3ODTA

Crystal structure of wd40 beta propeller domain of doa1
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
297
structure length
296
Chain Sequence
FTGYQLSATLKGHDQDVRDVVAVDDSKVASVSRDGTVRLWSKDDQWLGTVVYTGQGFLNSVCYDSEKELLLFGGKDTMINGVPLFATSGEDPYTLIGHQGNVCSLSFQDGVVISGSWDKTAKVWKEGSLVYNLQAHNASVWDAKVVSFSENKFLTASADKTIKLWQNDKVIKTFSGIHNDVVRHLAVVDDGHFISCSNDGLIKLVDMHTGDVLRTYEGHESFVYCIKLLPNGDIVSCGEDRTVRIWSKENGSLKQVITLPAISIWSVDCMSNGDIIVGSSDNLVRIFSQEKSRWAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title WD40 Repeat Propellers Define a Ubiquitin-Binding Domain that Regulates Turnover of F Box Proteins.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Nuclear protein
molecule keywords Protein DOA1
total genus 84
structure length 296
sequence length 297
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3odtA00
3P4FA 4J78A 4AOWA 4A09A 1NEXB 3SHFA 3IIWA 5EAMA 4J8GA 3PXTD 4HDJA 4A11A 3UKRC 3EG6A 3EI2A 3JAMg 5IJ7E 4EWRA 2P9KC 4CY5A 4ZOZA 4J0WA 4JSVC 4ERZA 3KRXB 3PXWD 2AGXA 3EI1B 1B9YA 3SN6B 1PBYB 3FGBA 1SQ9A 3DM0A 3OL2B 3DXKC 3RLMD 4E54A 2OK6A 4MK0B 4GGCA 2PM7B 3C5MA 4GGAA 1ERJA 4ES0A 4J73A 3GFCA 5B4WA 4O1QD 4XEIC 2H6QA 4FAND 4D0KA 4K3JB 2B5MA 2HJBA 5A2Qg 2IURA 4KFMB 1K8KC 1NR0A 3CFSB 5EMJB 4CY2A 4O45A 4A0AA 3L4MD 3K26A 3IJ0A 3I8EA 4A2MA 2XU7A 4A0BB 3EWEA 4CZYA 2UZYB 1GOTB 2I0TA 3SFZA 4L1QD 2PBIB 4GGDA 3SBRA 3VH0A 4GQ1A 4TZ4A 5HYNB 3DSMA 3VGZA 4FAVD 2AGWA 4ZOXA 5HE2B 5THAA 3JZHA 1OLZA 2QXVA 1TBGA 3ULEC 4A0AB 3SCYA 2B5LA 4J79A 1MG3A 3HFQA 3VA6A 1PEVA 3I7KA 4JSPC 2CNXA 1VYHC 2GC4A 4R7AB 2XYIA 3I8CA 4FA9D 5EMMB 5FKTA 5AMSA 2UZXB 2PM9B 4I79A 4U7AA 3C99A 4A09B 3PVUB 3ZWLB 4X60B 4A7JA 3ORVD 3SVWD 5H1MA 2H3XA 3GREA 4E5ZA 5TDHB 4CZXA 2G9AA 4J82A 2AH1A 5C9ZB 5CYKB 4CI3A 1XHMA 4FA4D 3RRMC 5TEEA 1XIPA 3UR4A 2XL2A 1GP2B 3EI4B 4A2LA 1N6EA 3JZNA 4LG8A 2P9NC 3N0EA 2H47A 2EBSA 2OVRB 3OKTA 4J8BA 5IC7A 1A0RB 4L3HD 4ERQA 5EALA 1RI6A 4A08A 1N6FA 4PBZA 4OZUA 4XYIA 4JSXC 4ERYA 5C2VB 1JMXB 4QT8A 3IIYA 3NVQA 2I0SA 5AFU3 1Q47A 4PSXB 5EMLB 2PM6B 1FWXA 4CI1A 3C75H 4Z8LA 2I3TA 1GG2B 2OJYA 5GXHA 4CY1A 2B4EA 3UVLA 5KDOB 1MG2A 2IUQA 1S4UX 3PE7A 4JT6C 3W15A 4J84A 4QL1A 3KRWB 2P9LC 5TF2A 5HE3B 5HE1B 3RFHA 5EM2A 3JRPA 3PSCB 2P9IC 4J86A 4YVDA 4JT5C 5CXCB 1JJUB 3F3GA 5IT9g 3J81g 2OK4A 5SXMA 3UVNA 1N6DA 3OW8A 1MDAH 3RSEC 4FB1D 5EARA 1OMWB 3SBQA 2GNQA 2H14A 3AL8A 4CY3A 4XYHA 2P9SC 4H5IA 3C9CA 2HJ4A 1QNIA 5CXCA 5FQDA 2CN3A 1GXRA 4BH6A 1PI6A 3RMZD 4ZOYA 3EI3B 2YNOA 4JXMA 3N0DA 4H5JA 4Y5RD 3MZKA 5AJAA 1U2VC 2AQ5A 1L0QA 3I89A 5FKQA 2H6KA 4O3UB 3EMHA 4LG9A 4JD2C 4ZN4A 3MZLA 3SLED 5TEFA 3CIKB 3SBPA 3UVKA 1R5MA 4LGNA 2J55H 2TRCB 3AL8B 4D6VA 5H17A 3JZGA 2YBAA 5FKSA 2H13A 3JROA 2OIZA 3UVOA 2H6NA 2CN2A 2AGLA 4Y7RA 2J57G 5CXBA 2Q7QA 3I7OA 3OKWA 5FA5B 4FWWA 3RN0D 3NVXA 3SJLD 4J0XA 2P9PC 4OWRA 5EM2B 5I5JA 3I7HA 5H14A 3DXMC 3PVWB 2IAAA 3IJCA 2H9LA 2CO0A 5JWZA 4AEZA 4GM3A 4GM8A 1SHYB 3DWLC 1TYQC 5CXBB 2BBKH 4O9DA 2J56H 4K3ID 5GXIA 4N14A 1P22A 4E5ZB 4GZ8A 2I3SA 3L4OD 3BG1A 2IWKA 2IUPA 3RFGA 3IJ1A 4A08B 2PM9A 4PSWB 2IWFA 3RN1D 2G99A 2AGZA 2OVPB 1JMZB 3ODTA 3BWSA 4GQ2P 3I2NA 5FXYA 5IGQA 2YNNA 4X63B 1U4CA 5FLXg 3AFCA 3JPXA 2HKRA 3UKUC 2CE9A 2QC5A 3SMRA 3UVMA 3EI4A 2B5NA 2H9PA 2GC7A 3IKOA 4ESGA 1B9XA 3A0FA 5C2WB 4BL0A 1YFQA 1SQJA 5CYKA 2YNPA 4PC0A 3F3FA 3K27A 3EU7A 5IGOA 1JOFA 4BUJC 2CE8A 3BG0A 2BCJB 5HQGA 4QRJA 3MXXA 1K32A 3V7DB 4CI8A 4J77A 5GMKn 5K19A 2MTAH 3CFVA 3I7PA 4G56B 4A0BA 3JB9L 3PSLA 2Z2OA 4FHLA 4J81A 4O3TB 3U4YA 2W18A 2XL3A 4JSNC 3F3PA 2AH0A 4J87A 2YMUA 3I7NA 4L9OA 3EI3A 4L3GD 4U1EI 3SXTD 4FA5D 2CO0C 4IMMA 3J80g 2IUVA 1PGUA 4FA1D 5IJ8E 3NVNA 3FRXA 3MKQA 2Z2PA 3AH8B 4GMBA 3MMYA 3I7LA 2O9KA 3E0CA 4GQBB 5GSAA 4CI2A 2HESX 4PXWA 2Z2NA 3OTTA 4X61B 2OVQB 4NSXA 3AL9A 4GM9A 4CZVA 3V9FA 2H68A 4QQEA 2P9UC 4CC9A 5FKRA 5EAPA 2H9NA 3MKSB 5I5MA 3EI2B 3SWSD 4A11B 5EMKB 3V5WB 2H9MA 4PBYA 5HE0B 2HXCA 1XKSA 4PNKB 5K1CC 3B7FA 3FM0A 4UI9R 3OKYA 4E54B 5I5IA 3PXSD 3OL2A 2AGYA 2YB8B 2HYEA 2I0RA 4IA9A 3EI1A 2HKMA 4X3EA 3OKYB 4ZOVA
chains in the Genus database with same CATH superfamily
3P4FA 4J78A 4AOWA 2VDKA 1NEXB 4A09A 4WK2A 3SHFA 3IIWA 5EAMA 1QFSA 4MMYA 1K3IA 3PXTD 4HDJA 3QI0A 4J8GA 4A11A 3UKRC 3EG6A 3EI2A 3JAMg 5IJ7E 3O4GA 4EWRA 3O4HA 2P9KC 4CY5A 4ZOZA 4J0WA 4JSVC 4ERZA 3KRXB 3PXWD 2AGXA 3EI1B 1B9YA 3SN6B 1PBYB 3FGBA 1SQ9A 5FFOA 3DM0A 3OL2B 3DXKC 3RLMD 4E54A 2OK6A 4MK0B 3ZE0A 1U8CA 4GGCA 2PM7B 3C5MA 4GGAA 1ERJA 3EQ9A 4ES0A 1YR2A 4J73A 3VI4A 3GFCA 5B4WA 4O1QD 4XEIC 2H6QA 4FAND 4D0KA 4K3JB 2B5MA 5E6RA 2HJBA 5C86A 5A2Qg 1H2WA 2IURA 4KFMB 1K8KC 5E6SA 1NR0A 3CFSB 4O02A 2XE4A 4NENA 4BCDA 5EMJB 4CY2A 5HDBA 4O45A 4A0AA 3L4MD 3V4VA 2VDOA 3K26A 3IJ0A 3I8EA 4A2MA 2XU7A 4A0BB 3K72A 3EWEA 4UM9A 4CZYA 2UZYB 1GOTB 2I0TA 3SFZA 4L1QD 2PBIB 1UOPA 3IJEA 3OF7A 4GGDA 3SBRA 3VH0A 4GQ1A 4TZ4A 3V4PA 3DSMA 3VGZA 4FAVD 5HYNB 2AGWA 4ZOXA 5HE2B 5THAA 3JZHA 1OLZA 2QXVA 1TBGA 4NC4A 3ULEC 4A0AB 3SCYA 1M1XA 3VI3A 2B5LA 2VZ3A 4J79A 1MG3A 3NIFA 3HFQA 3EQ8A 4BCCA 1O6GA 3VA6A 2VDRA 1PEVA 3I7KA 3O4IA 4JSPC 4WK0A 3IUJA 2CNXA 2GC4A 1VYHC 4R7AB 3IUMA 2XYIA 2XZGA 3I8CA 4FA9D 5EMMB 5FKTA 5AMSA 2UZXB 2PM9B 4I79A 1TYEA 3C99A 4U7AA 4A09B 3PVUB 4RE5A 2JKXA 3ZWLB 4Z7QA 4X60B 4A7JA 3K71A 3ORVD 3SVWD 5H1MA 2H3XA 3GREA 4DNVA 4E5ZA 5TDHB 4CZXA 3GC3B 2G9AA 4J82A 2AH1A 3ZDXA 5C9ZB 5CYKB 4CI3A 1XHMA 3IUQA 4FA4D 5M5TA 3RRMC 4G1EA 5TEEA 1XIPA 2VDNA 3UR4A 2XL2A 1GP2B 3EI4B 4A2LA 1N6EA 3JZNA 2HU7A 3IULA 4LG8A 2P9NC 3DDUA 2H47A 3N0EA 2EBSA 2OVRB 4QAMA 3OKTA 4J8BA 5IC7A 4AN0A 5M5SA 1A0RB 3IUNA 4G1MA 4L3HD 4ERQA 4RE6A 2HU8A 4IRZA 5EALA 1GOHA 1RI6A 4A08A 1N6FA 4PBZA 4OZUA 4XYIA 4JSXC 1T2XA 3ZE1A 4ERYA 5C2VB 1JMXB 4QT8A 3IIYA 3NVQA 2I0SA 3T3PA 5AFU3 1Q47A 4PSXB 5EMLB 2PM6B 2VDPA 1FWXA 4CI1A 3C75H 4Z8LA 2I3TA 4WJKA 1GG2B 1UOQA 2OJYA 5GXHA 4CY1A 3KCIA 2B4EA 3UVLA 3MUOA 2QZPA 5KDOB 1MG2A 1GOFA 2IUQA 1S4UX 3PE7A 4JT6C 3W15A 4J84A 4QL1A 3KRWB 2HU5A 2P9LC 5TF2A 5HE3B 5HE1B 3RFHA 5EM2A 3JRPA 4BP9A 3PSCB 2P9IC 4J86A 1VE7A 4YVDA 4JT5C 2VZ1A 5CXCB 1JJUB 3MUNA 2EIEA 3F3GA 5IT9g 3J81g 2OK4A 5SXMA 3UVNA 1N6DA 3OW8A 1MDAH 1O6FA 4BP8A 3RSEC 4FB1D 1VE6A 5EARA 1OMWB 3SBQA 2GNQA 2H14A 3AL8A 4CY3A 4XYHA 2P9SC 4H5IA 3C9CA 3T3MA 2HJ4A 4AMYA 1UOOA 4Z7OA 4UM8A 1QNIA 5CXCA 5FQDA 2CN3A 1GXRA 4BH6A 2VDMA 1PI6A 3RMZD 4ZOYA 3EI3B 2YNOA 4JXMA 3N0DA 4H5JA 4Y5RD 3IVMA 3MZKA 5AJAA 1U2VC 2AQ5A 1L0QA 3I89A 5FKQA 3O4JA 2H6KA 4O3UB 1GOGA 1JTDB 3IURA 5M5RA 3EMHA 4LG9A 4JD2C 4ZN4A 3MZLA 3SLED 5TEFA 3CIKB 3SBPA 3UVKA 1R5MA 4LGNA 2J55H 2TRCB 3AL8B 4AMZA 3MVDK 4D6VA 5H17A 3JZGA 2YBAA 5FKSA 1E8MA 2H13A 3JROA 2OIZA 3UVOA 2H6NA 2CN2A 2AGLA 4Y7RA 2J57G 2Q7QA 3I7OA 3OKWA 5CXBA 5FA5B 4FWWA 3RN0D 3NVXA 3SJLD 4J0XA 2P9PC 4OWRA 5EM2B 5M5UA 3FCSA 5M61A 5I5JA 3I7HA 5H14A 5E6UA 3DXMC 3PVWB 2IAAA 3IJCA 2H9LA 2CO0A 5JWZA 4AEZA 4GM3A 3ZDYA 3NIDA 4GM8A 1JV2A 1H2ZA 1SHYB 3DWLC 1TYQC 4JHNA 5CXBB 2BBKH 4O9DA 2J56H 1C9LA 4K3ID 5GXIA 4N14A 4NBMA 1P22A 4E5ZB 4GZ8A 1H2XA 2I3SA 3FCUA 3L4OD 3BG1A 2IWKA 3QHYB 2IUPA 2BKLA 3RFGA 3IJ1A 4O2WA 4A08B 2PM9A 1UTCA 4PSWB 1L5GA 2IWFA 3RN1D 2G99A 2AGZA 2OVPB 1QFMA 1JMZB 3ODTA 3BWSA 4GQ2P 3I2NA 5FXYA 5IGQA 2YNNA 4X63B 1U4CA 5FLXg 3EQ7A 3AFCA 3JPXA 2HKRA 3UKUC 4L1MA 2CE9A 1E8NA 2QC5A 3SMRA 3UVMA 3EI4A 1BPOA 2B5NA 2H9PA 2GC7A 3IKOA 4ESGA 1B9XA 3A0FA 5C2WB 4BL0A 1YFQA 1SQJA 5CYKA 2YNPA 4PC0A 3F3FA 3K27A 3EU7A 5IGOA 4MMZA 1JOFA 4BUJC 5FFGA 2CE8A 3BG0A 2BCJB 5HQGA 4QRJA 3MXXA 1K32A 3V7DB 5M5VA 4CI8A 4NAAA 4J77A 5GMKn 1E5TA 5K19A 2MTAH 3CFVA 1VZ2A 3I7PA 4G56B 4A0BA 3GD1I 3JB9L 3PSLA 1I2MB 3ZDZA 2VDLA 2Z2OA 1VZ3A 4FHLA 4J81A 4O3TB 3U4YA 2W18A 2XL3A 4JSNC 3F3PA 4Z7NA 4D9SA 2AH0A 4J87A 2EIDA 2YMUA 2VC2A 3I7NA 4L9OA 3EI3A 4L3GD 4U1EI 3SXTD 4FA5D 2WQ8A 2CO0C 4IMMA 4MMXA 3J80g 2IUVA 3K6SA 1PGUA 4FA1D 2XDWA 5IJ8E 3NVNA 4WK4A 3FRXA 3MKQA 2Z2PA 2EICA 3AH8B 2QR5A 4GMBA 3MMYA 3ZE2A 3I7LA 1C9IA 2O9KA 3E0CA 4GQBB 5GSAA 1H2YA 4CI2A 4BCBA 2HESX 4PXWA 2Z2NA 3OTTA 4X61B 2OVQB 4NSXA 3AL9A 4GM9A 4CZVA 4G55A 3V9FA 2H68A 4QQEA 2P9UC 3NIGA 4CC9A 5FKRA 5EAPA 2H9NA 3MKSB 5I5MA 3EI2B 2VDQA 3SWSD 4A11B 5EMKB 3V5WB 2H9MA 4DNUA 4AX4A 2EIBA 4PBYA 5HE0B 2HXCA 1XKSA 4PNKB 4AN1A 5K1CC 4JHPC 3B7FA 3FM0A 1A12A 4UI9R 5C92A 3OKYA 4E54B 5I5IA 3PXSD 3OL2A 2AGYA 2YB8B 2HYEA 2I0RA 4IA9A 3EI1A 4DNWA 2HKMA 4X3EA 3OKYB 4ZOVA
chains in the Genus database with same CATH topology
3P4FA 4J78A 4AOWA 4A09A 1NEXB 3SHFA 3IIWA 5EAMA 4J8GA 3PXTD 4HDJA 4A11A 3UKRC 3EG6A 3EI2A 3JAMg 5IJ7E 4EWRA 2P9KC 4CY5A 4ZOZA 4J0WA 4JSVC 4ERZA 3KRXB 3PXWD 2AGXA 3EI1B 1B9YA 3SN6B 1PBYB 3FGBA 1SQ9A 3DM0A 3OL2B 3DXKC 3RLMD 4E54A 2OK6A 4MK0B 4GGCA 2PM7B 3C5MA 4GGAA 1ERJA 4ES0A 4J73A 3GFCA 5B4WA 4O1QD 4XEIC 2H6QA 4FAND 4D0KA 4K3JB 2B5MA 2HJBA 5A2Qg 2IURA 4KFMB 1K8KC 1NR0A 3CFSB 5EMJB 4CY2A 4O45A 4A0AA 3L4MD 3K26A 3IJ0A 3I8EA 4A2MA 2XU7A 4A0BB 3EWEA 4CZYA 2UZYB 1GOTB 2I0TA 3SFZA 4L1QD 2PBIB 4GGDA 3SBRA 3VH0A 4GQ1A 4TZ4A 5HYNB 3DSMA 3VGZA 4FAVD 2AGWA 4ZOXA 5HE2B 5THAA 3JZHA 1OLZA 2QXVA 1TBGA 3ULEC 4A0AB 3SCYA 2B5LA 4J79A 1MG3A 3HFQA 3VA6A 1PEVA 3I7KA 4JSPC 2CNXA 1VYHC 2GC4A 4R7AB 2XYIA 3I8CA 4FA9D 5EMMB 5FKTA 5AMSA 2UZXB 2PM9B 4I79A 4U7AA 3C99A 4A09B 3PVUB 3ZWLB 4X60B 4A7JA 3ORVD 3SVWD 5H1MA 2H3XA 3GREA 4E5ZA 5TDHB 4CZXA 2G9AA 4J82A 2AH1A 5C9ZB 5CYKB 4CI3A 1XHMA 4FA4D 3RRMC 5TEEA 1XIPA 3UR4A 2XL2A 1GP2B 3EI4B 4A2LA 1N6EA 3JZNA 4LG8A 2P9NC 3N0EA 2H47A 2EBSA 2OVRB 3OKTA 4J8BA 5IC7A 1A0RB 4L3HD 4ERQA 5EALA 1RI6A 4A08A 1N6FA 4PBZA 4OZUA 4XYIA 4JSXC 4ERYA 5C2VB 1JMXB 4QT8A 3IIYA 3NVQA 2I0SA 5AFU3 1Q47A 4PSXB 5EMLB 2PM6B 1FWXA 4CI1A 3C75H 4Z8LA 2I3TA 1GG2B 2OJYA 5GXHA 4CY1A 2B4EA 3UVLA 5KDOB 1MG2A 2IUQA 1S4UX 3PE7A 4JT6C 3W15A 4J84A 4QL1A 3KRWB 2P9LC 5TF2A 5HE3B 5HE1B 3RFHA 5EM2A 3JRPA 3PSCB 2P9IC 4J86A 4YVDA 4JT5C 5CXCB 1JJUB 3F3GA 5IT9g 3J81g 2OK4A 5SXMA 3UVNA 1N6DA 3OW8A 1MDAH 3RSEC 4FB1D 5EARA 1OMWB 3SBQA 2GNQA 2H14A 3AL8A 4CY3A 4XYHA 2P9SC 4H5IA 3C9CA 2HJ4A 1QNIA 5CXCA 5FQDA 2CN3A 1GXRA 4BH6A 1PI6A 3RMZD 4ZOYA 3EI3B 2YNOA 4JXMA 3N0DA 4H5JA 4Y5RD 3MZKA 5AJAA 1U2VC 2AQ5A 1L0QA 3I89A 5FKQA 2H6KA 4O3UB 3EMHA 4LG9A 4JD2C 4ZN4A 3MZLA 3SLED 5TEFA 3CIKB 3SBPA 3UVKA 1R5MA 4LGNA 2J55H 2TRCB 3AL8B 4D6VA 5H17A 3JZGA 2YBAA 5FKSA 2H13A 3JROA 2OIZA 3UVOA 2H6NA 2CN2A 2AGLA 4Y7RA 2J57G 5CXBA 2Q7QA 3I7OA 3OKWA 5FA5B 4FWWA 3RN0D 3NVXA 3SJLD 4J0XA 2P9PC 4OWRA 5EM2B 5I5JA 3I7HA 5H14A 3DXMC 3PVWB 2IAAA 3IJCA 2H9LA 2CO0A 5JWZA 4AEZA 4GM3A 4GM8A 1SHYB 3DWLC 1TYQC 5CXBB 2BBKH 4O9DA 2J56H 4K3ID 5GXIA 4N14A 1P22A 4E5ZB 4GZ8A 2I3SA 3L4OD 3BG1A 2IWKA 2IUPA 3RFGA 3IJ1A 4A08B 2PM9A 4PSWB 2IWFA 3RN1D 2G99A 2AGZA 2OVPB 1JMZB 3ODTA 3BWSA 4GQ2P 3I2NA 5FXYA 5IGQA 2YNNA 4X63B 1U4CA 5FLXg 3AFCA 3JPXA 2HKRA 3UKUC 2CE9A 2QC5A 3SMRA 3UVMA 3EI4A 2B5NA 2H9PA 2GC7A 3IKOA 4ESGA 1B9XA 3A0FA 5C2WB 4BL0A 1YFQA 1SQJA 5CYKA 2YNPA 4PC0A 3F3FA 3K27A 3EU7A 5IGOA 1JOFA 4BUJC 2CE8A 3BG0A 2BCJB 5HQGA 4QRJA 3MXXA 1K32A 3V7DB 4CI8A 4J77A 5GMKn 5K19A 2MTAH 3CFVA 3I7PA 4G56B 4A0BA 3JB9L 3PSLA 2Z2OA 4FHLA 4J81A 4O3TB 3U4YA 2W18A 2XL3A 4JSNC 3F3PA 2AH0A 4J87A 2YMUA 3I7NA 4L9OA 3EI3A 4L3GD 4U1EI 3SXTD 4FA5D 2CO0C 4IMMA 3J80g 2IUVA 1PGUA 4FA1D 5IJ8E 3NVNA 3FRXA 3MKQA 2Z2PA 3AH8B 4GMBA 3MMYA 3I7LA 2O9KA 3E0CA 4GQBB 5GSAA 4CI2A 2HESX 4PXWA 2Z2NA 3OTTA 4X61B 2OVQB 4NSXA 3AL9A 4GM9A 4CZVA 3V9FA 2H68A 4QQEA 2P9UC 4CC9A 5FKRA 5EAPA 2H9NA 3MKSB 5I5MA 3EI2B 3SWSD 4A11B 5EMKB 3V5WB 2H9MA 4PBYA 5HE0B 2HXCA 1XKSA 4PNKB 5K1CC 3B7FA 3FM0A 4UI9R 3OKYA 4E54B 5I5IA 3PXSD 3OL2A 2AGYA 2YB8B 2HYEA 2I0RA 4IA9A 3EI1A 2HKMA 4X3EA 3OKYB 4ZOVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P4F A;  4J78 A;  4AOW A;  4A09 A;  1NEX B;  3SHF A;  3IIW A;  5EAM A;  4J8G A;  3PXT D;  4HDJ A;  4A11 A;  3UKR C;  3EG6 A;  3EI2 A;  3JAM g;  5IJ7 E;  4EWR A;  2P9K C;  4CY5 A;  4ZOZ A;  4J0W A;  4JSV C;  4ERZ A;  3KRX B;  3PXW D;  2AGX A;  3EI1 B;  1B9Y A;  3SN6 B;  1PBY B;  3FGB A;  1SQ9 A;  3DM0 A;  3OL2 B;  3DXK C;  3RLM D;  4E54 A;  2OK6 A;  4MK0 B;  4GGC A;  2PM7 B;  3C5M A;  4GGA A;  1ERJ A;  4ES0 A;  4J73 A;  3GFC A;  5B4W A;  4O1Q D;  4XEI C;  2H6Q A;  4FAN D;  4D0K A;  4K3J B;  2B5M A;  2HJB A;  5A2Q g;  2IUR A;  4KFM B;  1K8K C;  1NR0 A;  3CFS B;  5EMJ B;  4CY2 A;  4O45 A;  4A0A A;  3L4M D;  3K26 A;  3IJ0 A;  3I8E A;  4A2M A;  2XU7 A;  4A0B B;  3EWE A;  4CZY A;  2UZY B;  1GOT B;  2I0T A;  3SFZ A;  4L1Q D;  2PBI B;  4GGD A;  3SBR A;  3VH0 A;  4GQ1 A;  4TZ4 A;  5HYN B;  3DSM A;  3VGZ A;  4FAV D;  2AGW A;  4ZOX A;  5HE2 B;  5THA A;  3JZH A;  1OLZ A;  2QXV A;  1TBG A;  3ULE C;  4A0A B;  3SCY A;  2B5L A;  4J79 A;  1MG3 A;  3HFQ A;  3VA6 A;  1PEV A;  3I7K A;  4JSP C;  2CNX A;  1VYH C;  2GC4 A;  4R7A B;  2XYI A;  3I8C A;  4FA9 D;  5EMM B;  5FKT A;  5AMS A;  2UZX B;  2PM9 B;  4I79 A;  4U7A A;  3C99 A;  4A09 B;  3PVU B;  3ZWL B;  4X60 B;  4A7J A;  3ORV D;  3SVW D;  5H1M A;  2H3X A;  3GRE A;  4E5Z A;  5TDH B;  4CZX A;  2G9A A;  4J82 A;  2AH1 A;  5C9Z B;  5CYK B;  4CI3 A;  1XHM A;  4FA4 D;  3RRM C;  5TEE A;  1XIP A;  3UR4 A;  2XL2 A;  1GP2 B;  3EI4 B;  4A2L A;  1N6E A;  3JZN A;  4LG8 A;  2P9N C;  3N0E A;  2H47 A;  2EBS A;  2OVR B;  3OKT A;  4J8B A;  5IC7 A;  1A0R B;  4L3H D;  4ERQ A;  5EAL A;  1RI6 A;  4A08 A;  1N6F A;  4PBZ A;  4OZU A;  4XYI A;  4JSX C;  4ERY A;  5C2V B;  1JMX B;  4QT8 A;  3IIY A;  3NVQ A;  2I0S A;  5AFU 3;  1Q47 A;  4PSX B;  5EML B;  2PM6 B;  1FWX A;  4CI1 A;  3C75 H;  4Z8L A;  2I3T A;  1GG2 B;  2OJY A;  5GXH A;  4CY1 A;  2B4E A;  3UVL A;  5KDO B;  1MG2 A;  2IUQ A;  1S4U X;  3PE7 A;  4JT6 C;  3W15 A;  4J84 A;  4QL1 A;  3KRW B;  2P9L C;  5TF2 A;  5HE3 B;  5HE1 B;  3RFH A;  5EM2 A;  3JRP A;  3PSC B;  2P9I C;  4J86 A;  4YVD A;  4JT5 C;  5CXC B;  1JJU B;  3F3G A;  5IT9 g;  3J81 g;  2OK4 A;  5SXM A;  3UVN A;  1N6D A;  3OW8 A;  1MDA H;  3RSE C;  4FB1 D;  5EAR A;  1OMW B;  3SBQ A;  2GNQ A;  2H14 A;  3AL8 A;  4CY3 A;  4XYH A;  2P9S C;  4H5I A;  3C9C A;  2HJ4 A;  1QNI A;  5CXC A;  5FQD A;  2CN3 A;  1GXR A;  4BH6 A;  1PI6 A;  3RMZ D;  4ZOY A;  3EI3 B;  2YNO A;  4JXM A;  3N0D A;  4H5J A;  4Y5R D;  3MZK A;  5AJA A;  1U2V C;  2AQ5 A;  1L0Q A;  3I89 A;  5FKQ A;  2H6K A;  4O3U B;  3EMH A;  4LG9 A;  4JD2 C;  4ZN4 A;  3MZL A;  3SLE D;  5TEF A;  3CIK B;  3SBP A;  3UVK A;  1R5M A;  4LGN A;  2J55 H;  2TRC B;  3AL8 B;  4D6V A;  5H17 A;  3JZG A;  2YBA A;  5FKS A;  2H13 A;  3JRO A;  2OIZ A;  3UVO A;  2H6N A;  2CN2 A;  2AGL A;  4Y7R A;  2J57 G;  5CXB A;  2Q7Q A;  3I7O A;  3OKW A;  5FA5 B;  4FWW A;  3RN0 D;  3NVX A;  3SJL D;  4J0X A;  2P9P C;  4OWR A;  5EM2 B;  5I5J A;  3I7H A;  5H14 A;  3DXM C;  3PVW B;  2IAA A;  3IJC A;  2H9L A;  2CO0 A;  5JWZ A;  4AEZ A;  4GM3 A;  4GM8 A;  1SHY B;  3DWL C;  1TYQ C;  5CXB B;  2BBK H;  4O9D A;  2J56 H;  4K3I D;  5GXI A;  4N14 A;  1P22 A;  4E5Z B;  4GZ8 A;  2I3S A;  3L4O D;  3BG1 A;  2IWK A;  2IUP A;  3RFG A;  3IJ1 A;  4A08 B;  2PM9 A;  4PSW B;  2IWF A;  3RN1 D;  2G99 A;  2AGZ A;  2OVP B;  1JMZ B;  3ODT A;  3BWS A;  4GQ2 P;  3I2N A;  5FXY A;  5IGQ A;  2YNN A;  4X63 B;  1U4C A;  5FLX g;  3AFC A;  3JPX A;  2HKR A;  3UKU C;  2CE9 A;  2QC5 A;  3SMR A;  3UVM A;  3EI4 A;  2B5N A;  2H9P A;  2GC7 A;  3IKO A;  4ESG A;  1B9X A;  3A0F A;  5C2W B;  4BL0 A;  1YFQ A;  1SQJ A;  5CYK A;  2YNP A;  4PC0 A;  3F3F A;  3K27 A;  3EU7 A;  5IGO A;  1JOF A;  4BUJ C;  2CE8 A;  3BG0 A;  2BCJ B;  5HQG A;  4QRJ A;  3MXX A;  1K32 A;  3V7D B;  4CI8 A;  4J77 A;  5GMK n;  5K19 A;  2MTA H;  3CFV A;  3I7P A;  4G56 B;  4A0B A;  3JB9 L;  3PSL A;  2Z2O A;  4FHL A;  4J81 A;  4O3T B;  3U4Y A;  2W18 A;  2XL3 A;  4JSN C;  3F3P A;  2AH0 A;  4J87 A;  2YMU A;  3I7N A;  4L9O A;  3EI3 A;  4L3G D;  4U1E I;  3SXT D;  4FA5 D;  2CO0 C;  4IMM A;  3J80 g;  2IUV A;  1PGU A;  4FA1 D;  5IJ8 E;  3NVN A;  3FRX A;  3MKQ A;  2Z2P A;  3AH8 B;  4GMB A;  3MMY A;  3I7L A;  2O9K A;  3E0C A;  4GQB B;  5GSA A;  4CI2 A;  2HES X;  4PXW A;  2Z2N A;  3OTT A;  4X61 B;  2OVQ B;  4NSX A;  3AL9 A;  4GM9 A;  4CZV A;  3V9F A;  2H68 A;  4QQE A;  2P9U C;  4CC9 A;  5FKR A;  5EAP A;  2H9N A;  3MKS B;  5I5M A;  3EI2 B;  3SWS D;  4A11 B;  5EMK B;  3V5W B;  2H9M A;  4PBY A;  5HE0 B;  2HXC A;  1XKS A;  4PNK B;  5K1C C;  3B7F A;  3FM0 A;  4UI9 R;  3OKY A;  4E54 B;  5I5I A;  3PXS D;  3OL2 A;  2AGY A;  2YB8 B;  2HYE A;  2I0R A;  4IA9 A;  3EI1 A;  2HKM A;  4X3E A;  3OKY B;  4ZOV A; 
#chains in the Genus database with same CATH topology
 3P4F A;  4J78 A;  4AOW A;  2VDK A;  1NEX B;  4A09 A;  4WK2 A;  3SHF A;  3IIW A;  5EAM A;  1QFS A;  4MMY A;  1K3I A;  3PXT D;  4HDJ A;  3QI0 A;  4J8G A;  4A11 A;  3UKR C;  3EG6 A;  3EI2 A;  3JAM g;  5IJ7 E;  3O4G A;  4EWR A;  3O4H A;  2P9K C;  4CY5 A;  4ZOZ A;  4J0W A;  4JSV C;  4ERZ A;  3KRX B;  3PXW D;  2AGX A;  3EI1 B;  1B9Y A;  3SN6 B;  1PBY B;  3FGB A;  1SQ9 A;  5FFO A;  3DM0 A;  3OL2 B;  3DXK C;  3RLM D;  4E54 A;  2OK6 A;  4MK0 B;  3ZE0 A;  1U8C A;  4GGC A;  2PM7 B;  3C5M A;  4GGA A;  1ERJ A;  3EQ9 A;  4ES0 A;  1YR2 A;  4J73 A;  3VI4 A;  3GFC A;  5B4W A;  4O1Q D;  4XEI C;  2H6Q A;  4FAN D;  4D0K A;  4K3J B;  2B5M A;  5E6R A;  2HJB A;  5C86 A;  5A2Q g;  1H2W A;  2IUR A;  4KFM B;  1K8K C;  5E6S A;  1NR0 A;  3CFS B;  4O02 A;  2XE4 A;  4NEN A;  4BCD A;  5EMJ B;  4CY2 A;  5HDB A;  4O45 A;  4A0A A;  3L4M D;  3V4V A;  2VDO A;  3K26 A;  3IJ0 A;  3I8E A;  4A2M A;  2XU7 A;  4A0B B;  3K72 A;  3EWE A;  4UM9 A;  4CZY A;  2UZY B;  1GOT B;  2I0T A;  3SFZ A;  4L1Q D;  2PBI B;  1UOP A;  3IJE A;  3OF7 A;  4GGD A;  3SBR A;  3VH0 A;  4GQ1 A;  4TZ4 A;  3V4P A;  3DSM A;  3VGZ A;  4FAV D;  5HYN B;  2AGW A;  4ZOX A;  5HE2 B;  5THA A;  3JZH A;  1OLZ A;  2QXV A;  1TBG A;  4NC4 A;  3ULE C;  4A0A B;  3SCY A;  1M1X A;  3VI3 A;  2B5L A;  2VZ3 A;  4J79 A;  1MG3 A;  3NIF A;  3HFQ A;  3EQ8 A;  4BCC A;  1O6G A;  3VA6 A;  2VDR A;  1PEV A;  3I7K A;  3O4I A;  4JSP C;  4WK0 A;  3IUJ A;  2CNX A;  2GC4 A;  1VYH C;  4R7A B;  3IUM A;  2XYI A;  2XZG A;  3I8C A;  4FA9 D;  5EMM B;  5FKT A;  5AMS A;  2UZX B;  2PM9 B;  4I79 A;  1TYE A;  3C99 A;  4U7A A;  4A09 B;  3PVU B;  4RE5 A;  2JKX A;  3ZWL B;  4Z7Q A;  4X60 B;  4A7J A;  3K71 A;  3ORV D;  3SVW D;  5H1M A;  2H3X A;  3GRE A;  4DNV A;  4E5Z A;  5TDH B;  4CZX A;  3GC3 B;  2G9A A;  4J82 A;  2AH1 A;  3ZDX A;  5C9Z B;  5CYK B;  4CI3 A;  1XHM A;  3IUQ A;  4FA4 D;  5M5T A;  3RRM C;  4G1E A;  5TEE A;  1XIP A;  2VDN A;  3UR4 A;  2XL2 A;  1GP2 B;  3EI4 B;  4A2L A;  1N6E A;  3JZN A;  2HU7 A;  3IUL A;  4LG8 A;  2P9N C;  3DDU A;  2H47 A;  3N0E A;  2EBS A;  2OVR B;  4QAM A;  3OKT A;  4J8B A;  5IC7 A;  4AN0 A;  5M5S A;  1A0R B;  3IUN A;  4G1M A;  4L3H D;  4ERQ A;  4RE6 A;  2HU8 A;  4IRZ A;  5EAL A;  1GOH A;  1RI6 A;  4A08 A;  1N6F A;  4PBZ A;  4OZU A;  4XYI A;  4JSX C;  1T2X A;  3ZE1 A;  4ERY A;  5C2V B;  1JMX B;  4QT8 A;  3IIY A;  3NVQ A;  2I0S A;  3T3P A;  5AFU 3;  1Q47 A;  4PSX B;  5EML B;  2PM6 B;  2VDP A;  1FWX A;  4CI1 A;  3C75 H;  4Z8L A;  2I3T A;  4WJK A;  1GG2 B;  1UOQ A;  2OJY A;  5GXH A;  4CY1 A;  3KCI A;  2B4E A;  3UVL A;  3MUO A;  2QZP A;  5KDO B;  1MG2 A;  1GOF A;  2IUQ A;  1S4U X;  3PE7 A;  4JT6 C;  3W15 A;  4J84 A;  4QL1 A;  3KRW B;  2HU5 A;  2P9L C;  5TF2 A;  5HE3 B;  5HE1 B;  3RFH A;  5EM2 A;  3JRP A;  4BP9 A;  3PSC B;  2P9I C;  4J86 A;  1VE7 A;  4YVD A;  4JT5 C;  2VZ1 A;  5CXC B;  1JJU B;  3MUN A;  2EIE A;  3F3G A;  5IT9 g;  3J81 g;  2OK4 A;  5SXM A;  3UVN A;  1N6D A;  3OW8 A;  1MDA H;  1O6F A;  4BP8 A;  3RSE C;  4FB1 D;  1VE6 A;  5EAR A;  1OMW B;  3SBQ A;  2GNQ A;  2H14 A;  3AL8 A;  4CY3 A;  4XYH A;  2P9S C;  4H5I A;  3C9C A;  3T3M A;  2HJ4 A;  4AMY A;  1UOO A;  4Z7O A;  4UM8 A;  1QNI A;  5CXC A;  5FQD A;  2CN3 A;  1GXR A;  4BH6 A;  2VDM A;  1PI6 A;  3RMZ D;  4ZOY A;  3EI3 B;  2YNO A;  4JXM A;  3N0D A;  4H5J A;  4Y5R D;  3IVM A;  3MZK A;  5AJA A;  1U2V C;  2AQ5 A;  1L0Q A;  3I89 A;  5FKQ A;  3O4J A;  2H6K A;  4O3U B;  1GOG A;  1JTD B;  3IUR A;  5M5R A;  3EMH A;  4LG9 A;  4JD2 C;  4ZN4 A;  3MZL A;  3SLE D;  5TEF A;  3CIK B;  3SBP A;  3UVK A;  1R5M A;  4LGN A;  2J55 H;  2TRC B;  3AL8 B;  4AMZ A;  3MVD K;  4D6V A;  5H17 A;  3JZG A;  2YBA A;  5FKS A;  1E8M A;  2H13 A;  3JRO A;  2OIZ A;  3UVO A;  2H6N A;  2CN2 A;  2AGL A;  4Y7R A;  2J57 G;  2Q7Q A;  3I7O A;  3OKW A;  5CXB A;  5FA5 B;  4FWW A;  3RN0 D;  3NVX A;  3SJL D;  4J0X A;  2P9P C;  4OWR A;  5EM2 B;  5M5U A;  3FCS A;  5M61 A;  5I5J A;  3I7H A;  5H14 A;  5E6U A;  3DXM C;  3PVW B;  2IAA A;  3IJC A;  2H9L A;  2CO0 A;  5JWZ A;  4AEZ A;  4GM3 A;  3ZDY A;  3NID A;  4GM8 A;  1JV2 A;  1H2Z A;  1SHY B;  3DWL C;  1TYQ C;  4JHN A;  5CXB B;  2BBK H;  4O9D A;  2J56 H;  1C9L A;  4K3I D;  5GXI A;  4N14 A;  4NBM A;  1P22 A;  4E5Z B;  4GZ8 A;  1H2X A;  2I3S A;  3FCU A;  3L4O D;  3BG1 A;  2IWK A;  3QHY B;  2IUP A;  2BKL A;  3RFG A;  3IJ1 A;  4O2W A;  4A08 B;  2PM9 A;  1UTC A;  4PSW B;  1L5G A;  2IWF A;  3RN1 D;  2G99 A;  2AGZ A;  2OVP B;  1QFM A;  1JMZ B;  3ODT A;  3BWS A;  4GQ2 P;  3I2N A;  5FXY A;  5IGQ A;  2YNN A;  4X63 B;  1U4C A;  5FLX g;  3EQ7 A;  3AFC A;  3JPX A;  2HKR A;  3UKU C;  4L1M A;  2CE9 A;  1E8N A;  2QC5 A;  3SMR A;  3UVM A;  3EI4 A;  1BPO A;  2B5N A;  2H9P A;  2GC7 A;  3IKO A;  4ESG A;  1B9X A;  3A0F A;  5C2W B;  4BL0 A;  1YFQ A;  1SQJ A;  5CYK A;  2YNP A;  4PC0 A;  3F3F A;  3K27 A;  3EU7 A;  5IGO A;  4MMZ A;  1JOF A;  4BUJ C;  5FFG A;  2CE8 A;  3BG0 A;  2BCJ B;  5HQG A;  4QRJ A;  3MXX A;  1K32 A;  3V7D B;  5M5V A;  4CI8 A;  4NAA A;  4J77 A;  5GMK n;  1E5T A;  5K19 A;  2MTA H;  3CFV A;  1VZ2 A;  3I7P A;  4G56 B;  4A0B A;  3GD1 I;  3JB9 L;  3PSL A;  1I2M B;  3ZDZ A;  2VDL A;  2Z2O A;  1VZ3 A;  4FHL A;  4J81 A;  4O3T B;  3U4Y A;  2W18 A;  2XL3 A;  4JSN C;  3F3P A;  4Z7N A;  4D9S A;  2AH0 A;  4J87 A;  2EID A;  2YMU A;  2VC2 A;  3I7N A;  4L9O A;  3EI3 A;  4L3G D;  4U1E I;  3SXT D;  4FA5 D;  2WQ8 A;  2CO0 C;  4IMM A;  4MMX A;  3J80 g;  2IUV A;  3K6S A;  1PGU A;  4FA1 D;  2XDW A;  5IJ8 E;  3NVN A;  4WK4 A;  3FRX A;  3MKQ A;  2Z2P A;  2EIC A;  3AH8 B;  2QR5 A;  4GMB A;  3MMY A;  3ZE2 A;  3I7L A;  1C9I A;  2O9K A;  3E0C A;  4GQB B;  5GSA A;  1H2Y A;  4CI2 A;  4BCB A;  2HES X;  4PXW A;  2Z2N A;  3OTT A;  4X61 B;  2OVQ B;  4NSX A;  3AL9 A;  4GM9 A;  4CZV A;  4G55 A;  3V9F A;  2H68 A;  4QQE A;  2P9U C;  3NIG A;  4CC9 A;  5FKR A;  5EAP A;  2H9N A;  3MKS B;  5I5M A;  3EI2 B;  2VDQ A;  3SWS D;  4A11 B;  5EMK B;  3V5W B;  2H9M A;  4DNU A;  4AX4 A;  2EIB A;  4PBY A;  5HE0 B;  2HXC A;  1XKS A;  4PNK B;  4AN1 A;  5K1C C;  4JHP C;  3B7F A;  3FM0 A;  1A12 A;  4UI9 R;  5C92 A;  3OKY A;  4E54 B;  5I5I A;  3PXS D;  3OL2 A;  2AGY A;  2YB8 B;  2HYE A;  2I0R A;  4IA9 A;  3EI1 A;  4DNW A;  2HKM A;  4X3E A;  3OKY B;  4ZOV A; 
#chains in the Genus database with same CATH homology
 3P4F A;  4J78 A;  4AOW A;  4A09 A;  1NEX B;  3SHF A;  3IIW A;  5EAM A;  4J8G A;  3PXT D;  4HDJ A;  4A11 A;  3UKR C;  3EG6 A;  3EI2 A;  3JAM g;  5IJ7 E;  4EWR A;  2P9K C;  4CY5 A;  4ZOZ A;  4J0W A;  4JSV C;  4ERZ A;  3KRX B;  3PXW D;  2AGX A;  3EI1 B;  1B9Y A;  3SN6 B;  1PBY B;  3FGB A;  1SQ9 A;  3DM0 A;  3OL2 B;  3DXK C;  3RLM D;  4E54 A;  2OK6 A;  4MK0 B;  4GGC A;  2PM7 B;  3C5M A;  4GGA A;  1ERJ A;  4ES0 A;  4J73 A;  3GFC A;  5B4W A;  4O1Q D;  4XEI C;  2H6Q A;  4FAN D;  4D0K A;  4K3J B;  2B5M A;  2HJB A;  5A2Q g;  2IUR A;  4KFM B;  1K8K C;  1NR0 A;  3CFS B;  5EMJ B;  4CY2 A;  4O45 A;  4A0A A;  3L4M D;  3K26 A;  3IJ0 A;  3I8E A;  4A2M A;  2XU7 A;  4A0B B;  3EWE A;  4CZY A;  2UZY B;  1GOT B;  2I0T A;  3SFZ A;  4L1Q D;  2PBI B;  4GGD A;  3SBR A;  3VH0 A;  4GQ1 A;  4TZ4 A;  5HYN B;  3DSM A;  3VGZ A;  4FAV D;  2AGW A;  4ZOX A;  5HE2 B;  5THA A;  3JZH A;  1OLZ A;  2QXV A;  1TBG A;  3ULE C;  4A0A B;  3SCY A;  2B5L A;  4J79 A;  1MG3 A;  3HFQ A;  3VA6 A;  1PEV A;  3I7K A;  4JSP C;  2CNX A;  1VYH C;  2GC4 A;  4R7A B;  2XYI A;  3I8C A;  4FA9 D;  5EMM B;  5FKT A;  5AMS A;  2UZX B;  2PM9 B;  4I79 A;  4U7A A;  3C99 A;  4A09 B;  3PVU B;  3ZWL B;  4X60 B;  4A7J A;  3ORV D;  3SVW D;  5H1M A;  2H3X A;  3GRE A;  4E5Z A;  5TDH B;  4CZX A;  2G9A A;  4J82 A;  2AH1 A;  5C9Z B;  5CYK B;  4CI3 A;  1XHM A;  4FA4 D;  3RRM C;  5TEE A;  1XIP A;  3UR4 A;  2XL2 A;  1GP2 B;  3EI4 B;  4A2L A;  1N6E A;  3JZN A;  4LG8 A;  2P9N C;  3N0E A;  2H47 A;  2EBS A;  2OVR B;  3OKT A;  4J8B A;  5IC7 A;  1A0R B;  4L3H D;  4ERQ A;  5EAL A;  1RI6 A;  4A08 A;  1N6F A;  4PBZ A;  4OZU A;  4XYI A;  4JSX C;  4ERY A;  5C2V B;  1JMX B;  4QT8 A;  3IIY A;  3NVQ A;  2I0S A;  5AFU 3;  1Q47 A;  4PSX B;  5EML B;  2PM6 B;  1FWX A;  4CI1 A;  3C75 H;  4Z8L A;  2I3T A;  1GG2 B;  2OJY A;  5GXH A;  4CY1 A;  2B4E A;  3UVL A;  5KDO B;  1MG2 A;  2IUQ A;  1S4U X;  3PE7 A;  4JT6 C;  3W15 A;  4J84 A;  4QL1 A;  3KRW B;  2P9L C;  5TF2 A;  5HE3 B;  5HE1 B;  3RFH A;  5EM2 A;  3JRP A;  3PSC B;  2P9I C;  4J86 A;  4YVD A;  4JT5 C;  5CXC B;  1JJU B;  3F3G A;  5IT9 g;  3J81 g;  2OK4 A;  5SXM A;  3UVN A;  1N6D A;  3OW8 A;  1MDA H;  3RSE C;  4FB1 D;  5EAR A;  1OMW B;  3SBQ A;  2GNQ A;  2H14 A;  3AL8 A;  4CY3 A;  4XYH A;  2P9S C;  4H5I A;  3C9C A;  2HJ4 A;  1QNI A;  5CXC A;  5FQD A;  2CN3 A;  1GXR A;  4BH6 A;  1PI6 A;  3RMZ D;  4ZOY A;  3EI3 B;  2YNO A;  4JXM A;  3N0D A;  4H5J A;  4Y5R D;  3MZK A;  5AJA A;  1U2V C;  2AQ5 A;  1L0Q A;  3I89 A;  5FKQ A;  2H6K A;  4O3U B;  3EMH A;  4LG9 A;  4JD2 C;  4ZN4 A;  3MZL A;  3SLE D;  5TEF A;  3CIK B;  3SBP A;  3UVK A;  1R5M A;  4LGN A;  2J55 H;  2TRC B;  3AL8 B;  4D6V A;  5H17 A;  3JZG A;  2YBA A;  5FKS A;  2H13 A;  3JRO A;  2OIZ A;  3UVO A;  2H6N A;  2CN2 A;  2AGL A;  4Y7R A;  2J57 G;  5CXB A;  2Q7Q A;  3I7O A;  3OKW A;  5FA5 B;  4FWW A;  3RN0 D;  3NVX A;  3SJL D;  4J0X A;  2P9P C;  4OWR A;  5EM2 B;  5I5J A;  3I7H A;  5H14 A;  3DXM C;  3PVW B;  2IAA A;  3IJC A;  2H9L A;  2CO0 A;  5JWZ A;  4AEZ A;  4GM3 A;  4GM8 A;  1SHY B;  3DWL C;  1TYQ C;  5CXB B;  2BBK H;  4O9D A;  2J56 H;  4K3I D;  5GXI A;  4N14 A;  1P22 A;  4E5Z B;  4GZ8 A;  2I3S A;  3L4O D;  3BG1 A;  2IWK A;  2IUP A;  3RFG A;  3IJ1 A;  4A08 B;  2PM9 A;  4PSW B;  2IWF A;  3RN1 D;  2G99 A;  2AGZ A;  2OVP B;  1JMZ B;  3ODT A;  3BWS A;  4GQ2 P;  3I2N A;  5FXY A;  5IGQ A;  2YNN A;  4X63 B;  1U4C A;  5FLX g;  3AFC A;  3JPX A;  2HKR A;  3UKU C;  2CE9 A;  2QC5 A;  3SMR A;  3UVM A;  3EI4 A;  2B5N A;  2H9P A;  2GC7 A;  3IKO A;  4ESG A;  1B9X A;  3A0F A;  5C2W B;  4BL0 A;  1YFQ A;  1SQJ A;  5CYK A;  2YNP A;  4PC0 A;  3F3F A;  3K27 A;  3EU7 A;  5IGO A;  1JOF A;  4BUJ C;  2CE8 A;  3BG0 A;  2BCJ B;  5HQG A;  4QRJ A;  3MXX A;  1K32 A;  3V7D B;  4CI8 A;  4J77 A;  5GMK n;  5K19 A;  2MTA H;  3CFV A;  3I7P A;  4G56 B;  4A0B A;  3JB9 L;  3PSL A;  2Z2O A;  4FHL A;  4J81 A;  4O3T B;  3U4Y A;  2W18 A;  2XL3 A;  4JSN C;  3F3P A;  2AH0 A;  4J87 A;  2YMU A;  3I7N A;  4L9O A;  3EI3 A;  4L3G D;  4U1E I;  3SXT D;  4FA5 D;  2CO0 C;  4IMM A;  3J80 g;  2IUV A;  1PGU A;  4FA1 D;  5IJ8 E;  3NVN A;  3FRX A;  3MKQ A;  2Z2P A;  3AH8 B;  4GMB A;  3MMY A;  3I7L A;  2O9K A;  3E0C A;  4GQB B;  5GSA A;  4CI2 A;  2HES X;  4PXW A;  2Z2N A;  3OTT A;  4X61 B;  2OVQ B;  4NSX A;  3AL9 A;  4GM9 A;  4CZV A;  3V9F A;  2H68 A;  4QQE A;  2P9U C;  4CC9 A;  5FKR A;  5EAP A;  2H9N A;  3MKS B;  5I5M A;  3EI2 B;  3SWS D;  4A11 B;  5EMK B;  3V5W B;  2H9M A;  4PBY A;  5HE0 B;  2HXC A;  1XKS A;  4PNK B;  5K1C C;  3B7F A;  3FM0 A;  4UI9 R;  3OKY A;  4E54 B;  5I5I A;  3PXS D;  3OL2 A;  2AGY A;  2YB8 B;  2HYE A;  2I0R A;  4IA9 A;  3EI1 A;  2HKM A;  4X3E A;  3OKY B;  4ZOV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...