3ODTA

Crystal structure of wd40 beta propeller domain of doa1
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
297
structure length
296
Chain Sequence
FTGYQLSATLKGHDQDVRDVVAVDDSKVASVSRDGTVRLWSKDDQWLGTVVYTGQGFLNSVCYDSEKELLLFGGKDTMINGVPLFATSGEDPYTLIGHQGNVCSLSFQDGVVISGSWDKTAKVWKEGSLVYNLQAHNASVWDAKVVSFSENKFLTASADKTIKLWQNDKVIKTFSGIHNDVVRHLAVVDDGHFISCSNDGLIKLVDMHTGDVLRTYEGHESFVYCIKLLPNGDIVSCGEDRTVRIWSKENGSLKQVITLPAISIWSVDCMSNGDIIVGSSDNLVRIFSQEKSRWAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein DOA1
publication title WD40 Repeat Propellers Define a Ubiquitin-Binding Domain that Regulates Turnover of F Box Proteins.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Nuclear protein
total genus 84
structure length 296
sequence length 297
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3odtA00
4QL1A 4PNKB 4LG8A 5H17A 1XHMA 2HJ4A 4ERZA 4O1QD 3JZHA 2PBIB 1K32A 4CZYA 2I0TA 3MKSB 2OJYA 4L3HD 2IUVA 3UR4A 3OL2A 3NVNA 4O9DA 4GGCA 4O3UB 3I89A 3ODTA 4QT8A 3RN1D 3ULEC 4CZXA 4BH6A 2H9NA 2P9UC 4GGAA 3GFCA 3OL2B 2I0RA 2P9SC 4J77A 5CYKA 4A2MA 4I79A 5CYKB 2I3SA 3AFCA 3C9CA 3MZLA 5GXIA 3DXMC 2XU7A 3CFVA 1S4UX 5EMMB 4GQ2P 4J78A 3EI3A 2GC7A 4J87A 3P4FA 4L3GD 3SCYA 3AL9A 3NVQA 5FQDA 4AEZA 3EI3B 5FKSA 4PXWA 2I3TA 5A2Qg 4FB1D 2GNQA 4D6VA 3F3FA 2OVRB 3C75H 4CI8A 4FAVD 4U7AA 3GREA 3F3GA 4ZOVA 4CI1A 4J73A 3DSMA 2Z2NA 2CNXA 4PSWB 3AL8A 2CN3A 3DM0A 2Q7QA 1PBYB 2HJBA 1B9YA 1YFQA 3OW8A 5HE1B 5CXBB 3K26A 3RRMC 1RI6A 4LG9A 3I7NA 5FA5B 3IIYA 3DWLC 3PVUB 1NR0A 4BL0A 3I7OA 5I5MA 4JT5C 4N14A 5EALA 5IGQA 3UVOA 2Z2PA 3N0DA 1N6DA 2PM7B 5GMKn 2O9KA 2OIZA 2J57G 3EI1A 2MTAH 4Z8LA 3MZKA 4A09A 3EI1B 3JB9L 3EU7A 4GZ8A 2H9PA 3IJ1A 2YBAA 3B7FA 3E0CA 2IURA 3UVKA 4A09B 2GC4A 5CXCA 1JJUB 5CXCB 3V9FA 4FHLA 4X3EA 4A0AA 4ZOXA 1GOTB 3SBQA 4J0WA 4E5ZA 3RFGA 4A0AB 5GSAA 2B5LA 3L4OD 3C99A 4PBZA 4BUJC 4ES0A 2XL2A 4ZOZA 1TBGA 4GMBA 2OK4A 4O3TB 2IUQA 1GP2B 4EWRA 4AOWA 4CC9A 1Q47A 5C2VB 4J82A 5TF2A 2B5NA 3SN6B 4NSXA 3JZGA 3PSLA 3EI4A 3C5MA 4FWWA 3EI4B 2BCJB 1P22A 4J0XA 4QQEA 5EARA 4ZOYA 2TRCB 2IWFA 3U4YA 4L9OA 2P9PC 4J84A 2PM9A 1PEVA 5H14A 2YNOA 1U2VC 4FA1D 1N6FA 5FXYA 4JSXC 1XIPA 2PM9B 5HQGA 1L0QA 5HYNB 2H47A 5THAA 2HYEA 1OMWB 2CE8A 4X60B 2UZXB 3SFZA 4OWRA 3EG6A 1MG2A 1U4CA 3I7KA 1QNIA 4CI2A 3UKRC 5TEFA 3I8CA 3I8EA 5I5JA 1OLZA 2H3XA 4PSXB 3MMYA 2UZYB 4X63B 4K3JB 4PBYA 3OKYA 3UVMA 5FKRA 1GXRA 4FA5D 1JMZB 2H6QA 3SBPA 3IKOA 2CO0A 4GGDA 3OKTA 3JAMg 3J81g 1ERJA 4A0BA 3VGZA 5B4WA 4A2LA 2AH0A 3MKQA 3SBRA 3F3PA 3AL8B 4Y5RD 2G99A 4A0BB 4CY2A 2P9IC 4Y7RA 5AMSA 3NVXA 5EAPA 2AQ5A 3RSEC 2Z2OA 3UVNA 2H9LA 2IUPA 4JXMA 4PC0A 2YNNA 3K27A 2YNPA 1PGUA 1MDAH 4JSVC 2QC5A 5FKQA 1MG3A 2IWKA 5K1CC 4FA9D 4A08A 3KRXB 4KFMB 1K8KC 5EAMA 3PVWB 2B5MA 3HFQA 3W15A 2W18A 2HKRA 2P9KC 4A08B 5IJ8E 3UVLA 1B9XA 4MK0B 5FLXg 4FA4D 5IJ7E 5IC7A 2OK6A 2OVQB 4E5ZB 1A0RB 2EBSA 3ORVD 4CY5A 3OKWA 1FWXA 3V5WB 1XKSA 3KRWB 5JWZA 2YB8B 3FRXA 3EI2A 3SVWD 1SQJA 2IAAA 4J8BA 2OVPB 3EI2B 5TDHB 3RN0D 5C9ZB 4TZ4A 5AJAA 3PXTD 1R5MA 5HE3B 5GXHA 2XYIA 5IT9g 2CN2A 2AGYA 1JOFA 2B4EA 2PM6B 3A0FA 3AH8B 3MXXA 4J86A 3CFSB 4JT6C 5TEEA 3SWSD 4A7JA 3ZWLB 2P9NC 1SQ9A 1GG2B 4ZN4A 3J80g 4X61B 4XYHA 3EWEA 4D0KA 5AFU3 3RLMD 4XYIA 5EMLB 3SXTD 4ESGA 2H14A 4UI9R 2H68A 3VH0A 3N0EA 1PI6A 5KDOB 4CY1A 4OZUA 3VA6A 4ERQA 4GM9A 4E54A 4GM3A 2H6KA 4A11A 4JSNC 4H5IA 3PXWD 2AGWA 4E54B 4A11B 4HDJA 3PE7A 3OKYB 3UKUC 4JSPC 2AGLA 3SHFA 2H6NA 5I5IA 3DXKC 5K19A 4R7AB 1NEXB 4GQBB 3SMRA 2J56H 3JZNA 2G9AA 4L1QD 2AGZA 4IMMA 4K3ID 5EMKB 4QRJA 2HKMA 3PSCB 3IJ0A 4G56B 2HXCA 5CXBA 4CI3A 4O45A 3V7DB 5HE0B 2P9LC 2H9MA 3I7LA 1TYQC 4XEIC 5EMJB 5C2WB 4GM8A 5FKTA 3SLED 3EMHA 3BG1A 4IA9A 5HE2B 4J8GA 5EM2A 2CE9A 2BBKH 5SXMA 5IGOA 3SJLD 5EM2B 4LGNA 3I7HA 3OTTA 1N6EA 3IJCA 3RFHA 3JROA 4CY3A 2YMUA 5H1MA 3L4MD 1SHYB 3I2NA 3IIWA 4FAND 1VYHC 2I0SA 3JPXA 3PXSD 3JRPA 1JMXB 2QXVA 4J81A 3FM0A 4U1EI 4YVDA 4J79A 3BWSA 4GQ1A 3FGBA 3I7PA 4JD2C 3RMZD 2HESX 3CIKB 2J55H 2AH1A 4CZVA 3BG0A 4H5JA 2XL3A 2CO0C 2AGXA 4ERYA 2H13A
chains in the Genus database with same CATH superfamily
4QL1A 3ZDXA 4PNKB 4LG8A 4RE6A 1E8NA 1XHMA 2HJ4A 5H17A 4ERZA 4O1QD 3JZHA 4WK2A 2PBIB 1K32A 4CZYA 2EIEA 3ZE1A 2I0TA 3MKSB 2OJYA 4L3HD 2IUVA 3UR4A 3OL2A 3NVNA 4O9DA 4GGCA 4O3UB 4AMZA 3I89A 3ODTA 4QT8A 3RN1D 1E8MA 3ULEC 4CZXA 4BH6A 2H9NA 4UM8A 2P9UC 4GGAA 3GFCA 3OL2B 4BCBA 2I0RA 2P9SC 4J77A 5CYKA 4A2MA 4I79A 4RE5A 5CYKB 2I3SA 3AFCA 3C9CA 3IVMA 3MZLA 5GXIA 4DNUA 3DXMC 3NIFA 2XU7A 3CFVA 1S4UX 5EMMB 4NENA 1BPOA 4GQ2P 4J78A 5M5RA 4O2WA 3EI3A 2GC7A 4J87A 3P4FA 4L3GD 4QAMA 5M61A 3SCYA 5M5SA 3O4JA 3AL9A 3NVQA 5FQDA 4AEZA 3EI3B 4G1MA 5FKSA 4PXWA 2I3TA 1E5TA 5A2Qg 4NBMA 4FB1D 2GNQA 4D6VA 3F3FA 2OVRB 2VDQA 3C75H 2HU8A 4CI8A 3IURA 4FAVD 1GOFA 4U7AA 3GREA 3F3GA 4ZOVA 4CI1A 4J73A 2EICA 3DSMA 2Z2NA 2CNXA 4PSWB 3AL8A 2CN3A 3NIGA 3DM0A 2Q7QA 1PBYB 2HJBA 1B9YA 2XZGA 1YFQA 3OW8A 5HE1B 4BP8A 5CXBB 3K26A 3RRMC 1RI6A 4LG9A 3I7NA 5FA5B 3IIYA 3DWLC 3PVUB 1NR0A 4BL0A 3I7OA 5I5MA 4JT5C 4N14A 3FCUA 5EALA 5IGQA 3UVOA 2Z2PA 3N0DA 1N6DA 2PM7B 2VDNA 5GMKn 1H2WA 2O9KA 2OIZA 2J57G 3EI1A 2MTAH 4Z8LA 3MZKA 2VDLA 4A09A 1H2YA 3EI1B 3JB9L 3EU7A 4GZ8A 3K6SA 2H9PA 3IJ1A 2YBAA 3B7FA 3E0CA 2IURA 5FFGA 3UVKA 4A09B 2GC4A 4G1EA 5C92A 5CXCA 4UM9A 1JJUB 5CXCB 3V9FA 2XE4A 4FHLA 4X3EA 4A0AA 4ZOXA 1GOTB 3SBQA 4J0WA 4E5ZA 3RFGA 4A0AB 5GSAA 3IJEA 2B5LA 3L4OD 1U8CA 3C99A 3IUQA 4PBZA 4BUJC 4ES0A 3O4GA 2XL2A 2QZPA 4ZOZA 1TBGA 4GMBA 2OK4A 4O3TB 4DNWA 2VDMA 2IUQA 1GP2B 1GOHA 4EWRA 1UTCA 4AOWA 4CC9A 1JV2A 1Q47A 5C2VB 4J82A 5TF2A 2B5NA 4JHNA 3SN6B 4NSXA 3ZE0A 3JZGA 3PSLA 4Z7NA 2HU5A 3EI4A 4BCDA 3C5MA 3T3PA 3QHYB 4FWWA 1JTDB 3EI4B 2BCJB 1P22A 4J0XA 4QQEA 2EIDA 5EARA 4BP9A 1C9IA 4ZOYA 2TRCB 2IWFA 3U4YA 4L9OA 4AX4A 5FFOA 2P9PC 4J84A 2PM9A 1PEVA 5H14A 2YNOA 1U2VC 4FA1D 1N6FA 5FXYA 4JSXC 1XIPA 2PM9B 5HQGA 1L0QA 5HYNB 2H47A 5THAA 2HYEA 1OMWB 2CE8A 4X60B 2UZXB 3SFZA 4OWRA 3EG6A 1MG2A 1U4CA 3I7KA 1QNIA 4CI2A 3UKRC 5TEFA 3I8CA 3I8EA 3K71A 3NIDA 4DNVA 5I5JA 2XDWA 5M5TA 3IUNA 2VDRA 1OLZA 2H3XA 4PSXB 3MMYA 4NC4A 2UZYB 3O4HA 4X63B 4K3JB 4PBYA 3OKYA 3UVMA 5FKRA 4MMYA 1GXRA 4FA5D 1JMZB 2H6QA 3SBPA 3IKOA 2CO0A 4GGDA 3OKTA 3JAMg 3J81g 1ERJA 2QR5A 4A0BA 3VGZA 5B4WA 1VE6A 4IRZA 4A2LA 2AH0A 3MKQA 3ZDYA 3SBRA 3F3PA 3AL8B 4Y5RD 2G99A 1TYEA 4A0BB 4CY2A 2P9IC 4Y7RA 5AMSA 3VI4A 3NVXA 5EAPA 3O4IA 2AQ5A 4Z7QA 3RSEC 2Z2OA 3UVNA 2EIBA 2H9LA 2IUPA 1O6FA 4JXMA 4PC0A 2YNNA 3K27A 2YNPA 1PGUA 3EQ7A 1MDAH 4JSVC 2QC5A 2VC2A 5FKQA 1MG3A 2IWKA 5K1CC 4FA9D 4A08A 3KRXB 4KFMB 1K8KC 2HU7A 5EAMA 3PVWB 2B5MA 3HFQA 1VE7A 3W15A 2W18A 2HKRA 2P9KC 4A08B 1VZ2A 5IJ8E 3UVLA 1B9XA 3V4VA 4MK0B 5FLXg 4FA4D 3EQ8A 5IJ7E 5IC7A 2OK6A 3MVDK 3DDUA 2OVQB 4E5ZB 1A0RB 2EBSA 2JKXA 3ORVD 4CY5A 2VDOA 3OKWA 1FWXA 3V5WB 1XKSA 3KRWB 5JWZA 2YB8B 3FRXA 3EI2A 3SVWD 1SQJA 2IAAA 2VDKA 2OVPB 4J8BA 3MUOA 3EI2B 5TDHB 3RN0D 2VZ1A 5C9ZB 4TZ4A 5AJAA 3PXTD 1R5MA 5HE3B 5GXHA 2XYIA 5IT9g 3GC3B 1GOGA 2AGYA 1JOFA 2CN2A 4D9SA 2B4EA 1M1XA 1QFSA 2PM6B 3A0FA 3AH8B 3MXXA 4J86A 4BCCA 3CFSB 4L1MA 1C9LA 2BKLA 4JT6C 3IULA 5TEEA 3SWSD 4A7JA 5E6SA 4MMZA 4AN1A 3ZWLB 2P9NC 5M5VA 1VZ3A 1I2MB 1SQ9A 3K72A 3QI0A 1GG2B 4ZN4A 3J80g 4X61B 3GD1I 1H2XA 4XYHA 3EWEA 4D0KA 5AFU3 3ZDZA 3RLMD 4XYIA 5EMLB 3SXTD 1QFMA 1UOOA 4ESGA 2H14A 4UI9R 2H68A 3VH0A 3N0EA 1PI6A 5E6RA 5KDOB 4CY1A 4OZUA 3VA6A 5C86A 5M5UA 4ERQA 4GM9A 4E54A 4GM3A 4Z7OA 2H6KA 1A12A 3FCSA 4A11A 4JSNC 1UOPA 2VDPA 4H5IA 3PXWD 2AGWA 4E54B 4NAAA 4A11B 1L5GA 4HDJA 4WK0A 3MUNA 3PE7A 1H2ZA 3OKYB 3UKUC 3ZE2A 4JSPC 2AGLA 3T3MA 3SHFA 2H6NA 1UOQA 5I5IA 3DXKC 5K19A 4R7AB 5E6UA 1NEXB 2VZ3A 4GQBB 2J56H 3SMRA 3KCIA 3JZNA 2G9AA 4WK4A 4L1QD 1O6GA 4O02A 2AGZA 4IMMA 4K3ID 5EMKB 4JHPC 4QRJA 3V4PA 2HKMA 5HDBA 3IUJA 3PSCB 3EQ9A 3IJ0A 4G56B 2HXCA 5CXBA 4CI3A 4O45A 3V7DB 5HE0B 2P9LC 2H9MA 3I7LA 4MMXA 1TYQC 4XEIC 4AN0A 5EMJB 5C2WB 4GM8A 5FKTA 3SLED 1T2XA 3EMHA 3BG1A 4IA9A 5HE2B 4J8GA 5EM2A 2CE9A 2BBKH 5SXMA 5IGOA 4G55A 3SJLD 5EM2B 4LGNA 3I7HA 3OTTA 1N6EA 3IJCA 3RFHA 3JROA 1K3IA 4CY3A 2YMUA 5H1MA 3L4MD 1SHYB 3I2NA 3IIWA 4WJKA 4FAND 1VYHC 4AMYA 2I0SA 3OF7A 3JPXA 3PXSD 3JRPA 1JMXB 2QXVA 4J81A 3FM0A 4U1EI 4YVDA 4J79A 3VI3A 3BWSA 4GQ1A 3FGBA 3I7PA 2WQ8A 4JD2C 3RMZD 3IUMA 2HESX 3CIKB 2J55H 2AH1A 4CZVA 3BG0A 4H5JA 2XL3A 2CO0C 2AGXA 1YR2A 4ERYA 2H13A
chains in the Genus database with same CATH topology
4QL1A 4PNKB 4LG8A 5H17A 1XHMA 2HJ4A 4ERZA 4O1QD 3JZHA 2PBIB 1K32A 4CZYA 2I0TA 3MKSB 2OJYA 4L3HD 2IUVA 3UR4A 3OL2A 3NVNA 4O9DA 4GGCA 4O3UB 3I89A 3ODTA 4QT8A 3RN1D 3ULEC 4CZXA 4BH6A 2H9NA 2P9UC 4GGAA 3GFCA 3OL2B 2I0RA 2P9SC 4J77A 5CYKA 4A2MA 4I79A 5CYKB 2I3SA 3AFCA 3C9CA 3MZLA 5GXIA 3DXMC 2XU7A 3CFVA 1S4UX 5EMMB 4GQ2P 4J78A 3EI3A 2GC7A 4J87A 3P4FA 4L3GD 3SCYA 3AL9A 3NVQA 5FQDA 4AEZA 3EI3B 5FKSA 4PXWA 2I3TA 5A2Qg 4FB1D 2GNQA 4D6VA 3F3FA 2OVRB 3C75H 4CI8A 4FAVD 4U7AA 3GREA 3F3GA 4ZOVA 4CI1A 4J73A 3DSMA 2Z2NA 2CNXA 4PSWB 3AL8A 2CN3A 3DM0A 2Q7QA 1PBYB 2HJBA 1B9YA 1YFQA 3OW8A 5HE1B 5CXBB 3K26A 3RRMC 1RI6A 4LG9A 3I7NA 5FA5B 3IIYA 3DWLC 3PVUB 1NR0A 4BL0A 3I7OA 5I5MA 4JT5C 4N14A 5EALA 5IGQA 3UVOA 2Z2PA 3N0DA 1N6DA 2PM7B 5GMKn 2O9KA 2OIZA 2J57G 3EI1A 2MTAH 4Z8LA 3MZKA 4A09A 3EI1B 3JB9L 3EU7A 4GZ8A 2H9PA 3IJ1A 2YBAA 3B7FA 3E0CA 2IURA 3UVKA 4A09B 2GC4A 5CXCA 1JJUB 5CXCB 3V9FA 4FHLA 4X3EA 4A0AA 4ZOXA 1GOTB 3SBQA 4J0WA 4E5ZA 3RFGA 4A0AB 5GSAA 2B5LA 3L4OD 3C99A 4PBZA 4BUJC 4ES0A 2XL2A 4ZOZA 1TBGA 4GMBA 2OK4A 4O3TB 2IUQA 1GP2B 4EWRA 4AOWA 4CC9A 1Q47A 5C2VB 4J82A 5TF2A 2B5NA 3SN6B 4NSXA 3JZGA 3PSLA 3EI4A 3C5MA 4FWWA 3EI4B 2BCJB 1P22A 4J0XA 4QQEA 5EARA 4ZOYA 2TRCB 2IWFA 3U4YA 4L9OA 2P9PC 4J84A 2PM9A 1PEVA 5H14A 2YNOA 1U2VC 4FA1D 1N6FA 5FXYA 4JSXC 1XIPA 2PM9B 5HQGA 1L0QA 5HYNB 2H47A 5THAA 2HYEA 1OMWB 2CE8A 4X60B 2UZXB 3SFZA 4OWRA 3EG6A 1MG2A 1U4CA 3I7KA 1QNIA 4CI2A 3UKRC 5TEFA 3I8CA 3I8EA 5I5JA 1OLZA 2H3XA 4PSXB 3MMYA 2UZYB 4X63B 4K3JB 4PBYA 3OKYA 3UVMA 5FKRA 1GXRA 4FA5D 1JMZB 2H6QA 3SBPA 3IKOA 2CO0A 4GGDA 3OKTA 3JAMg 3J81g 1ERJA 4A0BA 3VGZA 5B4WA 4A2LA 2AH0A 3MKQA 3SBRA 3F3PA 3AL8B 4Y5RD 2G99A 4A0BB 4CY2A 2P9IC 4Y7RA 5AMSA 3NVXA 5EAPA 2AQ5A 3RSEC 2Z2OA 3UVNA 2H9LA 2IUPA 4JXMA 4PC0A 2YNNA 3K27A 2YNPA 1PGUA 1MDAH 4JSVC 2QC5A 5FKQA 1MG3A 2IWKA 5K1CC 4FA9D 4A08A 3KRXB 4KFMB 1K8KC 5EAMA 3PVWB 2B5MA 3HFQA 3W15A 2W18A 2HKRA 2P9KC 4A08B 5IJ8E 3UVLA 1B9XA 4MK0B 5FLXg 4FA4D 5IJ7E 5IC7A 2OK6A 2OVQB 4E5ZB 1A0RB 2EBSA 3ORVD 4CY5A 3OKWA 1FWXA 3V5WB 1XKSA 3KRWB 5JWZA 2YB8B 3FRXA 3EI2A 3SVWD 1SQJA 2IAAA 4J8BA 2OVPB 3EI2B 5TDHB 3RN0D 5C9ZB 4TZ4A 5AJAA 3PXTD 1R5MA 5HE3B 5GXHA 2XYIA 5IT9g 2CN2A 2AGYA 1JOFA 2B4EA 2PM6B 3A0FA 3AH8B 3MXXA 4J86A 3CFSB 4JT6C 5TEEA 3SWSD 4A7JA 3ZWLB 2P9NC 1SQ9A 1GG2B 4ZN4A 3J80g 4X61B 4XYHA 3EWEA 4D0KA 5AFU3 3RLMD 4XYIA 5EMLB 3SXTD 4ESGA 2H14A 4UI9R 2H68A 3VH0A 3N0EA 1PI6A 5KDOB 4CY1A 4OZUA 3VA6A 4ERQA 4GM9A 4E54A 4GM3A 2H6KA 4A11A 4JSNC 4H5IA 3PXWD 2AGWA 4E54B 4A11B 4HDJA 3PE7A 3OKYB 3UKUC 4JSPC 2AGLA 3SHFA 2H6NA 5I5IA 3DXKC 5K19A 4R7AB 1NEXB 4GQBB 3SMRA 2J56H 3JZNA 2G9AA 4L1QD 2AGZA 4IMMA 4K3ID 5EMKB 4QRJA 2HKMA 3PSCB 3IJ0A 4G56B 2HXCA 5CXBA 4CI3A 4O45A 3V7DB 5HE0B 2P9LC 2H9MA 3I7LA 1TYQC 4XEIC 5EMJB 5C2WB 4GM8A 5FKTA 3SLED 3EMHA 3BG1A 4IA9A 5HE2B 4J8GA 5EM2A 2CE9A 2BBKH 5SXMA 5IGOA 3SJLD 5EM2B 4LGNA 3I7HA 3OTTA 1N6EA 3IJCA 3RFHA 3JROA 4CY3A 2YMUA 5H1MA 3L4MD 1SHYB 3I2NA 3IIWA 4FAND 1VYHC 2I0SA 3JPXA 3PXSD 3JRPA 1JMXB 2QXVA 4J81A 3FM0A 4U1EI 4YVDA 4J79A 3BWSA 4GQ1A 3FGBA 3I7PA 4JD2C 3RMZD 2HESX 3CIKB 2J55H 2AH1A 4CZVA 3BG0A 4H5JA 2XL3A 2CO0C 2AGXA 4ERYA 2H13A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QL1 A;  4PNK B;  4LG8 A;  5H17 A;  1XHM A;  2HJ4 A;  4ERZ A;  4O1Q D;  3JZH A;  2PBI B;  1K32 A;  4CZY A;  2I0T A;  3MKS B;  2OJY A;  4L3H D;  2IUV A;  3UR4 A;  3OL2 A;  3NVN A;  4O9D A;  4GGC A;  4O3U B;  3I89 A;  3ODT A;  4QT8 A;  3RN1 D;  3ULE C;  4CZX A;  4BH6 A;  2H9N A;  2P9U C;  4GGA A;  3GFC A;  3OL2 B;  2I0R A;  2P9S C;  4J77 A;  5CYK A;  4A2M A;  4I79 A;  5CYK B;  2I3S A;  3AFC A;  3C9C A;  3MZL A;  5GXI A;  3DXM C;  2XU7 A;  3CFV A;  1S4U X;  5EMM B;  4GQ2 P;  4J78 A;  3EI3 A;  2GC7 A;  4J87 A;  3P4F A;  4L3G D;  3SCY A;  3AL9 A;  3NVQ A;  5FQD A;  4AEZ A;  3EI3 B;  5FKS A;  4PXW A;  2I3T A;  5A2Q g;  4FB1 D;  2GNQ A;  4D6V A;  3F3F A;  2OVR B;  3C75 H;  4CI8 A;  4FAV D;  4U7A A;  3GRE A;  3F3G A;  4ZOV A;  4CI1 A;  4J73 A;  3DSM A;  2Z2N A;  2CNX A;  4PSW B;  3AL8 A;  2CN3 A;  3DM0 A;  2Q7Q A;  1PBY B;  2HJB A;  1B9Y A;  1YFQ A;  3OW8 A;  5HE1 B;  5CXB B;  3K26 A;  3RRM C;  1RI6 A;  4LG9 A;  3I7N A;  5FA5 B;  3IIY A;  3DWL C;  3PVU B;  1NR0 A;  4BL0 A;  3I7O A;  5I5M A;  4JT5 C;  4N14 A;  5EAL A;  5IGQ A;  3UVO A;  2Z2P A;  3N0D A;  1N6D A;  2PM7 B;  5GMK n;  2O9K A;  2OIZ A;  2J57 G;  3EI1 A;  2MTA H;  4Z8L A;  3MZK A;  4A09 A;  3EI1 B;  3JB9 L;  3EU7 A;  4GZ8 A;  2H9P A;  3IJ1 A;  2YBA A;  3B7F A;  3E0C A;  2IUR A;  3UVK A;  4A09 B;  2GC4 A;  5CXC A;  1JJU B;  5CXC B;  3V9F A;  4FHL A;  4X3E A;  4A0A A;  4ZOX A;  1GOT B;  3SBQ A;  4J0W A;  4E5Z A;  3RFG A;  4A0A B;  5GSA A;  2B5L A;  3L4O D;  3C99 A;  4PBZ A;  4BUJ C;  4ES0 A;  2XL2 A;  4ZOZ A;  1TBG A;  4GMB A;  2OK4 A;  4O3T B;  2IUQ A;  1GP2 B;  4EWR A;  4AOW A;  4CC9 A;  1Q47 A;  5C2V B;  4J82 A;  5TF2 A;  2B5N A;  3SN6 B;  4NSX A;  3JZG A;  3PSL A;  3EI4 A;  3C5M A;  4FWW A;  3EI4 B;  2BCJ B;  1P22 A;  4J0X A;  4QQE A;  5EAR A;  4ZOY A;  2TRC B;  2IWF A;  3U4Y A;  4L9O A;  2P9P C;  4J84 A;  2PM9 A;  1PEV A;  5H14 A;  2YNO A;  1U2V C;  4FA1 D;  1N6F A;  5FXY A;  4JSX C;  1XIP A;  2PM9 B;  5HQG A;  1L0Q A;  5HYN B;  2H47 A;  5THA A;  2HYE A;  1OMW B;  2CE8 A;  4X60 B;  2UZX B;  3SFZ A;  4OWR A;  3EG6 A;  1MG2 A;  1U4C A;  3I7K A;  1QNI A;  4CI2 A;  3UKR C;  5TEF A;  3I8C A;  3I8E A;  5I5J A;  1OLZ A;  2H3X A;  4PSX B;  3MMY A;  2UZY B;  4X63 B;  4K3J B;  4PBY A;  3OKY A;  3UVM A;  5FKR A;  1GXR A;  4FA5 D;  1JMZ B;  2H6Q A;  3SBP A;  3IKO A;  2CO0 A;  4GGD A;  3OKT A;  3JAM g;  3J81 g;  1ERJ A;  4A0B A;  3VGZ A;  5B4W A;  4A2L A;  2AH0 A;  3MKQ A;  3SBR A;  3F3P A;  3AL8 B;  4Y5R D;  2G99 A;  4A0B B;  4CY2 A;  2P9I C;  4Y7R A;  5AMS A;  3NVX A;  5EAP A;  2AQ5 A;  3RSE C;  2Z2O A;  3UVN A;  2H9L A;  2IUP A;  4JXM A;  4PC0 A;  2YNN A;  3K27 A;  2YNP A;  1PGU A;  1MDA H;  4JSV C;  2QC5 A;  5FKQ A;  1MG3 A;  2IWK A;  5K1C C;  4FA9 D;  4A08 A;  3KRX B;  4KFM B;  1K8K C;  5EAM A;  3PVW B;  2B5M A;  3HFQ A;  3W15 A;  2W18 A;  2HKR A;  2P9K C;  4A08 B;  5IJ8 E;  3UVL A;  1B9X A;  4MK0 B;  5FLX g;  4FA4 D;  5IJ7 E;  5IC7 A;  2OK6 A;  2OVQ B;  4E5Z B;  1A0R B;  2EBS A;  3ORV D;  4CY5 A;  3OKW A;  1FWX A;  3V5W B;  1XKS A;  3KRW B;  5JWZ A;  2YB8 B;  3FRX A;  3EI2 A;  3SVW D;  1SQJ A;  2IAA A;  4J8B A;  2OVP B;  3EI2 B;  5TDH B;  3RN0 D;  5C9Z B;  4TZ4 A;  5AJA A;  3PXT D;  1R5M A;  5HE3 B;  5GXH A;  2XYI A;  5IT9 g;  2CN2 A;  2AGY A;  1JOF A;  2B4E A;  2PM6 B;  3A0F A;  3AH8 B;  3MXX A;  4J86 A;  3CFS B;  4JT6 C;  5TEE A;  3SWS D;  4A7J A;  3ZWL B;  2P9N C;  1SQ9 A;  1GG2 B;  4ZN4 A;  3J80 g;  4X61 B;  4XYH A;  3EWE A;  4D0K A;  5AFU 3;  3RLM D;  4XYI A;  5EML B;  3SXT D;  4ESG A;  2H14 A;  4UI9 R;  2H68 A;  3VH0 A;  3N0E A;  1PI6 A;  5KDO B;  4CY1 A;  4OZU A;  3VA6 A;  4ERQ A;  4GM9 A;  4E54 A;  4GM3 A;  2H6K A;  4A11 A;  4JSN C;  4H5I A;  3PXW D;  2AGW A;  4E54 B;  4A11 B;  4HDJ A;  3PE7 A;  3OKY B;  3UKU C;  4JSP C;  2AGL A;  3SHF A;  2H6N A;  5I5I A;  3DXK C;  5K19 A;  4R7A B;  1NEX B;  4GQB B;  3SMR A;  2J56 H;  3JZN A;  2G9A A;  4L1Q D;  2AGZ A;  4IMM A;  4K3I D;  5EMK B;  4QRJ A;  2HKM A;  3PSC B;  3IJ0 A;  4G56 B;  2HXC A;  5CXB A;  4CI3 A;  4O45 A;  3V7D B;  5HE0 B;  2P9L C;  2H9M A;  3I7L A;  1TYQ C;  4XEI C;  5EMJ B;  5C2W B;  4GM8 A;  5FKT A;  3SLE D;  3EMH A;  3BG1 A;  4IA9 A;  5HE2 B;  4J8G A;  5EM2 A;  2CE9 A;  2BBK H;  5SXM A;  5IGO A;  3SJL D;  5EM2 B;  4LGN A;  3I7H A;  3OTT A;  1N6E A;  3IJC A;  3RFH A;  3JRO A;  4CY3 A;  2YMU A;  5H1M A;  3L4M D;  1SHY B;  3I2N A;  3IIW A;  4FAN D;  1VYH C;  2I0S A;  3JPX A;  3PXS D;  3JRP A;  1JMX B;  2QXV A;  4J81 A;  3FM0 A;  4U1E I;  4YVD A;  4J79 A;  3BWS A;  4GQ1 A;  3FGB A;  3I7P A;  4JD2 C;  3RMZ D;  2HES X;  3CIK B;  2J55 H;  2AH1 A;  4CZV A;  3BG0 A;  4H5J A;  2XL3 A;  2CO0 C;  2AGX A;  4ERY A;  2H13 A; 
#chains in the Genus database with same CATH topology
 4QL1 A;  3ZDX A;  4PNK B;  4LG8 A;  4RE6 A;  1E8N A;  1XHM A;  2HJ4 A;  5H17 A;  4ERZ A;  4O1Q D;  3JZH A;  4WK2 A;  2PBI B;  1K32 A;  4CZY A;  2EIE A;  3ZE1 A;  2I0T A;  3MKS B;  2OJY A;  4L3H D;  2IUV A;  3UR4 A;  3OL2 A;  3NVN A;  4O9D A;  4GGC A;  4O3U B;  4AMZ A;  3I89 A;  3ODT A;  4QT8 A;  3RN1 D;  1E8M A;  3ULE C;  4CZX A;  4BH6 A;  2H9N A;  4UM8 A;  2P9U C;  4GGA A;  3GFC A;  3OL2 B;  4BCB A;  2I0R A;  2P9S C;  4J77 A;  5CYK A;  4A2M A;  4I79 A;  4RE5 A;  5CYK B;  2I3S A;  3AFC A;  3C9C A;  3IVM A;  3MZL A;  5GXI A;  4DNU A;  3DXM C;  3NIF A;  2XU7 A;  3CFV A;  1S4U X;  5EMM B;  4NEN A;  1BPO A;  4GQ2 P;  4J78 A;  5M5R A;  4O2W A;  3EI3 A;  2GC7 A;  4J87 A;  3P4F A;  4L3G D;  4QAM A;  5M61 A;  3SCY A;  5M5S A;  3O4J A;  3AL9 A;  3NVQ A;  5FQD A;  4AEZ A;  3EI3 B;  4G1M A;  5FKS A;  4PXW A;  2I3T A;  1E5T A;  5A2Q g;  4NBM A;  4FB1 D;  2GNQ A;  4D6V A;  3F3F A;  2OVR B;  2VDQ A;  3C75 H;  2HU8 A;  4CI8 A;  3IUR A;  4FAV D;  1GOF A;  4U7A A;  3GRE A;  3F3G A;  4ZOV A;  4CI1 A;  4J73 A;  2EIC A;  3DSM A;  2Z2N A;  2CNX A;  4PSW B;  3AL8 A;  2CN3 A;  3NIG A;  3DM0 A;  2Q7Q A;  1PBY B;  2HJB A;  1B9Y A;  2XZG A;  1YFQ A;  3OW8 A;  5HE1 B;  4BP8 A;  5CXB B;  3K26 A;  3RRM C;  1RI6 A;  4LG9 A;  3I7N A;  5FA5 B;  3IIY A;  3DWL C;  3PVU B;  1NR0 A;  4BL0 A;  3I7O A;  5I5M A;  4JT5 C;  4N14 A;  3FCU A;  5EAL A;  5IGQ A;  3UVO A;  2Z2P A;  3N0D A;  1N6D A;  2PM7 B;  2VDN A;  5GMK n;  1H2W A;  2O9K A;  2OIZ A;  2J57 G;  3EI1 A;  2MTA H;  4Z8L A;  3MZK A;  2VDL A;  4A09 A;  1H2Y A;  3EI1 B;  3JB9 L;  3EU7 A;  4GZ8 A;  3K6S A;  2H9P A;  3IJ1 A;  2YBA A;  3B7F A;  3E0C A;  2IUR A;  5FFG A;  3UVK A;  4A09 B;  2GC4 A;  4G1E A;  5C92 A;  5CXC A;  4UM9 A;  1JJU B;  5CXC B;  3V9F A;  2XE4 A;  4FHL A;  4X3E A;  4A0A A;  4ZOX A;  1GOT B;  3SBQ A;  4J0W A;  4E5Z A;  3RFG A;  4A0A B;  5GSA A;  3IJE A;  2B5L A;  3L4O D;  1U8C A;  3C99 A;  3IUQ A;  4PBZ A;  4BUJ C;  4ES0 A;  3O4G A;  2XL2 A;  2QZP A;  4ZOZ A;  1TBG A;  4GMB A;  2OK4 A;  4O3T B;  4DNW A;  2VDM A;  2IUQ A;  1GP2 B;  1GOH A;  4EWR A;  1UTC A;  4AOW A;  4CC9 A;  1JV2 A;  1Q47 A;  5C2V B;  4J82 A;  5TF2 A;  2B5N A;  4JHN A;  3SN6 B;  4NSX A;  3ZE0 A;  3JZG A;  3PSL A;  4Z7N A;  2HU5 A;  3EI4 A;  4BCD A;  3C5M A;  3T3P A;  3QHY B;  4FWW A;  1JTD B;  3EI4 B;  2BCJ B;  1P22 A;  4J0X A;  4QQE A;  2EID A;  5EAR A;  4BP9 A;  1C9I A;  4ZOY A;  2TRC B;  2IWF A;  3U4Y A;  4L9O A;  4AX4 A;  5FFO A;  2P9P C;  4J84 A;  2PM9 A;  1PEV A;  5H14 A;  2YNO A;  1U2V C;  4FA1 D;  1N6F A;  5FXY A;  4JSX C;  1XIP A;  2PM9 B;  5HQG A;  1L0Q A;  5HYN B;  2H47 A;  5THA A;  2HYE A;  1OMW B;  2CE8 A;  4X60 B;  2UZX B;  3SFZ A;  4OWR A;  3EG6 A;  1MG2 A;  1U4C A;  3I7K A;  1QNI A;  4CI2 A;  3UKR C;  5TEF A;  3I8C A;  3I8E A;  3K71 A;  3NID A;  4DNV A;  5I5J A;  2XDW A;  5M5T A;  3IUN A;  2VDR A;  1OLZ A;  2H3X A;  4PSX B;  3MMY A;  4NC4 A;  2UZY B;  3O4H A;  4X63 B;  4K3J B;  4PBY A;  3OKY A;  3UVM A;  5FKR A;  4MMY A;  1GXR A;  4FA5 D;  1JMZ B;  2H6Q A;  3SBP A;  3IKO A;  2CO0 A;  4GGD A;  3OKT A;  3JAM g;  3J81 g;  1ERJ A;  2QR5 A;  4A0B A;  3VGZ A;  5B4W A;  1VE6 A;  4IRZ A;  4A2L A;  2AH0 A;  3MKQ A;  3ZDY A;  3SBR A;  3F3P A;  3AL8 B;  4Y5R D;  2G99 A;  1TYE A;  4A0B B;  4CY2 A;  2P9I C;  4Y7R A;  5AMS A;  3VI4 A;  3NVX A;  5EAP A;  3O4I A;  2AQ5 A;  4Z7Q A;  3RSE C;  2Z2O A;  3UVN A;  2EIB A;  2H9L A;  2IUP A;  1O6F A;  4JXM A;  4PC0 A;  2YNN A;  3K27 A;  2YNP A;  1PGU A;  3EQ7 A;  1MDA H;  4JSV C;  2QC5 A;  2VC2 A;  5FKQ A;  1MG3 A;  2IWK A;  5K1C C;  4FA9 D;  4A08 A;  3KRX B;  4KFM B;  1K8K C;  2HU7 A;  5EAM A;  3PVW B;  2B5M A;  3HFQ A;  1VE7 A;  3W15 A;  2W18 A;  2HKR A;  2P9K C;  4A08 B;  1VZ2 A;  5IJ8 E;  3UVL A;  1B9X A;  3V4V A;  4MK0 B;  5FLX g;  4FA4 D;  3EQ8 A;  5IJ7 E;  5IC7 A;  2OK6 A;  3MVD K;  3DDU A;  2OVQ B;  4E5Z B;  1A0R B;  2EBS A;  2JKX A;  3ORV D;  4CY5 A;  2VDO A;  3OKW A;  1FWX A;  3V5W B;  1XKS A;  3KRW B;  5JWZ A;  2YB8 B;  3FRX A;  3EI2 A;  3SVW D;  1SQJ A;  2IAA A;  2VDK A;  2OVP B;  4J8B A;  3MUO A;  3EI2 B;  5TDH B;  3RN0 D;  2VZ1 A;  5C9Z B;  4TZ4 A;  5AJA A;  3PXT D;  1R5M A;  5HE3 B;  5GXH A;  2XYI A;  5IT9 g;  3GC3 B;  1GOG A;  2AGY A;  1JOF A;  2CN2 A;  4D9S A;  2B4E A;  1M1X A;  1QFS A;  2PM6 B;  3A0F A;  3AH8 B;  3MXX A;  4J86 A;  4BCC A;  3CFS B;  4L1M A;  1C9L A;  2BKL A;  4JT6 C;  3IUL A;  5TEE A;  3SWS D;  4A7J A;  5E6S A;  4MMZ A;  4AN1 A;  3ZWL B;  2P9N C;  5M5V A;  1VZ3 A;  1I2M B;  1SQ9 A;  3K72 A;  3QI0 A;  1GG2 B;  4ZN4 A;  3J80 g;  4X61 B;  3GD1 I;  1H2X A;  4XYH A;  3EWE A;  4D0K A;  5AFU 3;  3ZDZ A;  3RLM D;  4XYI A;  5EML B;  3SXT D;  1QFM A;  1UOO A;  4ESG A;  2H14 A;  4UI9 R;  2H68 A;  3VH0 A;  3N0E A;  1PI6 A;  5E6R A;  5KDO B;  4CY1 A;  4OZU A;  3VA6 A;  5C86 A;  5M5U A;  4ERQ A;  4GM9 A;  4E54 A;  4GM3 A;  4Z7O A;  2H6K A;  1A12 A;  3FCS A;  4A11 A;  4JSN C;  1UOP A;  2VDP A;  4H5I A;  3PXW D;  2AGW A;  4E54 B;  4NAA A;  4A11 B;  1L5G A;  4HDJ A;  4WK0 A;  3MUN A;  3PE7 A;  1H2Z A;  3OKY B;  3UKU C;  3ZE2 A;  4JSP C;  2AGL A;  3T3M A;  3SHF A;  2H6N A;  1UOQ A;  5I5I A;  3DXK C;  5K19 A;  4R7A B;  5E6U A;  1NEX B;  2VZ3 A;  4GQB B;  2J56 H;  3SMR A;  3KCI A;  3JZN A;  2G9A A;  4WK4 A;  4L1Q D;  1O6G A;  4O02 A;  2AGZ A;  4IMM A;  4K3I D;  5EMK B;  4JHP C;  4QRJ A;  3V4P A;  2HKM A;  5HDB A;  3IUJ A;  3PSC B;  3EQ9 A;  3IJ0 A;  4G56 B;  2HXC A;  5CXB A;  4CI3 A;  4O45 A;  3V7D B;  5HE0 B;  2P9L C;  2H9M A;  3I7L A;  4MMX A;  1TYQ C;  4XEI C;  4AN0 A;  5EMJ B;  5C2W B;  4GM8 A;  5FKT A;  3SLE D;  1T2X A;  3EMH A;  3BG1 A;  4IA9 A;  5HE2 B;  4J8G A;  5EM2 A;  2CE9 A;  2BBK H;  5SXM A;  5IGO A;  4G55 A;  3SJL D;  5EM2 B;  4LGN A;  3I7H A;  3OTT A;  1N6E A;  3IJC A;  3RFH A;  3JRO A;  1K3I A;  4CY3 A;  2YMU A;  5H1M A;  3L4M D;  1SHY B;  3I2N A;  3IIW A;  4WJK A;  4FAN D;  1VYH C;  4AMY A;  2I0S A;  3OF7 A;  3JPX A;  3PXS D;  3JRP A;  1JMX B;  2QXV A;  4J81 A;  3FM0 A;  4U1E I;  4YVD A;  4J79 A;  3VI3 A;  3BWS A;  4GQ1 A;  3FGB A;  3I7P A;  2WQ8 A;  4JD2 C;  3RMZ D;  3IUM A;  2HES X;  3CIK B;  2J55 H;  2AH1 A;  4CZV A;  3BG0 A;  4H5J A;  2XL3 A;  2CO0 C;  2AGX A;  1YR2 A;  4ERY A;  2H13 A; 
#chains in the Genus database with same CATH homology
 4QL1 A;  4PNK B;  4LG8 A;  5H17 A;  1XHM A;  2HJ4 A;  4ERZ A;  4O1Q D;  3JZH A;  2PBI B;  1K32 A;  4CZY A;  2I0T A;  3MKS B;  2OJY A;  4L3H D;  2IUV A;  3UR4 A;  3OL2 A;  3NVN A;  4O9D A;  4GGC A;  4O3U B;  3I89 A;  3ODT A;  4QT8 A;  3RN1 D;  3ULE C;  4CZX A;  4BH6 A;  2H9N A;  2P9U C;  4GGA A;  3GFC A;  3OL2 B;  2I0R A;  2P9S C;  4J77 A;  5CYK A;  4A2M A;  4I79 A;  5CYK B;  2I3S A;  3AFC A;  3C9C A;  3MZL A;  5GXI A;  3DXM C;  2XU7 A;  3CFV A;  1S4U X;  5EMM B;  4GQ2 P;  4J78 A;  3EI3 A;  2GC7 A;  4J87 A;  3P4F A;  4L3G D;  3SCY A;  3AL9 A;  3NVQ A;  5FQD A;  4AEZ A;  3EI3 B;  5FKS A;  4PXW A;  2I3T A;  5A2Q g;  4FB1 D;  2GNQ A;  4D6V A;  3F3F A;  2OVR B;  3C75 H;  4CI8 A;  4FAV D;  4U7A A;  3GRE A;  3F3G A;  4ZOV A;  4CI1 A;  4J73 A;  3DSM A;  2Z2N A;  2CNX A;  4PSW B;  3AL8 A;  2CN3 A;  3DM0 A;  2Q7Q A;  1PBY B;  2HJB A;  1B9Y A;  1YFQ A;  3OW8 A;  5HE1 B;  5CXB B;  3K26 A;  3RRM C;  1RI6 A;  4LG9 A;  3I7N A;  5FA5 B;  3IIY A;  3DWL C;  3PVU B;  1NR0 A;  4BL0 A;  3I7O A;  5I5M A;  4JT5 C;  4N14 A;  5EAL A;  5IGQ A;  3UVO A;  2Z2P A;  3N0D A;  1N6D A;  2PM7 B;  5GMK n;  2O9K A;  2OIZ A;  2J57 G;  3EI1 A;  2MTA H;  4Z8L A;  3MZK A;  4A09 A;  3EI1 B;  3JB9 L;  3EU7 A;  4GZ8 A;  2H9P A;  3IJ1 A;  2YBA A;  3B7F A;  3E0C A;  2IUR A;  3UVK A;  4A09 B;  2GC4 A;  5CXC A;  1JJU B;  5CXC B;  3V9F A;  4FHL A;  4X3E A;  4A0A A;  4ZOX A;  1GOT B;  3SBQ A;  4J0W A;  4E5Z A;  3RFG A;  4A0A B;  5GSA A;  2B5L A;  3L4O D;  3C99 A;  4PBZ A;  4BUJ C;  4ES0 A;  2XL2 A;  4ZOZ A;  1TBG A;  4GMB A;  2OK4 A;  4O3T B;  2IUQ A;  1GP2 B;  4EWR A;  4AOW A;  4CC9 A;  1Q47 A;  5C2V B;  4J82 A;  5TF2 A;  2B5N A;  3SN6 B;  4NSX A;  3JZG A;  3PSL A;  3EI4 A;  3C5M A;  4FWW A;  3EI4 B;  2BCJ B;  1P22 A;  4J0X A;  4QQE A;  5EAR A;  4ZOY A;  2TRC B;  2IWF A;  3U4Y A;  4L9O A;  2P9P C;  4J84 A;  2PM9 A;  1PEV A;  5H14 A;  2YNO A;  1U2V C;  4FA1 D;  1N6F A;  5FXY A;  4JSX C;  1XIP A;  2PM9 B;  5HQG A;  1L0Q A;  5HYN B;  2H47 A;  5THA A;  2HYE A;  1OMW B;  2CE8 A;  4X60 B;  2UZX B;  3SFZ A;  4OWR A;  3EG6 A;  1MG2 A;  1U4C A;  3I7K A;  1QNI A;  4CI2 A;  3UKR C;  5TEF A;  3I8C A;  3I8E A;  5I5J A;  1OLZ A;  2H3X A;  4PSX B;  3MMY A;  2UZY B;  4X63 B;  4K3J B;  4PBY A;  3OKY A;  3UVM A;  5FKR A;  1GXR A;  4FA5 D;  1JMZ B;  2H6Q A;  3SBP A;  3IKO A;  2CO0 A;  4GGD A;  3OKT A;  3JAM g;  3J81 g;  1ERJ A;  4A0B A;  3VGZ A;  5B4W A;  4A2L A;  2AH0 A;  3MKQ A;  3SBR A;  3F3P A;  3AL8 B;  4Y5R D;  2G99 A;  4A0B B;  4CY2 A;  2P9I C;  4Y7R A;  5AMS A;  3NVX A;  5EAP A;  2AQ5 A;  3RSE C;  2Z2O A;  3UVN A;  2H9L A;  2IUP A;  4JXM A;  4PC0 A;  2YNN A;  3K27 A;  2YNP A;  1PGU A;  1MDA H;  4JSV C;  2QC5 A;  5FKQ A;  1MG3 A;  2IWK A;  5K1C C;  4FA9 D;  4A08 A;  3KRX B;  4KFM B;  1K8K C;  5EAM A;  3PVW B;  2B5M A;  3HFQ A;  3W15 A;  2W18 A;  2HKR A;  2P9K C;  4A08 B;  5IJ8 E;  3UVL A;  1B9X A;  4MK0 B;  5FLX g;  4FA4 D;  5IJ7 E;  5IC7 A;  2OK6 A;  2OVQ B;  4E5Z B;  1A0R B;  2EBS A;  3ORV D;  4CY5 A;  3OKW A;  1FWX A;  3V5W B;  1XKS A;  3KRW B;  5JWZ A;  2YB8 B;  3FRX A;  3EI2 A;  3SVW D;  1SQJ A;  2IAA A;  4J8B A;  2OVP B;  3EI2 B;  5TDH B;  3RN0 D;  5C9Z B;  4TZ4 A;  5AJA A;  3PXT D;  1R5M A;  5HE3 B;  5GXH A;  2XYI A;  5IT9 g;  2CN2 A;  2AGY A;  1JOF A;  2B4E A;  2PM6 B;  3A0F A;  3AH8 B;  3MXX A;  4J86 A;  3CFS B;  4JT6 C;  5TEE A;  3SWS D;  4A7J A;  3ZWL B;  2P9N C;  1SQ9 A;  1GG2 B;  4ZN4 A;  3J80 g;  4X61 B;  4XYH A;  3EWE A;  4D0K A;  5AFU 3;  3RLM D;  4XYI A;  5EML B;  3SXT D;  4ESG A;  2H14 A;  4UI9 R;  2H68 A;  3VH0 A;  3N0E A;  1PI6 A;  5KDO B;  4CY1 A;  4OZU A;  3VA6 A;  4ERQ A;  4GM9 A;  4E54 A;  4GM3 A;  2H6K A;  4A11 A;  4JSN C;  4H5I A;  3PXW D;  2AGW A;  4E54 B;  4A11 B;  4HDJ A;  3PE7 A;  3OKY B;  3UKU C;  4JSP C;  2AGL A;  3SHF A;  2H6N A;  5I5I A;  3DXK C;  5K19 A;  4R7A B;  1NEX B;  4GQB B;  3SMR A;  2J56 H;  3JZN A;  2G9A A;  4L1Q D;  2AGZ A;  4IMM A;  4K3I D;  5EMK B;  4QRJ A;  2HKM A;  3PSC B;  3IJ0 A;  4G56 B;  2HXC A;  5CXB A;  4CI3 A;  4O45 A;  3V7D B;  5HE0 B;  2P9L C;  2H9M A;  3I7L A;  1TYQ C;  4XEI C;  5EMJ B;  5C2W B;  4GM8 A;  5FKT A;  3SLE D;  3EMH A;  3BG1 A;  4IA9 A;  5HE2 B;  4J8G A;  5EM2 A;  2CE9 A;  2BBK H;  5SXM A;  5IGO A;  3SJL D;  5EM2 B;  4LGN A;  3I7H A;  3OTT A;  1N6E A;  3IJC A;  3RFH A;  3JRO A;  4CY3 A;  2YMU A;  5H1M A;  3L4M D;  1SHY B;  3I2N A;  3IIW A;  4FAN D;  1VYH C;  2I0S A;  3JPX A;  3PXS D;  3JRP A;  1JMX B;  2QXV A;  4J81 A;  3FM0 A;  4U1E I;  4YVD A;  4J79 A;  3BWS A;  4GQ1 A;  3FGB A;  3I7P A;  4JD2 C;  3RMZ D;  2HES X;  3CIK B;  2J55 H;  2AH1 A;  4CZV A;  3BG0 A;  4H5J A;  2XL3 A;  2CO0 C;  2AGX A;  4ERY A;  2H13 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...