3ODTA

Crystal structure of wd40 beta propeller domain of doa1
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
297
structure length
296
Chain Sequence
b'FTGYQLSATLKGHDQDVRDVVAVDDSKVASVSRDGTVRLWSKDDQWLGTVVYTGQGFLNSVCYDSEKELLLFGGKDTMINGVPLFATSGEDPYTLIGHQGNVCSLSFQDGVVISGSWDKTAKVWKEGSLVYNLQAHNASVWDAKVVSFSENKFLTASADKTIKLWQNDKVIKTFSGIHNDVVRHLAVVDDGHFISCSNDGLIKLVDMHTGDVLRTYEGHESFVYCIKLLPNGDIVSCGEDRTVRIWSKENGSLKQVITLPAISIWSVDCMSNGDIIVGSSDNLVRIFSQEKSRWAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein DOA1
publication title WD40 Repeat Propellers Define a Ubiquitin-Binding Domain that Regulates Turnover of F Box Proteins.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Nuclear protein
total genus 84
structure length 296
sequence length 297
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3odtA00
5JWZA 4A08B 4O45A 3I7HA 2H6NA 2Z2OA 2XL2A 1B9XA 3K26A 3EU7A 5THAA 5HQGA 2OVPB 5HE1B 4ZOZA 2OK4A 5FA5B 4CI8A 1N6EA 2AH0A 4Y7RA 2I0RA 5EAPA 1L0QA 3DXMC 4FHLA 4ES0A 3C9CA 3NVQA 2IAAA 3ORVD 2Q7QA 3JRPA 4D0KA 4UI9R 2UZYB 5AMSA 3K27A 3SBRA 3HFQA 4A2LA 2OJYA 2CE9A 4PNKB 3UVKA 3KRWB 1YFQA 2GC4A 4U7AA 3V5WB 2QXVA 4D6VA 3L4OD 2HESX 3PVUB 4ZOYA 1FWXA 4FA1D 3CFVA 4XEIC 4J0XA 2AGLA 2AGXA 5IT9g 2B4EA 1SHYB 5HE0B 2P9LC 2OVQB 2CO0A 5GMKn 1K8KC 3EMHA 5FKRA 4CZVA 4LG8A 3EI1B 5B4WA 3UR4A 2XU7A 5EM2B 3J81g 3BG1A 3UVLA 2H9PA 1U2VC 2YNPA 3C5MA 1NR0A 1PI6A 4Y5RD 3JZNA 2GNQA 1PBYB 3DM0A 2J56H 4GM3A 4J82A 5SXMA 4ZOXA 4JSVC 1ERJA 5GSAA 4J78A 4L1QD 2OVRB 3AH8B 3AL9A 4JT5C 4J81A 4O3UB 2O9KA 3JPXA 2YNNA 2AGZA 2P9NC 3OKTA 4GQ1A 5EARA 3RN0D 4JSPC 4K3ID 5EMKB 3NVXA 3I89A 2H3XA 2G9AA 3SJLD 3L4MD 2HYEA 1JJUB 3P4FA 3VH0A 3UKUC 3A0FA 2Z2PA 4O1QD 4PSXB 4PXWA 4A7JA 4A08A 5HE3B 2IUVA 4H5IA 1SQJA 4A0BA 2PBIB 1R5MA 3JZGA 3PXTD 2P9SC 4FWWA 3UVOA 2P9PC 3N0DA 3AL8B 1K32A 4L3GD 4J84A 5K19A 3JB9L 1PEVA 2I3TA 2BCJB 2OK6A 2W18A 3DSMA 3EG6A 4NSXA 3KRXB 5EMJB 3FGBA 3OKYA 5H1MA 4A11B 2CO0C 4A0BB 2CN3A 2HKMA 4PBYA 1GP2B 4GGCA 4ZOVA 3MZLA 2J57G 1XKSA 4X61B 2IUQA 3SXTD 1MG2A 4KFMB 3MKQA 2H6KA 2YMUA 5AJAA 1RI6A 2P9UC 5H14A 3OKYB 3PSLA 2HJBA 5EMLB 4FAND 4JT6C 4X63B 3OKWA 2TRCB 3PXWD 3F3FA 5A2Qg 1TYQC 3CFSB 4YVDA 4AEZA 1Q47A 2AGWA 3ULEC 1XHMA 3PSCB 3RFGA 5HE2B 2PM9B 3EI1A 3UVMA 5EM2A 2HJ4A 5IGQA 5I5MA 3C75H 4I79A 2H6QA 3OTTA 4EWRA 3I8EA 3I2NA 3UKRC 2IUPA 4XYHA 4X60B 3I7NA 1JMZB 4G56B 3SBQA 5I5IA 5IGOA 3IIWA 4ERZA 4FA4D 5EAMA 4H5JA 2G99A 3JAMg 5CXCB 5CXBB 4IA9A 3SBPA 3EI4A 4GQ2P 3EI2B 5HYNB 4QQEA 3W15A 4GZ8A 1N6FA 3SHFA 4ERQA 2UZXB 4CY5A 1OMWB 4OWRA 1P22A 2B5NA 2I0TA 4J86A 4J8BA 4O3TB 3IJ1A 3JROA 4PC0A 2H47A 3V7DB 5GXHA 3V9FA 3EI4B 3I8CA 4FA5D 4X3EA 2BBKH 2H13A 3AL8A 5FKSA 4A0AB 5C2VB 3F3PA 4CY2A 2YB8B 4A11A 3UVNA 4ERYA 5FKTA 3I7OA 4BUJC 2XL3A 2YNOA 4CC9A 3SMRA 3IKOA 5FKQA 4J87A 5CYKB 5C9ZB 1TBGA 4J77A 5TEEA 2IURA 3PE7A 3OL2A 2H9MA 4GGDA 3GFCA 4JSXC 3EI3B 2J55H 4PSWB 2B5MA 3PXSD 5AFU3 2HXCA 2P9IC 2H9NA 3OW8A 3IIYA 4L9OA 1S4UX 2HKRA 4CI3A 3FRXA 3IJCA 4J0WA 3I7KA 3SWSD 3OL2B 4L3HD 5I5JA 2CNXA 4LG9A 1SQ9A 3RLMD 3RMZD 2PM9A 4ZN4A 4CI1A 3MZKA 3RN1D 3N0EA 1MG3A 1QNIA 3B7FA 4LGNA 1N6DA 4N14A 4GMBA 5H17A 2H14A 3SFZA 5FQDA 2YBAA 4ESGA 2H9LA 2P9KC 2CE8A 4GQBB 3I7LA 4HDJA 3CIKB 2GC7A 3PVWB 2H68A 1VYHC 3AFCA 4J8GA 3DXKC 4CZXA 2MTAH 3F3GA 3BG0A 3EWEA 3RFHA 5CXCA 4FA9D 4J79A 2QC5A 5CXBA 4GM8A 2CN2A 4QL1A 4U1EI 3EI2A 2OIZA 1GXRA 2I3SA 3ZWLB 5FXYA 1GG2B 4CI2A 3ODTA 2XYIA 3E0CA 4A09A 3C99A 1U4CA 3SN6B 4O9DA 5TF2A 1OLZA 4QT8A 3MXXA 3DWLC 3I7PA 4XYIA 4FB1D 4MK0B 4E5ZA 4A0AA 5EALA 1MDAH 4A09B 3FM0A 1JMXB 3RSEC 4A2MA 1PGUA 4QRJA 5TEFA 5FLXg 4PBZA 4JSNC 2AQ5A 2EBSA 5CYKA 4OZUA 1B9YA 5GXIA 4CY3A 4TZ4A 2PM7B 2IWFA 4E5ZB 5IJ8E 4BL0A 3IJ0A 4FAVD 3NVNA 1GOTB 3BWSA 3EI3A 3RRMC 3MKSB 4CZYA 2PM6B 3VGZA 5C2WB 4E54A 4BH6A 4JD2C 5IJ7E 5IC7A 5TDHB 2B5LA 1A0RB 4AOWA 4IMMA 5EMMB 2AH1A 3SCYA 4K3JB 4J73A 4Z8LA 4JXMA 2Z2NA 3J80g 3MMYA 2AGYA 4E54B 5K1CC 3U4YA 4GM9A 3SLED 1JOFA 3SVWD 1XIPA 2I0SA 3VA6A 3JZHA 5KDOB 4R7AB 4CY1A 1NEXB 4GGAA 2IWKA 3GREA
chains in the Genus database with same CATH superfamily
3OF7A 5JWZA 4A08B 4O45A 3I7HA 3QI0A 2H6NA 2Z2OA 2XL2A 1B9XA 3K26A 3EU7A 5THAA 5HQGA 2OVPB 5M5VA 5HE1B 3NIFA 4ZOZA 2OK4A 5FA5B 4CI8A 1N6EA 2AH0A 3ZDZA 4Y7RA 3IUMA 2I0RA 5EAPA 1L0QA 3DXMC 4Z7NA 4FHLA 4ES0A 3C9CA 3NVQA 2IAAA 3ORVD 4O2WA 3IUNA 2Q7QA 3JRPA 4D0KA 4UI9R 2UZYB 5AMSA 3K27A 3SBRA 4JHPC 3HFQA 4A2LA 2OJYA 4D9SA 2CE9A 4PNKB 3UVKA 3KRWB 1E8MA 1YFQA 2GC4A 4U7AA 2QXVA 3V5WB 4D6VA 3L4OD 2HESX 3PVUB 3FCSA 4UM9A 4ZOYA 1FWXA 4BP9A 4FA1D 3CFVA 4XEIC 4J0XA 2AGLA 2JKXA 5C92A 2AGXA 5IT9g 2B4EA 1SHYB 5HE0B 2P9LC 2OVQB 2CO0A 1I2MB 2VZ1A 5GMKn 2EICA 1K8KC 3EMHA 5FKRA 4CZVA 4LG8A 3EI1B 5B4WA 3UR4A 2XU7A 4G55A 1T2XA 3IUJA 5EM2B 3J81g 2QR5A 4MMZA 3BG1A 3UVLA 2H9PA 1U2VC 2VDPA 1H2XA 2YNPA 3C5MA 1NR0A 1PI6A 2VC2A 4Y5RD 3IVMA 3JZNA 2GNQA 1PBYB 3VI4A 3DM0A 3T3PA 2J56H 2EIBA 4GM3A 4J82A 5SXMA 4ZOXA 4JSVC 1ERJA 2XZGA 5GSAA 4J78A 4L1QD 2OVRB 3AH8B 3AL9A 4JT5C 4J81A 4O3UB 2O9KA 2VDLA 3GC3B 3JPXA 2YNNA 2AGZA 2P9NC 3OKTA 4GQ1A 5EARA 3RN0D 4JSPC 4K3ID 5EMKB 3NVXA 3V4VA 3I89A 2H3XA 2G9AA 3SJLD 3L4MD 2HYEA 1JJUB 3P4FA 4AX4A 3UKUC 3VH0A 3A0FA 4BCBA 1E8NA 2Z2PA 4O1QD 4PSXB 4PXWA 4A7JA 4A08A 5HE3B 2IUVA 4H5IA 1SQJA 4A0BA 2PBIB 1R5MA 3JZGA 4BCDA 3PXTD 2P9SC 4L1MA 4FWWA 4RE5A 3UVOA 2P9PC 3N0DA 3AL8B 1K32A 3FCUA 2VZ3A 4L3GD 4J84A 5K19A 3JB9L 1PEVA 2I3TA 2BCJB 2OK6A 2W18A 3DSMA 3EG6A 3KRXB 3O4IA 4NSXA 5EMJB 4BCCA 3FGBA 3OKYA 5H1MA 4A11B 4AN1A 2CO0C 3ZE0A 4MMYA 5M5TA 4A0BB 2CN3A 2HKMA 4PBYA 1GP2B 4GGCA 4ZOVA 1VE7A 1UOQA 3KCIA 3MZLA 2J57G 1C9LA 1YR2A 1XKSA 4DNWA 4X61B 2BKLA 2IUQA 3SXTD 1MG2A 4KFMB 3MKQA 1H2WA 2H6KA 2YMUA 5AJAA 1RI6A 2VDMA 3QHYB 2P9UC 5H14A 5FFOA 3OKYB 3PSLA 2HJBA 1M1XA 2HU7A 5FFGA 5EMLB 4FAND 4JT6C 4X63B 5C86A 3OKWA 2HU8A 2TRCB 3PXWD 3F3FA 5A2Qg 1TYQC 3CFSB 1K3IA 4YVDA 4AEZA 2XE4A 1Q47A 2AGWA 3ULEC 1XHMA 3PSCB 5HDBA 3RFGA 5HE2B 2PM9B 3EI1A 3UVMA 3O4GA 5EM2A 2HJ4A 5IGQA 1QFSA 4O02A 5I5MA 3C75H 1A12A 4I79A 3IURA 2H6QA 3O4JA 3OTTA 4EWRA 3I8EA 1VE6A 5E6RA 3I2NA 3UKRC 2IUPA 4XYHA 4X60B 3I7NA 1JMZB 3EQ7A 4AMYA 4G56B 3SBQA 5I5IA 5M5UA 5IGOA 1GOGA 3IIWA 4ERZA 4FA4D 3ZDXA 5EAMA 4H5JA 2G99A 3JAMg 5CXCB 1TYEA 5CXBB 2VDOA 2WQ8A 3DDUA 4IA9A 3SBPA 3EI4A 1O6GA 2VDQA 4GQ2P 3EI2B 1UOOA 4DNVA 5HYNB 4QQEA 3W15A 4GZ8A 1N6FA 3SHFA 3NIDA 4ERQA 2UZXB 4CY5A 1OMWB 4OWRA 1P22A 2B5NA 2I0TA 4J86A 4J8BA 4O3TB 4G1EA 3IJ1A 3JROA 4PC0A 2H47A 3V7DB 5GXHA 2VDNA 3V9FA 3EI4B 3I8CA 4FA5D 4X3EA 2BBKH 2H13A 3AL8A 5FKSA 3ZE1A 4WK4A 5M5RA 2HU5A 1UOPA 4QAMA 3K71A 4A0AB 5C2VB 3F3PA 3IUQA 3MVDK 4CY2A 2YB8B 4A11A 3UVNA 4ERYA 5FKTA 3I7OA 4BUJC 2XL3A 2YNOA 4CC9A 3SMRA 3IKOA 1C9IA 1E5TA 5FKQA 4J87A 5CYKB 5C9ZB 1TBGA 4J77A 5TEEA 2IURA 3IULA 4RE6A 3PE7A 3OL2A 2H9MA 4GGDA 3GFCA 4JSXC 4WK0A 3MUNA 3EI3B 2J55H 4PSWB 2B5MA 3PXSD 5AFU3 2HXCA 2P9IC 2H9NA 3OW8A 3IIYA 2VDKA 4L9OA 1S4UX 3K72A 2HKRA 4CI3A 3FRXA 3IJCA 4J0WA 3I7KA 3SWSD 3OL2B 4L3HD 5I5JA 2CNXA 4DNUA 4LG9A 1SQ9A 3RLMD 3RMZD 2PM9A 5E6UA 4ZN4A 4BP8A 4Z7QA 4CI1A 4NAAA 3MZKA 3RN1D 5M5SA 3N0EA 1MG3A 1QNIA 1BPOA 3B7FA 4LGNA 1N6DA 3VI3A 4N14A 4GMBA 4AMZA 3EQ8A 5H17A 3NIGA 2H14A 3ZE2A 4IRZA 1VZ3A 3SFZA 5FQDA 2YBAA 3EQ9A 4ESGA 1L5GA 2H9LA 2P9KC 2CE8A 4GQBB 3I7LA 4HDJA 3CIKB 2GC7A 3PVWB 2H68A 1VYHC 3K6SA 1GOFA 3AFCA 4J8GA 3DXKC 4CZXA 2MTAH 3F3GA 3BG0A 3EWEA 3RFHA 5CXCA 4FA9D 4J79A 2QC5A 5CXBA 4GM8A 2CN2A 4QL1A 3O4HA 3GD1I 3MUOA 4U1EI 3EI2A 2OIZA 1GXRA 2I3SA 3ZWLB 5FXYA 4G1MA 5E6SA 1GG2B 4CI2A 3V4PA 3ODTA 2XYIA 3E0CA 4A09A 4JHNA 3C99A 1UTCA 1U4CA 3SN6B 4O9DA 5TF2A 1OLZA 4NC4A 4QT8A 3MXXA 3DWLC 3I7PA 3T3MA 4XYIA 1JV2A 4FB1D 4UM8A 4MK0B 1JTDB 4E5ZA 3IJEA 4A0AA 1GOHA 5EALA 1MDAH 1H2YA 4A09B 2EIDA 3FM0A 1JMXB 3RSEC 4Z7OA 4A2MA 1PGUA 4QRJA 5TEFA 5FLXg 4PBZA 4JSNC 2AQ5A 2EBSA 5CYKA 4OZUA 1B9YA 5GXIA 4CY3A 4TZ4A 2PM7B 2IWFA 4E5ZB 4WK2A 1H2ZA 5IJ8E 4BL0A 1U8CA 3IJ0A 4FAVD 3NVNA 1GOTB 3BWSA 3EI3A 3RRMC 1VZ2A 4WJKA 3MKSB 4CZYA 2PM6B 3VGZA 5C2WB 4E54A 4AN0A 4BH6A 4JD2C 5IJ7E 5IC7A 5TDHB 2B5LA 1A0RB 4AOWA 4IMMA 2XDWA 5EMMB 2AH1A 3SCYA 2QZPA 4K3JB 4NENA 4J73A 4Z8LA 4JXMA 2Z2NA 3J80g 2EIEA 5M61A 3MMYA 2AGYA 4E54B 5K1CC 1O6FA 3U4YA 4GM9A 4MMXA 3SLED 1JOFA 3SVWD 1XIPA 2I0SA 3VA6A 3JZHA 5KDOB 4R7AB 2VDRA 1QFMA 4CY1A 1NEXB 4GGAA 4NBMA 3ZDYA 2IWKA 3GREA
chains in the Genus database with same CATH topology
5JWZA 4A08B 4O45A 3I7HA 2H6NA 2Z2OA 2XL2A 1B9XA 3K26A 3EU7A 5THAA 5HQGA 2OVPB 5HE1B 4ZOZA 2OK4A 5FA5B 4CI8A 1N6EA 2AH0A 4Y7RA 2I0RA 5EAPA 1L0QA 3DXMC 4FHLA 4ES0A 3C9CA 3NVQA 2IAAA 3ORVD 2Q7QA 3JRPA 4D0KA 4UI9R 2UZYB 5AMSA 3K27A 3SBRA 3HFQA 4A2LA 2OJYA 2CE9A 4PNKB 3UVKA 3KRWB 1YFQA 2GC4A 4U7AA 3V5WB 2QXVA 4D6VA 3L4OD 2HESX 3PVUB 4ZOYA 1FWXA 4FA1D 3CFVA 4XEIC 4J0XA 2AGLA 2AGXA 5IT9g 2B4EA 1SHYB 5HE0B 2P9LC 2OVQB 2CO0A 5GMKn 1K8KC 3EMHA 5FKRA 4CZVA 4LG8A 3EI1B 5B4WA 3UR4A 2XU7A 5EM2B 3J81g 3BG1A 3UVLA 2H9PA 1U2VC 2YNPA 3C5MA 1NR0A 1PI6A 4Y5RD 3JZNA 2GNQA 1PBYB 3DM0A 2J56H 4GM3A 4J82A 5SXMA 4ZOXA 4JSVC 1ERJA 5GSAA 4J78A 4L1QD 2OVRB 3AH8B 3AL9A 4JT5C 4J81A 4O3UB 2O9KA 3JPXA 2YNNA 2AGZA 2P9NC 3OKTA 4GQ1A 5EARA 3RN0D 4JSPC 4K3ID 5EMKB 3NVXA 3I89A 2H3XA 2G9AA 3SJLD 3L4MD 2HYEA 1JJUB 3P4FA 3VH0A 3UKUC 3A0FA 2Z2PA 4O1QD 4PSXB 4PXWA 4A7JA 4A08A 5HE3B 2IUVA 4H5IA 1SQJA 4A0BA 2PBIB 1R5MA 3JZGA 3PXTD 2P9SC 4FWWA 3UVOA 2P9PC 3N0DA 3AL8B 1K32A 4L3GD 4J84A 5K19A 3JB9L 1PEVA 2I3TA 2BCJB 2OK6A 2W18A 3DSMA 3EG6A 4NSXA 3KRXB 5EMJB 3FGBA 3OKYA 5H1MA 4A11B 2CO0C 4A0BB 2CN3A 2HKMA 4PBYA 1GP2B 4GGCA 4ZOVA 3MZLA 2J57G 1XKSA 4X61B 2IUQA 3SXTD 1MG2A 4KFMB 3MKQA 2H6KA 2YMUA 5AJAA 1RI6A 2P9UC 5H14A 3OKYB 3PSLA 2HJBA 5EMLB 4FAND 4JT6C 4X63B 3OKWA 2TRCB 3PXWD 3F3FA 5A2Qg 1TYQC 3CFSB 4YVDA 4AEZA 1Q47A 2AGWA 3ULEC 1XHMA 3PSCB 3RFGA 5HE2B 2PM9B 3EI1A 3UVMA 5EM2A 2HJ4A 5IGQA 5I5MA 3C75H 4I79A 2H6QA 3OTTA 4EWRA 3I8EA 3I2NA 3UKRC 2IUPA 4XYHA 4X60B 3I7NA 1JMZB 4G56B 3SBQA 5I5IA 5IGOA 3IIWA 4ERZA 4FA4D 5EAMA 4H5JA 2G99A 3JAMg 5CXCB 5CXBB 4IA9A 3SBPA 3EI4A 4GQ2P 3EI2B 5HYNB 4QQEA 3W15A 4GZ8A 1N6FA 3SHFA 4ERQA 2UZXB 4CY5A 1OMWB 4OWRA 1P22A 2B5NA 2I0TA 4J86A 4J8BA 4O3TB 3IJ1A 3JROA 4PC0A 2H47A 3V7DB 5GXHA 3V9FA 3EI4B 3I8CA 4FA5D 4X3EA 2BBKH 2H13A 3AL8A 5FKSA 4A0AB 5C2VB 3F3PA 4CY2A 2YB8B 4A11A 3UVNA 4ERYA 5FKTA 3I7OA 4BUJC 2XL3A 2YNOA 4CC9A 3SMRA 3IKOA 5FKQA 4J87A 5CYKB 5C9ZB 1TBGA 4J77A 5TEEA 2IURA 3PE7A 3OL2A 2H9MA 4GGDA 3GFCA 4JSXC 3EI3B 2J55H 4PSWB 2B5MA 3PXSD 5AFU3 2HXCA 2P9IC 2H9NA 3OW8A 3IIYA 4L9OA 1S4UX 2HKRA 4CI3A 3FRXA 3IJCA 4J0WA 3I7KA 3SWSD 3OL2B 4L3HD 5I5JA 2CNXA 4LG9A 1SQ9A 3RLMD 3RMZD 2PM9A 4ZN4A 4CI1A 3MZKA 3RN1D 3N0EA 1MG3A 1QNIA 3B7FA 4LGNA 1N6DA 4N14A 4GMBA 5H17A 2H14A 3SFZA 5FQDA 2YBAA 4ESGA 2H9LA 2P9KC 2CE8A 4GQBB 3I7LA 4HDJA 3CIKB 2GC7A 3PVWB 2H68A 1VYHC 3AFCA 4J8GA 3DXKC 4CZXA 2MTAH 3F3GA 3BG0A 3EWEA 3RFHA 5CXCA 4FA9D 4J79A 2QC5A 5CXBA 4GM8A 2CN2A 4QL1A 4U1EI 3EI2A 2OIZA 1GXRA 2I3SA 3ZWLB 5FXYA 1GG2B 4CI2A 3ODTA 2XYIA 3E0CA 4A09A 3C99A 1U4CA 3SN6B 4O9DA 5TF2A 1OLZA 4QT8A 3MXXA 3DWLC 3I7PA 4XYIA 4FB1D 4MK0B 4E5ZA 4A0AA 5EALA 1MDAH 4A09B 3FM0A 1JMXB 3RSEC 4A2MA 1PGUA 4QRJA 5TEFA 5FLXg 4PBZA 4JSNC 2AQ5A 2EBSA 5CYKA 4OZUA 1B9YA 5GXIA 4CY3A 4TZ4A 2PM7B 2IWFA 4E5ZB 5IJ8E 4BL0A 3IJ0A 4FAVD 3NVNA 1GOTB 3BWSA 3EI3A 3RRMC 3MKSB 4CZYA 2PM6B 3VGZA 5C2WB 4E54A 4BH6A 4JD2C 5IJ7E 5IC7A 5TDHB 2B5LA 1A0RB 4AOWA 4IMMA 5EMMB 2AH1A 3SCYA 4K3JB 4J73A 4Z8LA 4JXMA 2Z2NA 3J80g 3MMYA 2AGYA 4E54B 5K1CC 3U4YA 4GM9A 3SLED 1JOFA 3SVWD 1XIPA 2I0SA 3VA6A 3JZHA 5KDOB 4R7AB 4CY1A 1NEXB 4GGAA 2IWKA 3GREA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JWZ A;  4A08 B;  4O45 A;  3I7H A;  2H6N A;  2Z2O A;  2XL2 A;  1B9X A;  3K26 A;  3EU7 A;  5THA A;  5HQG A;  2OVP B;  5HE1 B;  4ZOZ A;  2OK4 A;  5FA5 B;  4CI8 A;  1N6E A;  2AH0 A;  4Y7R A;  2I0R A;  5EAP A;  1L0Q A;  3DXM C;  4FHL A;  4ES0 A;  3C9C A;  3NVQ A;  2IAA A;  3ORV D;  2Q7Q A;  3JRP A;  4D0K A;  4UI9 R;  2UZY B;  5AMS A;  3K27 A;  3SBR A;  3HFQ A;  4A2L A;  2OJY A;  2CE9 A;  4PNK B;  3UVK A;  3KRW B;  1YFQ A;  2GC4 A;  4U7A A;  3V5W B;  2QXV A;  4D6V A;  3L4O D;  2HES X;  3PVU B;  4ZOY A;  1FWX A;  4FA1 D;  3CFV A;  4XEI C;  4J0X A;  2AGL A;  2AGX A;  5IT9 g;  2B4E A;  1SHY B;  5HE0 B;  2P9L C;  2OVQ B;  2CO0 A;  5GMK n;  1K8K C;  3EMH A;  5FKR A;  4CZV A;  4LG8 A;  3EI1 B;  5B4W A;  3UR4 A;  2XU7 A;  5EM2 B;  3J81 g;  3BG1 A;  3UVL A;  2H9P A;  1U2V C;  2YNP A;  3C5M A;  1NR0 A;  1PI6 A;  4Y5R D;  3JZN A;  2GNQ A;  1PBY B;  3DM0 A;  2J56 H;  4GM3 A;  4J82 A;  5SXM A;  4ZOX A;  4JSV C;  1ERJ A;  5GSA A;  4J78 A;  4L1Q D;  2OVR B;  3AH8 B;  3AL9 A;  4JT5 C;  4J81 A;  4O3U B;  2O9K A;  3JPX A;  2YNN A;  2AGZ A;  2P9N C;  3OKT A;  4GQ1 A;  5EAR A;  3RN0 D;  4JSP C;  4K3I D;  5EMK B;  3NVX A;  3I89 A;  2H3X A;  2G9A A;  3SJL D;  3L4M D;  2HYE A;  1JJU B;  3P4F A;  3VH0 A;  3UKU C;  3A0F A;  2Z2P A;  4O1Q D;  4PSX B;  4PXW A;  4A7J A;  4A08 A;  5HE3 B;  2IUV A;  4H5I A;  1SQJ A;  4A0B A;  2PBI B;  1R5M A;  3JZG A;  3PXT D;  2P9S C;  4FWW A;  3UVO A;  2P9P C;  3N0D A;  3AL8 B;  1K32 A;  4L3G D;  4J84 A;  5K19 A;  3JB9 L;  1PEV A;  2I3T A;  2BCJ B;  2OK6 A;  2W18 A;  3DSM A;  3EG6 A;  4NSX A;  3KRX B;  5EMJ B;  3FGB A;  3OKY A;  5H1M A;  4A11 B;  2CO0 C;  4A0B B;  2CN3 A;  2HKM A;  4PBY A;  1GP2 B;  4GGC A;  4ZOV A;  3MZL A;  2J57 G;  1XKS A;  4X61 B;  2IUQ A;  3SXT D;  1MG2 A;  4KFM B;  3MKQ A;  2H6K A;  2YMU A;  5AJA A;  1RI6 A;  2P9U C;  5H14 A;  3OKY B;  3PSL A;  2HJB A;  5EML B;  4FAN D;  4JT6 C;  4X63 B;  3OKW A;  2TRC B;  3PXW D;  3F3F A;  5A2Q g;  1TYQ C;  3CFS B;  4YVD A;  4AEZ A;  1Q47 A;  2AGW A;  3ULE C;  1XHM A;  3PSC B;  3RFG A;  5HE2 B;  2PM9 B;  3EI1 A;  3UVM A;  5EM2 A;  2HJ4 A;  5IGQ A;  5I5M A;  3C75 H;  4I79 A;  2H6Q A;  3OTT A;  4EWR A;  3I8E A;  3I2N A;  3UKR C;  2IUP A;  4XYH A;  4X60 B;  3I7N A;  1JMZ B;  4G56 B;  3SBQ A;  5I5I A;  5IGO A;  3IIW A;  4ERZ A;  4FA4 D;  5EAM A;  4H5J A;  2G99 A;  3JAM g;  5CXC B;  5CXB B;  4IA9 A;  3SBP A;  3EI4 A;  4GQ2 P;  3EI2 B;  5HYN B;  4QQE A;  3W15 A;  4GZ8 A;  1N6F A;  3SHF A;  4ERQ A;  2UZX B;  4CY5 A;  1OMW B;  4OWR A;  1P22 A;  2B5N A;  2I0T A;  4J86 A;  4J8B A;  4O3T B;  3IJ1 A;  3JRO A;  4PC0 A;  2H47 A;  3V7D B;  5GXH A;  3V9F A;  3EI4 B;  3I8C A;  4FA5 D;  4X3E A;  2BBK H;  2H13 A;  3AL8 A;  5FKS A;  4A0A B;  5C2V B;  3F3P A;  4CY2 A;  2YB8 B;  4A11 A;  3UVN A;  4ERY A;  5FKT A;  3I7O A;  4BUJ C;  2XL3 A;  2YNO A;  4CC9 A;  3SMR A;  3IKO A;  5FKQ A;  4J87 A;  5CYK B;  5C9Z B;  1TBG A;  4J77 A;  5TEE A;  2IUR A;  3PE7 A;  3OL2 A;  2H9M A;  4GGD A;  3GFC A;  4JSX C;  3EI3 B;  2J55 H;  4PSW B;  2B5M A;  3PXS D;  5AFU 3;  2HXC A;  2P9I C;  2H9N A;  3OW8 A;  3IIY A;  4L9O A;  1S4U X;  2HKR A;  4CI3 A;  3FRX A;  3IJC A;  4J0W A;  3I7K A;  3SWS D;  3OL2 B;  4L3H D;  5I5J A;  2CNX A;  4LG9 A;  1SQ9 A;  3RLM D;  3RMZ D;  2PM9 A;  4ZN4 A;  4CI1 A;  3MZK A;  3RN1 D;  3N0E A;  1MG3 A;  1QNI A;  3B7F A;  4LGN A;  1N6D A;  4N14 A;  4GMB A;  5H17 A;  2H14 A;  3SFZ A;  5FQD A;  2YBA A;  4ESG A;  2H9L A;  2P9K C;  2CE8 A;  4GQB B;  3I7L A;  4HDJ A;  3CIK B;  2GC7 A;  3PVW B;  2H68 A;  1VYH C;  3AFC A;  4J8G A;  3DXK C;  4CZX A;  2MTA H;  3F3G A;  3BG0 A;  3EWE A;  3RFH A;  5CXC A;  4FA9 D;  4J79 A;  2QC5 A;  5CXB A;  4GM8 A;  2CN2 A;  4QL1 A;  4U1E I;  3EI2 A;  2OIZ A;  1GXR A;  2I3S A;  3ZWL B;  5FXY A;  1GG2 B;  4CI2 A;  3ODT A;  2XYI A;  3E0C A;  4A09 A;  3C99 A;  1U4C A;  3SN6 B;  4O9D A;  5TF2 A;  1OLZ A;  4QT8 A;  3MXX A;  3DWL C;  3I7P A;  4XYI A;  4FB1 D;  4MK0 B;  4E5Z A;  4A0A A;  5EAL A;  1MDA H;  4A09 B;  3FM0 A;  1JMX B;  3RSE C;  4A2M A;  1PGU A;  4QRJ A;  5TEF A;  5FLX g;  4PBZ A;  4JSN C;  2AQ5 A;  2EBS A;  5CYK A;  4OZU A;  1B9Y A;  5GXI A;  4CY3 A;  4TZ4 A;  2PM7 B;  2IWF A;  4E5Z B;  5IJ8 E;  4BL0 A;  3IJ0 A;  4FAV D;  3NVN A;  1GOT B;  3BWS A;  3EI3 A;  3RRM C;  3MKS B;  4CZY A;  2PM6 B;  3VGZ A;  5C2W B;  4E54 A;  4BH6 A;  4JD2 C;  5IJ7 E;  5IC7 A;  5TDH B;  2B5L A;  1A0R B;  4AOW A;  4IMM A;  5EMM B;  2AH1 A;  3SCY A;  4K3J B;  4J73 A;  4Z8L A;  4JXM A;  2Z2N A;  3J80 g;  3MMY A;  2AGY A;  4E54 B;  5K1C C;  3U4Y A;  4GM9 A;  3SLE D;  1JOF A;  3SVW D;  1XIP A;  2I0S A;  3VA6 A;  3JZH A;  5KDO B;  4R7A B;  4CY1 A;  1NEX B;  4GGA A;  2IWK A;  3GRE A; 
#chains in the Genus database with same CATH topology
 3OF7 A;  5JWZ A;  4A08 B;  4O45 A;  3I7H A;  3QI0 A;  2H6N A;  2Z2O A;  2XL2 A;  1B9X A;  3K26 A;  3EU7 A;  5THA A;  5HQG A;  2OVP B;  5M5V A;  5HE1 B;  3NIF A;  4ZOZ A;  2OK4 A;  5FA5 B;  4CI8 A;  1N6E A;  2AH0 A;  3ZDZ A;  4Y7R A;  3IUM A;  2I0R A;  5EAP A;  1L0Q A;  3DXM C;  4Z7N A;  4FHL A;  4ES0 A;  3C9C A;  3NVQ A;  2IAA A;  3ORV D;  4O2W A;  3IUN A;  2Q7Q A;  3JRP A;  4D0K A;  4UI9 R;  2UZY B;  5AMS A;  3K27 A;  3SBR A;  4JHP C;  3HFQ A;  4A2L A;  2OJY A;  4D9S A;  2CE9 A;  4PNK B;  3UVK A;  3KRW B;  1E8M A;  1YFQ A;  2GC4 A;  4U7A A;  2QXV A;  3V5W B;  4D6V A;  3L4O D;  2HES X;  3PVU B;  3FCS A;  4UM9 A;  4ZOY A;  1FWX A;  4BP9 A;  4FA1 D;  3CFV A;  4XEI C;  4J0X A;  2AGL A;  2JKX A;  5C92 A;  2AGX A;  5IT9 g;  2B4E A;  1SHY B;  5HE0 B;  2P9L C;  2OVQ B;  2CO0 A;  1I2M B;  2VZ1 A;  5GMK n;  2EIC A;  1K8K C;  3EMH A;  5FKR A;  4CZV A;  4LG8 A;  3EI1 B;  5B4W A;  3UR4 A;  2XU7 A;  4G55 A;  1T2X A;  3IUJ A;  5EM2 B;  3J81 g;  2QR5 A;  4MMZ A;  3BG1 A;  3UVL A;  2H9P A;  1U2V C;  2VDP A;  1H2X A;  2YNP A;  3C5M A;  1NR0 A;  1PI6 A;  2VC2 A;  4Y5R D;  3IVM A;  3JZN A;  2GNQ A;  1PBY B;  3VI4 A;  3DM0 A;  3T3P A;  2J56 H;  2EIB A;  4GM3 A;  4J82 A;  5SXM A;  4ZOX A;  4JSV C;  1ERJ A;  2XZG A;  5GSA A;  4J78 A;  4L1Q D;  2OVR B;  3AH8 B;  3AL9 A;  4JT5 C;  4J81 A;  4O3U B;  2O9K A;  2VDL A;  3GC3 B;  3JPX A;  2YNN A;  2AGZ A;  2P9N C;  3OKT A;  4GQ1 A;  5EAR A;  3RN0 D;  4JSP C;  4K3I D;  5EMK B;  3NVX A;  3V4V A;  3I89 A;  2H3X A;  2G9A A;  3SJL D;  3L4M D;  2HYE A;  1JJU B;  3P4F A;  4AX4 A;  3UKU C;  3VH0 A;  3A0F A;  4BCB A;  1E8N A;  2Z2P A;  4O1Q D;  4PSX B;  4PXW A;  4A7J A;  4A08 A;  5HE3 B;  2IUV A;  4H5I A;  1SQJ A;  4A0B A;  2PBI B;  1R5M A;  3JZG A;  4BCD A;  3PXT D;  2P9S C;  4L1M A;  4FWW A;  4RE5 A;  3UVO A;  2P9P C;  3N0D A;  3AL8 B;  1K32 A;  3FCU A;  2VZ3 A;  4L3G D;  4J84 A;  5K19 A;  3JB9 L;  1PEV A;  2I3T A;  2BCJ B;  2OK6 A;  2W18 A;  3DSM A;  3EG6 A;  3KRX B;  3O4I A;  4NSX A;  5EMJ B;  4BCC A;  3FGB A;  3OKY A;  5H1M A;  4A11 B;  4AN1 A;  2CO0 C;  3ZE0 A;  4MMY A;  5M5T A;  4A0B B;  2CN3 A;  2HKM A;  4PBY A;  1GP2 B;  4GGC A;  4ZOV A;  1VE7 A;  1UOQ A;  3KCI A;  3MZL A;  2J57 G;  1C9L A;  1YR2 A;  1XKS A;  4DNW A;  4X61 B;  2BKL A;  2IUQ A;  3SXT D;  1MG2 A;  4KFM B;  3MKQ A;  1H2W A;  2H6K A;  2YMU A;  5AJA A;  1RI6 A;  2VDM A;  3QHY B;  2P9U C;  5H14 A;  5FFO A;  3OKY B;  3PSL A;  2HJB A;  1M1X A;  2HU7 A;  5FFG A;  5EML B;  4FAN D;  4JT6 C;  4X63 B;  5C86 A;  3OKW A;  2HU8 A;  2TRC B;  3PXW D;  3F3F A;  5A2Q g;  1TYQ C;  3CFS B;  1K3I A;  4YVD A;  4AEZ A;  2XE4 A;  1Q47 A;  2AGW A;  3ULE C;  1XHM A;  3PSC B;  5HDB A;  3RFG A;  5HE2 B;  2PM9 B;  3EI1 A;  3UVM A;  3O4G A;  5EM2 A;  2HJ4 A;  5IGQ A;  1QFS A;  4O02 A;  5I5M A;  3C75 H;  1A12 A;  4I79 A;  3IUR A;  2H6Q A;  3O4J A;  3OTT A;  4EWR A;  3I8E A;  1VE6 A;  5E6R A;  3I2N A;  3UKR C;  2IUP A;  4XYH A;  4X60 B;  3I7N A;  1JMZ B;  3EQ7 A;  4AMY A;  4G56 B;  3SBQ A;  5I5I A;  5M5U A;  5IGO A;  1GOG A;  3IIW A;  4ERZ A;  4FA4 D;  3ZDX A;  5EAM A;  4H5J A;  2G99 A;  3JAM g;  5CXC B;  1TYE A;  5CXB B;  2VDO A;  2WQ8 A;  3DDU A;  4IA9 A;  3SBP A;  3EI4 A;  1O6G A;  2VDQ A;  4GQ2 P;  3EI2 B;  1UOO A;  4DNV A;  5HYN B;  4QQE A;  3W15 A;  4GZ8 A;  1N6F A;  3SHF A;  3NID A;  4ERQ A;  2UZX B;  4CY5 A;  1OMW B;  4OWR A;  1P22 A;  2B5N A;  2I0T A;  4J86 A;  4J8B A;  4O3T B;  4G1E A;  3IJ1 A;  3JRO A;  4PC0 A;  2H47 A;  3V7D B;  5GXH A;  2VDN A;  3V9F A;  3EI4 B;  3I8C A;  4FA5 D;  4X3E A;  2BBK H;  2H13 A;  3AL8 A;  5FKS A;  3ZE1 A;  4WK4 A;  5M5R A;  2HU5 A;  1UOP A;  4QAM A;  3K71 A;  4A0A B;  5C2V B;  3F3P A;  3IUQ A;  3MVD K;  4CY2 A;  2YB8 B;  4A11 A;  3UVN A;  4ERY A;  5FKT A;  3I7O A;  4BUJ C;  2XL3 A;  2YNO A;  4CC9 A;  3SMR A;  3IKO A;  1C9I A;  1E5T A;  5FKQ A;  4J87 A;  5CYK B;  5C9Z B;  1TBG A;  4J77 A;  5TEE A;  2IUR A;  3IUL A;  4RE6 A;  3PE7 A;  3OL2 A;  2H9M A;  4GGD A;  3GFC A;  4JSX C;  4WK0 A;  3MUN A;  3EI3 B;  2J55 H;  4PSW B;  2B5M A;  3PXS D;  5AFU 3;  2HXC A;  2P9I C;  2H9N A;  3OW8 A;  3IIY A;  2VDK A;  4L9O A;  1S4U X;  3K72 A;  2HKR A;  4CI3 A;  3FRX A;  3IJC A;  4J0W A;  3I7K A;  3SWS D;  3OL2 B;  4L3H D;  5I5J A;  2CNX A;  4DNU A;  4LG9 A;  1SQ9 A;  3RLM D;  3RMZ D;  2PM9 A;  5E6U A;  4ZN4 A;  4BP8 A;  4Z7Q A;  4CI1 A;  4NAA A;  3MZK A;  3RN1 D;  5M5S A;  3N0E A;  1MG3 A;  1QNI A;  1BPO A;  3B7F A;  4LGN A;  1N6D A;  3VI3 A;  4N14 A;  4GMB A;  4AMZ A;  3EQ8 A;  5H17 A;  3NIG A;  2H14 A;  3ZE2 A;  4IRZ A;  1VZ3 A;  3SFZ A;  5FQD A;  2YBA A;  3EQ9 A;  4ESG A;  1L5G A;  2H9L A;  2P9K C;  2CE8 A;  4GQB B;  3I7L A;  4HDJ A;  3CIK B;  2GC7 A;  3PVW B;  2H68 A;  1VYH C;  3K6S A;  1GOF A;  3AFC A;  4J8G A;  3DXK C;  4CZX A;  2MTA H;  3F3G A;  3BG0 A;  3EWE A;  3RFH A;  5CXC A;  4FA9 D;  4J79 A;  2QC5 A;  5CXB A;  4GM8 A;  2CN2 A;  4QL1 A;  3O4H A;  3GD1 I;  3MUO A;  4U1E I;  3EI2 A;  2OIZ A;  1GXR A;  2I3S A;  3ZWL B;  5FXY A;  4G1M A;  5E6S A;  1GG2 B;  4CI2 A;  3V4P A;  3ODT A;  2XYI A;  3E0C A;  4A09 A;  4JHN A;  3C99 A;  1UTC A;  1U4C A;  3SN6 B;  4O9D A;  5TF2 A;  1OLZ A;  4NC4 A;  4QT8 A;  3MXX A;  3DWL C;  3I7P A;  3T3M A;  4XYI A;  1JV2 A;  4FB1 D;  4UM8 A;  4MK0 B;  1JTD B;  4E5Z A;  3IJE A;  4A0A A;  1GOH A;  5EAL A;  1MDA H;  1H2Y A;  4A09 B;  2EID A;  3FM0 A;  1JMX B;  3RSE C;  4Z7O A;  4A2M A;  1PGU A;  4QRJ A;  5TEF A;  5FLX g;  4PBZ A;  4JSN C;  2AQ5 A;  2EBS A;  5CYK A;  4OZU A;  1B9Y A;  5GXI A;  4CY3 A;  4TZ4 A;  2PM7 B;  2IWF A;  4E5Z B;  4WK2 A;  1H2Z A;  5IJ8 E;  4BL0 A;  1U8C A;  3IJ0 A;  4FAV D;  3NVN A;  1GOT B;  3BWS A;  3EI3 A;  3RRM C;  1VZ2 A;  4WJK A;  3MKS B;  4CZY A;  2PM6 B;  3VGZ A;  5C2W B;  4E54 A;  4AN0 A;  4BH6 A;  4JD2 C;  5IJ7 E;  5IC7 A;  5TDH B;  2B5L A;  1A0R B;  4AOW A;  4IMM A;  2XDW A;  5EMM B;  2AH1 A;  3SCY A;  2QZP A;  4K3J B;  4NEN A;  4J73 A;  4Z8L A;  4JXM A;  2Z2N A;  3J80 g;  2EIE A;  5M61 A;  3MMY A;  2AGY A;  4E54 B;  5K1C C;  1O6F A;  3U4Y A;  4GM9 A;  4MMX A;  3SLE D;  1JOF A;  3SVW D;  1XIP A;  2I0S A;  3VA6 A;  3JZH A;  5KDO B;  4R7A B;  2VDR A;  1QFM A;  4CY1 A;  1NEX B;  4GGA A;  4NBM A;  3ZDY A;  2IWK A;  3GRE A; 
#chains in the Genus database with same CATH homology
 5JWZ A;  4A08 B;  4O45 A;  3I7H A;  2H6N A;  2Z2O A;  2XL2 A;  1B9X A;  3K26 A;  3EU7 A;  5THA A;  5HQG A;  2OVP B;  5HE1 B;  4ZOZ A;  2OK4 A;  5FA5 B;  4CI8 A;  1N6E A;  2AH0 A;  4Y7R A;  2I0R A;  5EAP A;  1L0Q A;  3DXM C;  4FHL A;  4ES0 A;  3C9C A;  3NVQ A;  2IAA A;  3ORV D;  2Q7Q A;  3JRP A;  4D0K A;  4UI9 R;  2UZY B;  5AMS A;  3K27 A;  3SBR A;  3HFQ A;  4A2L A;  2OJY A;  2CE9 A;  4PNK B;  3UVK A;  3KRW B;  1YFQ A;  2GC4 A;  4U7A A;  3V5W B;  2QXV A;  4D6V A;  3L4O D;  2HES X;  3PVU B;  4ZOY A;  1FWX A;  4FA1 D;  3CFV A;  4XEI C;  4J0X A;  2AGL A;  2AGX A;  5IT9 g;  2B4E A;  1SHY B;  5HE0 B;  2P9L C;  2OVQ B;  2CO0 A;  5GMK n;  1K8K C;  3EMH A;  5FKR A;  4CZV A;  4LG8 A;  3EI1 B;  5B4W A;  3UR4 A;  2XU7 A;  5EM2 B;  3J81 g;  3BG1 A;  3UVL A;  2H9P A;  1U2V C;  2YNP A;  3C5M A;  1NR0 A;  1PI6 A;  4Y5R D;  3JZN A;  2GNQ A;  1PBY B;  3DM0 A;  2J56 H;  4GM3 A;  4J82 A;  5SXM A;  4ZOX A;  4JSV C;  1ERJ A;  5GSA A;  4J78 A;  4L1Q D;  2OVR B;  3AH8 B;  3AL9 A;  4JT5 C;  4J81 A;  4O3U B;  2O9K A;  3JPX A;  2YNN A;  2AGZ A;  2P9N C;  3OKT A;  4GQ1 A;  5EAR A;  3RN0 D;  4JSP C;  4K3I D;  5EMK B;  3NVX A;  3I89 A;  2H3X A;  2G9A A;  3SJL D;  3L4M D;  2HYE A;  1JJU B;  3P4F A;  3VH0 A;  3UKU C;  3A0F A;  2Z2P A;  4O1Q D;  4PSX B;  4PXW A;  4A7J A;  4A08 A;  5HE3 B;  2IUV A;  4H5I A;  1SQJ A;  4A0B A;  2PBI B;  1R5M A;  3JZG A;  3PXT D;  2P9S C;  4FWW A;  3UVO A;  2P9P C;  3N0D A;  3AL8 B;  1K32 A;  4L3G D;  4J84 A;  5K19 A;  3JB9 L;  1PEV A;  2I3T A;  2BCJ B;  2OK6 A;  2W18 A;  3DSM A;  3EG6 A;  4NSX A;  3KRX B;  5EMJ B;  3FGB A;  3OKY A;  5H1M A;  4A11 B;  2CO0 C;  4A0B B;  2CN3 A;  2HKM A;  4PBY A;  1GP2 B;  4GGC A;  4ZOV A;  3MZL A;  2J57 G;  1XKS A;  4X61 B;  2IUQ A;  3SXT D;  1MG2 A;  4KFM B;  3MKQ A;  2H6K A;  2YMU A;  5AJA A;  1RI6 A;  2P9U C;  5H14 A;  3OKY B;  3PSL A;  2HJB A;  5EML B;  4FAN D;  4JT6 C;  4X63 B;  3OKW A;  2TRC B;  3PXW D;  3F3F A;  5A2Q g;  1TYQ C;  3CFS B;  4YVD A;  4AEZ A;  1Q47 A;  2AGW A;  3ULE C;  1XHM A;  3PSC B;  3RFG A;  5HE2 B;  2PM9 B;  3EI1 A;  3UVM A;  5EM2 A;  2HJ4 A;  5IGQ A;  5I5M A;  3C75 H;  4I79 A;  2H6Q A;  3OTT A;  4EWR A;  3I8E A;  3I2N A;  3UKR C;  2IUP A;  4XYH A;  4X60 B;  3I7N A;  1JMZ B;  4G56 B;  3SBQ A;  5I5I A;  5IGO A;  3IIW A;  4ERZ A;  4FA4 D;  5EAM A;  4H5J A;  2G99 A;  3JAM g;  5CXC B;  5CXB B;  4IA9 A;  3SBP A;  3EI4 A;  4GQ2 P;  3EI2 B;  5HYN B;  4QQE A;  3W15 A;  4GZ8 A;  1N6F A;  3SHF A;  4ERQ A;  2UZX B;  4CY5 A;  1OMW B;  4OWR A;  1P22 A;  2B5N A;  2I0T A;  4J86 A;  4J8B A;  4O3T B;  3IJ1 A;  3JRO A;  4PC0 A;  2H47 A;  3V7D B;  5GXH A;  3V9F A;  3EI4 B;  3I8C A;  4FA5 D;  4X3E A;  2BBK H;  2H13 A;  3AL8 A;  5FKS A;  4A0A B;  5C2V B;  3F3P A;  4CY2 A;  2YB8 B;  4A11 A;  3UVN A;  4ERY A;  5FKT A;  3I7O A;  4BUJ C;  2XL3 A;  2YNO A;  4CC9 A;  3SMR A;  3IKO A;  5FKQ A;  4J87 A;  5CYK B;  5C9Z B;  1TBG A;  4J77 A;  5TEE A;  2IUR A;  3PE7 A;  3OL2 A;  2H9M A;  4GGD A;  3GFC A;  4JSX C;  3EI3 B;  2J55 H;  4PSW B;  2B5M A;  3PXS D;  5AFU 3;  2HXC A;  2P9I C;  2H9N A;  3OW8 A;  3IIY A;  4L9O A;  1S4U X;  2HKR A;  4CI3 A;  3FRX A;  3IJC A;  4J0W A;  3I7K A;  3SWS D;  3OL2 B;  4L3H D;  5I5J A;  2CNX A;  4LG9 A;  1SQ9 A;  3RLM D;  3RMZ D;  2PM9 A;  4ZN4 A;  4CI1 A;  3MZK A;  3RN1 D;  3N0E A;  1MG3 A;  1QNI A;  3B7F A;  4LGN A;  1N6D A;  4N14 A;  4GMB A;  5H17 A;  2H14 A;  3SFZ A;  5FQD A;  2YBA A;  4ESG A;  2H9L A;  2P9K C;  2CE8 A;  4GQB B;  3I7L A;  4HDJ A;  3CIK B;  2GC7 A;  3PVW B;  2H68 A;  1VYH C;  3AFC A;  4J8G A;  3DXK C;  4CZX A;  2MTA H;  3F3G A;  3BG0 A;  3EWE A;  3RFH A;  5CXC A;  4FA9 D;  4J79 A;  2QC5 A;  5CXB A;  4GM8 A;  2CN2 A;  4QL1 A;  4U1E I;  3EI2 A;  2OIZ A;  1GXR A;  2I3S A;  3ZWL B;  5FXY A;  1GG2 B;  4CI2 A;  3ODT A;  2XYI A;  3E0C A;  4A09 A;  3C99 A;  1U4C A;  3SN6 B;  4O9D A;  5TF2 A;  1OLZ A;  4QT8 A;  3MXX A;  3DWL C;  3I7P A;  4XYI A;  4FB1 D;  4MK0 B;  4E5Z A;  4A0A A;  5EAL A;  1MDA H;  4A09 B;  3FM0 A;  1JMX B;  3RSE C;  4A2M A;  1PGU A;  4QRJ A;  5TEF A;  5FLX g;  4PBZ A;  4JSN C;  2AQ5 A;  2EBS A;  5CYK A;  4OZU A;  1B9Y A;  5GXI A;  4CY3 A;  4TZ4 A;  2PM7 B;  2IWF A;  4E5Z B;  5IJ8 E;  4BL0 A;  3IJ0 A;  4FAV D;  3NVN A;  1GOT B;  3BWS A;  3EI3 A;  3RRM C;  3MKS B;  4CZY A;  2PM6 B;  3VGZ A;  5C2W B;  4E54 A;  4BH6 A;  4JD2 C;  5IJ7 E;  5IC7 A;  5TDH B;  2B5L A;  1A0R B;  4AOW A;  4IMM A;  5EMM B;  2AH1 A;  3SCY A;  4K3J B;  4J73 A;  4Z8L A;  4JXM A;  2Z2N A;  3J80 g;  3MMY A;  2AGY A;  4E54 B;  5K1C C;  3U4Y A;  4GM9 A;  3SLE D;  1JOF A;  3SVW D;  1XIP A;  2I0S A;  3VA6 A;  3JZH A;  5KDO B;  4R7A B;  4CY1 A;  1NEX B;  4GGA A;  2IWK A;  3GRE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...