ A;  2OK6 A;  4J87 A;  4PBZ A;  4PXW A;  1QFS A;  5C2W B;  3DM0 A;  3VGZ A;  3SBP A;  3EG6 A;  4X60 B;  5EMK B;  2VDR A;  4MMZ A;  5H1M A;  2CO0 A;  4I79 A;  3ZE0 A;  1NR0 A;  3PSL A;  5GMK n;  2XE4 A;  1C9L A;  3SN6 B;  3EI1 A;  1GP2 B;  3I7K A;  3AL9 A;  2XU7 A;  4J8B A;  3I7P A;  3EQ9 A;  4J81 A;  1R5M A;  3AFC A;  4GM8 A;  2BCJ B;  3GRE A;  1GOG A;  1JOF A;  1GG2 B;  4BL0 A;  4CY2 A;  1A12 A;  3AL8 A;  2EIB A;  4JHP C;  3C9C A;  3SCY A;  2P9K C;  5TEF A;  4AN0 A;  3C5M A;  2Z2P A;  4LG8 A;  3VI4 A;  3NVN A;  1C9I A;  2H9L A;  4L3H D;  5CXB A;  1Q47 A;  1UTC A;  4CI2 A;  3GD1 I;  4QQE A;  1GXR A;  1H2Z A;  3I8C A;  5FKS A;  4DNV A;  5C2V B;  4O3U B;  3IJE A;  4O1Q D;  1JTD B;  4CI1 A;  5AFU 3;  1OLZ A;  2Z2O A;  3QI0 A;  4A0B A;  2P9N C;  2IUR A;  4TZ4 A;  2B5M A;  4EWR A;  5EML B;  4GGD A;  1MG3 A;  1VE7 A;  3FGB A;  3OKY A;  5I5M A;  3MKQ A;  2AGY A;  3VI3 A;  4CY1 A;  3IUR A;  5CXC A;  2EIE A;  4OZU A;  4U7A A;  3V4V A;  1B9Y A;  1SQ9 A;  4PSX B;  2HKM A;  2J55 H;  2OVQ B;  1L5G A;  3RSE C;  5JWZ A;  3PVU B;  2OVR B;  2OVP B;  4JD2 C;  4O02 A;  4ZOV A;  5IJ7 E;  2CE9 A;  2IUQ A;  4FHL A;  4CZY A;  3DXK C;  1K8K C;  5EM2 A;  5FA5 B;  2BKL A;  3KCI A;  3UKR C;  4D9S A;  2Z2N A;  3I89 A;  2HKR A;  2P9I C;  4A08 A;  3I7H A;  4BUJ C;  3HFQ A;  4NEN A;  3SFZ A;  3N0D A;  3V7D B;  3PSC B;  2HES X;  2VDL A;  3SLE D;  3MXX A;  3RN0 D;  4OWR A;  4A08 B;  4LG9 A;  2XL2 A;  3I7O A;  3O4H A;  1TYE A;  5IJ8 E;  2CN3 A;  3IUQ A;  4CC9 A;  2UZX B;  3N0E A;  4WK0 A;  4WK2 A;  1YR2 A;  4ZOZ A;  1K3I A;  1QFM A;  2H13 A;  3VH0 A;  3UVL A;  1QNI A;  3KRX B;  3EI2 B;  3F3P A;  3OF7 A;  4J8G A;  1PEV A;  5I5J A;  3UVK A;  2H9P A;  2HU7 A;  2PM9 A;  4FA4 D;  4E54 B;  4MK0 B;  4CY5 A;  3EMH A;  3AH8 B;  3V9F A;  3RRM C;  4WJK A;  4MMY A;  1H2Y A;  3K72 A;  4FA5 D;  2JKX A;  4O3T B;  5C9Z B;  1NEX B;  3J81 g;  1UOQ A;  1VZ3 A;  2PM9 B;  3I7N A;  4LGN A;  2IWK A;  4L3G D;  5GXI A;  5HE2 B;  4A2L A;  3EQ7 A;  3RFG A;  3A0F A;  3IIW A;  3NIG A;  4NBM A;  3FRX A;  5HE3 B;  5THA A;  2EIC A;  3RFH A;  2H14 A;  2EID A;  3PXT D;  2OIZ A;  4ES0 A;  3O4I A;  5EAP A;  3T3P A;  3W15 A;  2H9M A;  1B9X A;  4CZV A;  5FFO A;  3MUN A;  2P9S C;  2YNP A;  4IA9 A;  3I8E A;  1VYH C;  1O6G A;  2QC5 A;  5HE0 B;  4L1M A;  4J79 A;  3IJ1 A;  1GOH A;  1SQJ A;  4X3E A;  2YBA A;  3UVO A;  3JZN A;  4QT8 A;  3ORV D;  5A2Q g;  3RN1 D;  3VA6 A;  4IRZ A;  2VDN A;  2VZ3 A;  5EMJ B;  2QZP A;  3FCS A;  4RE6 A;  3PE7 A;  3SWS D;  3IUM A;  2CNX A;  2GC7 A;  3F3F A;  3JZG A;  4PBY A;  4BP8 A;  2QR5 A;  1JV2 A;  2CO0 C;  4JSV C;  3PXW D;  1XIP A;  4UI9 R;  1RI6 A;  5EAR A;  1N6E A;  2J57 G;  2OJY A;  4J84 A;  2VDK A;  3NVX A;  1VE6 A;  5CYK B;  4G56 B;  4IMM A;  3MZL A;  1YFQ A;  1UOO A;  3SJL D;  4QL1 A;  3RLM D;  1PBY B;  2HU5 A;  2AGX A;  5K1C C;  2H9N A;  4A09 A;  2I0R A;  4J78 A;  3RMZ D;  4XEI C;  3PVW B;  4GM9 A;  1L0Q A;  5E6R A;  3SBR A;  5M5S A;  4AMZ A;  4PC0 A;  3SMR A;  5KDO B;  1N6F A;  4KFM B;  5AMS A;  4FAN D;  4GQ1 A;  4A09 B;  2YMU A;  2HJ4 A;  2VZ1 A;  1S4U X;  2B4E A;  1U4C A;  3K27 A;  3DWL C;  4GQB B;  3C99 A;  2IUP A;  3IUJ A;  3KRW B;  4BH6 A;  2Q7Q A;  1JMX B;  3MMY A;  2CE8 A;  2I0S A;  3K6S A;  2P9L C;  4PSW B;  3SHF A;  2XZG A;  4X61 B;  3ULE C;  5M61 A;  3E0C A;  4HDJ A;  2PM6 B;  2BBK H;  3UR4 A;  2VDM A;  1E5T A;  4ESG A;  2YB8 B;  3BWS A;  3NIF A;  3IKO A;  4H5I A;  3IUL A;  1O6F A;  3OW8 A;  3DDU A;  5H14 A;  5C92 A;  3OTT A;  5H17 A;  1K32 A;  4CZX A;  1H2W A;  4R7A B;  3JB9 L;  3DSM A;  3I2N A;  3EI2 A;  3L4O D;  4O9D A;  1I2M B;  4JT6 C;  2TRC B; 
#chains in the Genus database with same CATH homology
 3P4F A;  3EI4 A;  2HYE A;  5TF2 A;  5K19 A;  4E54 A;  4A2M A;  4JT5 C;  4A0A B;  4J82 A;  4A11 A;  4JXM A;  3UVM A;  4J0W A;  3EI4 B;  5HE1 B;  2I0T A;  3DXM C;  2IUV A;  4U1E I;  4E5Z B;  3EU7 A;  5GXH A;  4CY3 A;  3PXS D;  4PNK B;  4A11 B;  3OKT A;  1GOT B;  3MKS B;  2HXC A;  2EBS A;  2AH0 A;  4J0X A;  4J73 A;  3OL2 B;  1JMZ B;  2H3X A;  3SBQ A;  4AOW A;  2B5N A;  2AGW A;  3J80 g;  4ERZ A;  4Y5R D;  3IJC A;  3UVN A;  1U2V C;  1FWX A;  5IGO A;  3SVW D;  3L4M D;  4O45 A;  4Z8L A;  2AGZ A;  4ZOX A;  5IT9 g;  3U4Y A;  3ZWL B;  5IC7 A;  2AQ5 A;  5I5I A;  2W18 A;  3EWE A;  3NVQ A;  2IAA A;  3BG0 A;  1XHM A;  2H6N A;  4AEZ A;  2P9P C;  5EAM A;  4D0K A;  2XL3 A;  5CYK A;  3IJ0 A;  3ODT A;  4GM3 A;  4NSX A;  3K26 A;  5FXY A;  2H6Q A;  4H5J A;  5FKR A;  4K3J B;  3EI1 B;  3OKW A;  4FA1 D;  4QRJ A;  2H47 A;  5GSA A;  1TBG A;  5SXM A;  4XYH A;  5EAL A;  4L9O A;  4ERQ A;  4ZN4 A;  5HYN B;  4D6V A;  3AL8 B;  4ZOY A;  4FAV D;  3CIK B;  5AJA A;  5B4W A;  1P22 A;  2IWF A;  4CI3 A;  4GGC A;  3FM0 A;  1JJU B;  4GMB A;  4GQ2 P;  4X63 B;  5CXB B;  5FKT A;  2G99 A;  5TDH B;  2H6K A;  3EI3 A;  3JZH A;  4K3I D;  4JSN C;  2OK4 A;  2HJB A;  2GC4 A;  4JSP C;  5FQD A;  4FB1 D;  1MDA H;  2O9K A;  1ERJ A;  1SHY B;  1MG2 A;  3B7F A;  2CN2 A;  2GNQ A;  4A0B B;  2YNO A;  2QXV A;  3EI3 B;  4A0A A;  2MTA H;  3OKY B;  4GGA A;  2PM7 B;  3UKU C;  2G9A A;  3GFC A;  5CXC B;  2XYI A;  2I3T A;  4L1Q D;  4J86 A;  4E5Z A;  3MZK A;  3JAM g;  1OMW B;  5EM2 B;  3CFV A;  1PI6 A;  2PBI B;  4FA9 D;  4FWW A;  2AGL A;  3CFS B;  3OL2 A;  4J77 A;  3C75 H;  2B5L A;  3IIY A;  3BG1 A;  4ERY A;  5FKQ A;  1TYQ C;  1XKS A;  5TEE A;  2P9U C;  4A7J A;  5FLX g;  3JRO A;  5HQG A;  4YVD A;  3F3G A;  3JRP A;  1PGU A;  1N6D A;  2J56 H;  3JPX A;  2UZY B;  3V5W B;  2I3S A;  3I7L A;  4GZ8 A;  3SXT D;  4JSX C;  4XYI A;  2AH1 A;  4CI8 A;  4Y7R A;  5EMM B;  2YNN A;  2H68 A;  4N14 A;  1A0R B;  5IGQ A;  2OK6 A;  4J87 A;  4PBZ A;  4PXW A;  5C2W B;  3DM0 A;  3VGZ A;  3SBP A;  3EG6 A;  4X60 B;  5EMK B;  5H1M A;  2CO0 A;  4I79 A;  1NR0 A;  3PSL A;  5GMK n;  3SN6 B;  3EI1 A;  1GP2 B;  3I7K A;  3AL9 A;  2XU7 A;  4J8B A;  3I7P A;  4J81 A;  1R5M A;  3AFC A;  4GM8 A;  2BCJ B;  3GRE A;  1JOF A;  1GG2 B;  4BL0 A;  4CY2 A;  3AL8 A;  3C9C A;  3SCY A;  2P9K C;  5TEF A;  3C5M A;  2Z2P A;  4LG8 A;  3NVN A;  2H9L A;  4L3H D;  5CXB A;  1Q47 A;  4CI2 A;  4QQE A;  1GXR A;  3I8C A;  5FKS A;  5C2V B;  4O3U B;  4O1Q D;  4CI1 A;  5AFU 3;  1OLZ A;  2Z2O A;  4A0B A;  2P9N C;  2IUR A;  4TZ4 A;  2B5M A;  4EWR A;  5EML B;  4GGD A;  1MG3 A;  5I5M A;  3FGB A;  3OKY A;  3MKQ A;  2AGY A;  4CY1 A;  5CXC A;  4OZU A;  4U7A A;  1B9Y A;  1SQ9 A;  4PSX B;  2HKM A;  2J55 H;  2OVQ B;  5JWZ A;  3RSE C;  3PVU B;  2OVR B;  2OVP B;  4JD2 C;  4ZOV A;  5IJ7 E;  2CE9 A;  2IUQ A;  4FHL A;  4CZY A;  3DXK C;  1K8K C;  5EM2 A;  5FA5 B;  3UKR C;  2Z2N A;  3I89 A;  2HKR A;  2P9I C;  4A08 A;  3I7H A;  4BUJ C;  3HFQ A;  3SFZ A;  3N0D A;  3V7D B;  3PSC B;  2HES X;  3SLE D;  3MXX A;  3RN0 D;  4OWR A;  4A08 B;  4LG9 A;  2XL2 A;  3I7O A;  5IJ8 E;  2CN3 A;  4CC9 A;  2UZX B;  3N0E A;  4ZOZ A;  2H13 A;  3VH0 A;  3UVL A;  1QNI A;  3KRX B;  3EI2 B;  3F3P A;  4J8G A;  1PEV A;  5I5J A;  3UVK A;  2H9P A;  2PM9 A;  4FA4 D;  4E54 B;  4MK0 B;  4CY5 A;  3EMH A;  3AH8 B;  3V9F A;  3RRM C;  4FA5 D;  4O3T B;  5C9Z B;  1NEX B;  3J81 g;  2PM9 B;  3I7N A;  4LGN A;  2IWK A;  4L3G D;  5GXI A;  5HE2 B;  4A2L A;  3RFG A;  3A0F A;  3IIW A;  5THA A;  3FRX A;  5HE3 B;  3RFH A;  2H14 A;  3PXT D;  2OIZ A;  4ES0 A;  5EAP A;  3W15 A;  2H9M A;  1B9X A;  4CZV A;  2P9S C;  2YNP A;  4IA9 A;  3I8E A;  1VYH C;  2QC5 A;  5HE0 B;  4J79 A;  3IJ1 A;  1SQJ A;  4X3E A;  2YBA A;  3UVO A;  3JZN A;  4QT8 A;  3ORV D;  5A2Q g;  3RN1 D;  3VA6 A;  5EMJ B;  3PE7 A;  3SWS D;  2CNX A;  2GC7 A;  3F3F A;  3JZG A;  4PBY A;  2CO0 C;  4JSV C;  3PXW D;  1XIP A;  4UI9 R;  1RI6 A;  5EAR A;  1N6E A;  2J57 G;  2OJY A;  4J84 A;  5CYK B;  3NVX A;  4G56 B;  4IMM A;  3MZL A;  1YFQ A;  3SJL D;  4QL1 A;  3RLM D;  1PBY B;  2AGX A;  5K1C C;  2H9N A;  4A09 A;  2I0R A;  4J78 A;  3RMZ D;  4XEI C;  3PVW B;  4GM9 A;  1L0Q A;  3SBR A;  4PC0 A;  3SMR A;  5KDO B;  1N6F A;  4KFM B;  5AMS A;  4FAN D;  4GQ1 A;  4A09 B;  2YMU A;  2HJ4 A;  1S4U X;  2B4E A;  1U4C A;  3K27 A;  3DWL C;  4GQB B;  3C99 A;  2IUP A;  3KRW B;  4BH6 A;  2Q7Q A;  1JMX B;  3MMY A;  2CE8 A;  2I0S A;  2P9L C;  4PSW B;  3SHF A;  4X61 B;  3ULE C;  3E0C A;  4HDJ A;  2PM6 B;  2BBK H;  3UR4 A;  4ESG A;  2YB8 B;  3BWS A;  3IKO A;  4H5I A;  3OW8 A;  5H14 A;  3OTT A;  5H17 A;  1K32 A;  4CZX A;  4R7A B;  3JB9 L;  3DSM A;  3I2N A;  3EI2 A;  3L4O D;  4O9D A;  4JT6 C;  2TRC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...