3ODTA

Crystal structure of wd40 beta propeller domain of doa1
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
297
structure length
296
Chain Sequence
FTGYQLSATLKGHDQDVRDVVAVDDSKVASVSRDGTVRLWSKDDQWLGTVVYTGQGFLNSVCYDSEKELLLFGGKDTMINGVPLFATSGEDPYTLIGHQGNVCSLSFQDGVVISGSWDKTAKVWKEGSLVYNLQAHNASVWDAKVVSFSENKFLTASADKTIKLWQNDKVIKTFSGIHNDVVRHLAVVDDGHFISCSNDGLIKLVDMHTGDVLRTYEGHESFVYCIKLLPNGDIVSCGEDRTVRIWSKENGSLKQVITLPAISIWSVDCMSNGDIIVGSSDNLVRIFSQEKSRWAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title WD40 Repeat Propellers Define a Ubiquitin-Binding Domain that Regulates Turnover of F Box Proteins.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Nuclear protein
molecule keywords Protein DOA1
total genus 84
structure length 296
sequence length 297
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3odtA00
1SHYB 2YMUA 5GSAA 4L3GD 3F3GA 2P9UC 5I5JA 3OKYA 5EAMA 4E54B 5TDHB 3UVKA 4FA4D 4I79A 4J82A 5FKSA 2I0TA 5EM2A 3FRXA 2PM6B 3SBPA 1OMWB 5C2VB 3IIWA 5IC7A 4GZ8A 4J0WA 4PSWB 1GOTB 3CIKB 3SBRA 4TZ4A 4ZN4A 2IWFA 2AQ5A 2H9LA 2I0SA 2IWKA 4JSNC 4A2MA 4ZOZA 4A2LA 3J80g 4N14A 5HE2B 4QL1A 4A7JA 4CZVA 3HFQA 1N6FA 1Q47A 5SXMA 3EWEA 2J55H 3VA6A 5HQGA 2XU7A 4E5ZB 2HESX 5AFU3 4JT6C 3JZNA 3I8CA 4J87A 1R5MA 3ULEC 3BG1A 2YB8B 4JXMA 2UZYB 4GM8A 4X61B 4A08B 3EI3B 3JZGA 3NVQA 4GGCA 4IMMA 1FWXA 3UKUC 4QRJA 1U4CA 5K19A 3PXWD 4PXWA 2B4EA 2P9SC 3NVXA 4LG8A 2AGLA 4FHLA 3FM0A 4BUJC 1JOFA 4CI3A 2IUVA 3EI4A 3ZWLB 4A0BA 2H6NA 4CY5A 4JSXC 4A08A 3DM0A 4GGDA 4FA1D 3PVWB 3SLED 4KFMB 1ERJA 2H13A 3I7PA 5C2WB 2H14A 1JMXB 4E5ZA 3N0DA 5AJAA 4GMBA 1N6DA 4Y5RD 3K27A 4HDJA 4L1QD 3SN6B 3DXKC 3JPXA 4JT5C 2TRCB 5EMJB 3MXXA 3IIYA 4L3HD 3OKTA 5GXIA 4OZUA 1P22A 3OW8A 4ERZA 3EG6A 4ZOYA 4Y7RA 3DSMA 2O9KA 1SQJA 5I5MA 4GQ1A 3SVWD 1GG2B 2XL3A 4J84A 3I7KA 1NR0A 3IJCA 3L4OD 2B5LA 2J57G 4J78A 2HKMA 5AMSA 1OLZA 3OKWA 5EM2B 3MKQA 4U7AA 5I5IA 2CNXA 2AH1A 2EBSA 4Z8LA 2AGWA 5FLXg 4J81A 3I7HA 3EI4B 5CXCB 2CE9A 2QC5A 4ERQA 4K3ID 3AL8A 5CYKB 2J56H 1GXRA 3IJ1A 5EMKB 2Q7QA 3MMYA 4A11B 2P9PC 2IURA 5EALA 2OIZA 4ESGA 4GQ2P 2CE8A 4A09B 2GNQA 2PM9A 2BCJB 1K8KC 2H47A 3MZLA 1MG3A 4O3UB 5IT9g 3UVOA 2G9AA 3KRWB 4QT8A 1TBGA 3OL2A 2OK4A 4AOWA 3I89A 4J77A 2CO0A 3AFCA 4CY1A 2PM7B 3MKSB 4D6VA 2HKRA 2YBAA 3C75H 4L9OA 5GXHA 1XHMA 2HYEA 3UVLA 4FAND 4CC9A 4A0AA 1QNIA 2XYIA 3ORVD 4ERYA 1MG2A 3RMZD 5K1CC 3EI2B 4BH6A 4LGNA 3BWSA 4J0XA 2YNNA 4XYHA 2CN2A 5EMLB 2P9IC 5HYNB 3W15A 4CI2A 4GQBB 3SMRA 2CN3A 4J8GA 2IUQA 3U4YA 4X60B 3RN0D 1JMZB 3C9CA 3EI1A 4FA9D 5IGOA 3DWLC 3F3PA 4OWRA 5CXBB 2H3XA 4CZXA 3RLMD 3JROA 4EWRA 3SJLD 4R7AB 1MDAH 3JAMg 1L0QA 2P9NC 2AGYA 3SBQA 3V5WB 5JWZA 4JSPC 2PM9B 5TF2A 1S4UX 4A09A 4O3TB 4FAVD 3AH8B 2AGZA 1PBYB 2YNPA 5H1MA 2H9MA 2IAAA 3RRMC 2YNOA 2H6KA 3PSLA 5H17A 3V9FA 4CY2A 5IJ8E 4CZYA 5GMKn 3BG0A 4H5IA 3PXSD 3C5MA 4NSXA 4PSXB 5FKQA 5FXYA 2H6QA 2Z2NA 3IKOA 4O1QD 2HJ4A 3DXMC 3I7OA 2XL2A 3K26A 3JZHA 3UVMA 4O45A 2I3TA 5THAA 4G56B 3SWSD 3PSCB 2P9LC 3RFHA 3SXTD 2GC4A 4ES0A 2BBKH 3P4FA 5B4WA 5EAPA 4IA9A 2OVRB 1K32A 4UI9R 3SHFA 1SQ9A 4ZOXA 4J79A 2OVPB 3PXTD 4AEZA 4YVDA 2B5NA 3IJ0A 2OK6A 3V7DB 2AGXA 3JRPA 3CFSB 3SCYA 5EARA 3VH0A 2HJBA 5FKRA 3EMHA 3N0EA 4XEIC 4QQEA 5KDOB 1YFQA 2OVQB 1PEVA 4FB1D 3EU7A 3J81g 4FWWA 5FA5B 3SFZA 3UR4A 4A0BB 1RI6A 4J8BA 4BL0A 4X3EA 3GFCA 2QXVA 3UKRC 4XYIA 3RN1D 4JD2C 3A0FA 5A2Qg 2PBIB 3KRXB 2MTAH 1VYHC 3VGZA 2H68A 2P9KC 2G99A 1N6EA 1A0RB 3EI3A 4H5JA 5CXBA 5H14A 3EI1B 2GC7A 3I2NA 5HE3B 3L4MD 3I7NA 3RSEC 1PI6A 1NEXB 2IUPA 2OJYA 4X63B 5HE1B 5IGQA 2B5MA 3I7LA 4GM9A 5TEEA 3PVUB 2HXCA 1B9YA 3NVNA 4GM3A 5C9ZB 2UZXB 5IJ7E 4CI1A 1PGUA 4O9DA 1XIPA 3RFGA 3EI2A 4J73A 4J86A 4A0AB 4K3JB 2AH0A 2I0RA 5EMMB 4PBZA 2W18A 3B7FA 2H9NA 3FGBA 4PNKB 2H9PA 5FKTA 1GP2B 3OTTA 3OL2B 5FQDA 4CI8A 3ODTA 4PBYA 4D0KA 4U1EI 4GGAA 4E54A 3OKYB 5HE0B 3CFVA 4ZOVA 1XKSA 2Z2OA 3UVNA 4PC0A 3AL9A 3F3FA 3PE7A 4A11A 2CO0C 4MK0B 4CY3A 4FA5D 1TYQC 3MZKA 3JB9L 5CYKA 3GREA 3AL8B 1B9XA 2I3SA 3E0CA 1JJUB 1U2VC 4JSVC 3I8EA 5CXCA 5TEFA 3C99A 2Z2PA 4LG9A
chains in the Genus database with same CATH superfamily
1SHYB 2YMUA 4O2WA 5GSAA 4L3GD 2VDQA 3F3GA 3IUMA 2P9UC 2VZ1A 3IUJA 5I5JA 3OKYA 5EAMA 3EQ9A 4E54B 5TDHB 3UVKA 4FA4D 4I79A 4J82A 5FKSA 4JHNA 2I0TA 5EM2A 3FRXA 2EICA 2PM6B 2VDKA 1M1XA 3SBPA 1OMWB 5TEFA 5C2VB 3IIWA 5IC7A 4GZ8A 4J0WA 4PSWB 5E6UA 1GOTB 3CIKB 3SBRA 4DNVA 4TZ4A 4ZN4A 2IWFA 3V4PA 2AQ5A 2H9LA 2I0SA 2IWKA 4JSNC 4A2MA 4ZOZA 2XZGA 4A2LA 3GC3B 3J80g 4N14A 5HE2B 2XE4A 3K72A 4QL1A 4A7JA 4CZVA 3HFQA 1N6FA 5CXCA 1Q47A 3NIFA 5SXMA 3EWEA 2J55H 3VA6A 3NIGA 5HQGA 3O4JA 2XU7A 4E5ZB 2HESX 4MMZA 5AFU3 4JT6C 3JZNA 3I8CA 4J87A 1R5MA 3ULEC 3BG1A 2YB8B 4JXMA 2UZYB 4GM8A 4X61B 4A08B 3EI3B 2VDMA 3JZGA 3NVQA 4GGCA 4IMMA 1FWXA 3UKUC 1UOOA 4QRJA 1U4CA 4AMZA 5K19A 3PXWD 4PXWA 1U8CA 2B4EA 2P9SC 3NVXA 4LG8A 3KCIA 4G55A 2AGLA 4FHLA 3FM0A 4BUJC 1JOFA 4CI3A 2IUVA 1QFSA 3T3PA 3ZWLB 4A0BA 2H6NA 1VE6A 4CY5A 4Z7QA 4JSXC 4A08A 3DM0A 4GGDA 4FA1D 3QI0A 3PVWB 3SLED 4KFMB 1H2WA 2QZPA 3ZE2A 1ERJA 2H13A 3I7PA 3IULA 5C2WB 2H14A 1JMXB 4E5ZA 3N0DA 5AJAA 4GMBA 1N6DA 4Y5RD 3K27A 4HDJA 4L1QD 3SN6B 3DXKC 3JPXA 4JT5C 2JKXA 2TRCB 1VZ3A 5EMJB 3MXXA 3IIYA 3MVDK 4L3HD 3OKTA 5GXIA 4OZUA 1P22A 3OW8A 4ERZA 1TYEA 3EG6A 2VDPA 4ZOYA 3IURA 4Y7RA 3DSMA 1JTDB 2O9KA 1SQJA 5I5MA 4GQ1A 3SVWD 1GG2B 2XL3A 4J84A 3I7KA 1NR0A 3IJCA 3L4OD 2B5LA 2J57G 4J78A 2HKMA 5AMSA 4BP9A 1OLZA 3OKWA 5EM2B 3O4IA 3MKQA 1I2MB 4U7AA 5I5IA 1GOFA 2CNXA 2AH1A 2EBSA 4Z8LA 1GOHA 4AN0A 2AGWA 4AMYA 5FLXg 4J81A 3I7HA 3EI4B 5CXCB 2CE9A 2QC5A 4ERQA 4K3ID 3AL8A 5CYKB 4RE5A 4WK4A 2J56H 1GXRA 3IJ1A 5EMKB 2Q7QA 3MMYA 4A11B 2P9PC 2IURA 5EALA 2OIZA 2VDOA 4ESGA 4GQ2P 2CE8A 4A09B 2VDLA 2GNQA 3K71A 2PM9A 2VC2A 1T2XA 2BCJB 1UTCA 1K8KC 2H47A 3MZLA 1MG3A 4O3UB 5IT9g 3UVOA 2G9AA 3KRWB 4QT8A 1TBGA 3OL2A 2OK4A 5FFGA 4AOWA 3I89A 1C9LA 4J77A 2CO0A 3AFCA 4CY1A 2PM7B 1VE7A 3MKSB 4NBMA 4RE6A 4D6VA 2HKRA 2YBAA 3C75H 4L9OA 5GXHA 1XHMA 3GD1I 2HYEA 1O6FA 3UVLA 5E6SA 4FAND 4CC9A 2QR5A 4A0AA 1QNIA 2XYIA 3ORVD 4ERYA 1MG2A 3QHYB 4UM9A 3RMZD 5K1CC 3ZDXA 3EI2B 2VZ3A 4BH6A 4LGNA 3BWSA 4J0XA 2YNNA 4XYHA 2CN2A 5EMLB 4Z7NA 2P9IC 5HYNB 3W15A 4CI2A 4GQBB 5M5TA 3SMRA 4BCDA 1YR2A 2CN3A 4J8GA 2IUQA 5M61A 3U4YA 4NENA 4BCCA 4X60B 3RN0D 1H2ZA 1JMZB 3C9CA 3VI4A 3EI1A 4FA9D 5IGOA 3DWLC 3F3PA 2BKLA 4OWRA 2HU8A 2H3XA 5CXBB 3RLMD 3FCUA 4CZXA 3JROA 4EWRA 3SJLD 5M5RA 2EIDA 4R7AB 1MDAH 3JAMg 1L0QA 2P9NC 2AGYA 3SBQA 3V5WB 5JWZA 4JSPC 2PM9B 5TF2A 1S4UX 4A09A 4O3TB 4FAVD 3AH8B 2AGZA 1PBYB 3MUNA 3K6SA 3DDUA 2YNPA 5H1MA 2H9MA 5FFOA 3FCSA 2IAAA 3RRMC 2YNOA 2H6KA 3PSLA 5H17A 3V9FA 1C9IA 4CY2A 5IJ8E 4CZYA 3OF7A 5GMKn 3BG0A 1GOGA 2EIEA 4H5IA 3PXSD 3C5MA 4NSXA 4PSXB 5FKQA 5FXYA 2H6QA 2Z2NA 3IKOA 4O1QD 3ZDZA 2HJ4A 4AN1A 3DXMC 3I7OA 2XL2A 3K26A 2XDWA 3JZHA 4O45A 1QFMA 2I3TA 3UVMA 4BCBA 5THAA 4G56B 3SWSD 3PSCB 2P9LC 3RFHA 3SXTD 2GC4A 4ES0A 1UOPA 2BBKH 4DNWA 3P4FA 5B4WA 5EAPA 4IA9A 2OVRB 1K32A 4UI9R 3EQ8A 3SHFA 5C86A 1SQ9A 4O02A 4ZOXA 4J79A 2OVPB 3PXTD 4AEZA 2WQ8A 4YVDA 2B5NA 3IJ0A 3V4VA 1H2XA 4WJKA 2OK6A 3V7DB 2AGXA 3JRPA 3CFSB 3SCYA 5EARA 3VH0A 2HJBA 5FKRA 3EMHA 4AX4A 3N0EA 4NAAA 4XEIC 4QQEA 1E5TA 5KDOB 1YFQA 4NC4A 2OVQB 1PEVA 4FB1D 3EU7A 3J81g 4FWWA 5FA5B 4WK0A 3SFZA 2VDRA 1E8NA 3O4GA 3UR4A 4A0BB 1RI6A 4J8BA 4BL0A 1VZ2A 4X3EA 3ZE0A 3GFCA 2QXVA 3UKRC 4XYIA 3RN1D 4JD2C 3A0FA 5A2Qg 2PBIB 3O4HA 4L1MA 2VDNA 3KRXB 2MTAH 1VYHC 3VGZA 5M5SA 2H68A 2EIBA 3ZDYA 1K3IA 2P9KC 4G1EA 1L5GA 2G99A 1N6EA 1A0RB 3EI3A 4H5JA 5CXBA 3T3MA 5H14A 3EI1B 5M5UA 2GC7A 3I2NA 5HE3B 3L4MD 1UOQA 4G1MA 3I7NA 3RSEC 1PI6A 4MMYA 1NEXB 2IUPA 2OJYA 4X63B 5HE1B 5IGQA 2B5MA 3I7LA 4D9SA 4GM9A 5TEEA 3PVUB 2HXCA 5E6RA 4MMXA 1B9YA 3NVNA 4GM3A 5C9ZB 2UZXB 5IJ7E 4CI1A 1PGUA 4O9DA 1XIPA 3RFGA 4IRZA 3EI2A 5C92A 4J73A 3IUNA 4J86A 4JHPC 4A0AB 4K3JB 2AH0A 2I0RA 3MUOA 2HU5A 4PBZA 5EMMB 2W18A 4Z7OA 1A12A 3B7FA 2H9NA 3FGBA 1BPOA 4PNKB 1JV2A 2H9PA 5FKTA 1GP2B 3OTTA 5M5VA 3OL2B 4UM8A 4QAMA 5FQDA 4CI8A 3ODTA 4PBYA 4D0KA 4U1EI 1E8MA 3IUQA 3ZE1A 4BP8A 4GGAA 4E54A 3IJEA 3IVMA 3OKYB 5HE0B 4DNUA 3CFVA 4ZOVA 1XKSA 2Z2OA 3UVNA 4PC0A 3AL9A 3F3FA 3PE7A 4WK2A 3VI3A 4A11A 3EQ7A 2CO0C 3NIDA 4MK0B 4CY3A 4FA5D 1TYQC 3MZKA 3JB9L 5CYKA 3GREA 1H2YA 3AL8B 1B9XA 2HU7A 2I3SA 1JJUB 1U2VC 3E0CA 4JSVC 3I8EA 1O6GA 3EI4A 5HDBA 3C99A 2Z2PA 4LG9A
chains in the Genus database with same CATH topology
1SHYB 2YMUA 5GSAA 4L3GD 3F3GA 2P9UC 5I5JA 3OKYA 5EAMA 4E54B 5TDHB 3UVKA 4FA4D 4I79A 4J82A 5FKSA 2I0TA 5EM2A 3FRXA 2PM6B 3SBPA 1OMWB 5C2VB 3IIWA 5IC7A 4GZ8A 4J0WA 4PSWB 1GOTB 3CIKB 3SBRA 4TZ4A 4ZN4A 2IWFA 2AQ5A 2H9LA 2I0SA 2IWKA 4JSNC 4A2MA 4ZOZA 4A2LA 3J80g 4N14A 5HE2B 4QL1A 4A7JA 4CZVA 3HFQA 1N6FA 1Q47A 5SXMA 3EWEA 2J55H 3VA6A 5HQGA 2XU7A 4E5ZB 2HESX 5AFU3 4JT6C 3JZNA 3I8CA 4J87A 1R5MA 3ULEC 3BG1A 2YB8B 4JXMA 2UZYB 4GM8A 4X61B 4A08B 3EI3B 3JZGA 3NVQA 4GGCA 4IMMA 1FWXA 3UKUC 4QRJA 1U4CA 5K19A 3PXWD 4PXWA 2B4EA 2P9SC 3NVXA 4LG8A 2AGLA 4FHLA 3FM0A 4BUJC 1JOFA 4CI3A 2IUVA 3EI4A 3ZWLB 4A0BA 2H6NA 4CY5A 4JSXC 4A08A 3DM0A 4GGDA 4FA1D 3PVWB 3SLED 4KFMB 1ERJA 2H13A 3I7PA 5C2WB 2H14A 1JMXB 4E5ZA 3N0DA 5AJAA 4GMBA 1N6DA 4Y5RD 3K27A 4HDJA 4L1QD 3SN6B 3DXKC 3JPXA 4JT5C 2TRCB 5EMJB 3MXXA 3IIYA 4L3HD 3OKTA 5GXIA 4OZUA 1P22A 3OW8A 4ERZA 3EG6A 4ZOYA 4Y7RA 3DSMA 2O9KA 1SQJA 5I5MA 4GQ1A 3SVWD 1GG2B 2XL3A 4J84A 3I7KA 1NR0A 3IJCA 3L4OD 2B5LA 2J57G 4J78A 2HKMA 5AMSA 1OLZA 3OKWA 5EM2B 3MKQA 4U7AA 5I5IA 2CNXA 2AH1A 2EBSA 4Z8LA 2AGWA 5FLXg 4J81A 3I7HA 3EI4B 5CXCB 2CE9A 2QC5A 4ERQA 4K3ID 3AL8A 5CYKB 2J56H 1GXRA 3IJ1A 5EMKB 2Q7QA 3MMYA 4A11B 2P9PC 2IURA 5EALA 2OIZA 4ESGA 4GQ2P 2CE8A 4A09B 2GNQA 2PM9A 2BCJB 1K8KC 2H47A 3MZLA 1MG3A 4O3UB 5IT9g 3UVOA 2G9AA 3KRWB 4QT8A 1TBGA 3OL2A 2OK4A 4AOWA 3I89A 4J77A 2CO0A 3AFCA 4CY1A 2PM7B 3MKSB 4D6VA 2HKRA 2YBAA 3C75H 4L9OA 5GXHA 1XHMA 2HYEA 3UVLA 4FAND 4CC9A 4A0AA 1QNIA 2XYIA 3ORVD 4ERYA 1MG2A 3RMZD 5K1CC 3EI2B 4BH6A 4LGNA 3BWSA 4J0XA 2YNNA 4XYHA 2CN2A 5EMLB 2P9IC 5HYNB 3W15A 4CI2A 4GQBB 3SMRA 2CN3A 4J8GA 2IUQA 3U4YA 4X60B 3RN0D 1JMZB 3C9CA 3EI1A 4FA9D 5IGOA 3DWLC 3F3PA 4OWRA 5CXBB 2H3XA 4CZXA 3RLMD 3JROA 4EWRA 3SJLD 4R7AB 1MDAH 3JAMg 1L0QA 2P9NC 2AGYA 3SBQA 3V5WB 5JWZA 4JSPC 2PM9B 5TF2A 1S4UX 4A09A 4O3TB 4FAVD 3AH8B 2AGZA 1PBYB 2YNPA 5H1MA 2H9MA 2IAAA 3RRMC 2YNOA 2H6KA 3PSLA 5H17A 3V9FA 4CY2A 5IJ8E 4CZYA 5GMKn 3BG0A 4H5IA 3PXSD 3C5MA 4NSXA 4PSXB 5FKQA 5FXYA 2H6QA 2Z2NA 3IKOA 4O1QD 2HJ4A 3DXMC 3I7OA 2XL2A 3K26A 3JZHA 3UVMA 4O45A 2I3TA 5THAA 4G56B 3SWSD 3PSCB 2P9LC 3RFHA 3SXTD 2GC4A 4ES0A 2BBKH 3P4FA 5B4WA 5EAPA 4IA9A 2OVRB 1K32A 4UI9R 3SHFA 1SQ9A 4ZOXA 4J79A 2OVPB 3PXTD 4AEZA 4YVDA 2B5NA 3IJ0A 2OK6A 3V7DB 2AGXA 3JRPA 3CFSB 3SCYA 5EARA 3VH0A 2HJBA 5FKRA 3EMHA 3N0EA 4XEIC 4QQEA 5KDOB 1YFQA 2OVQB 1PEVA 4FB1D 3EU7A 3J81g 4FWWA 5FA5B 3SFZA 3UR4A 4A0BB 1RI6A 4J8BA 4BL0A 4X3EA 3GFCA 2QXVA 3UKRC 4XYIA 3RN1D 4JD2C 3A0FA 5A2Qg 2PBIB 3KRXB 2MTAH 1VYHC 3VGZA 2H68A 2P9KC 2G99A 1N6EA 1A0RB 3EI3A 4H5JA 5CXBA 5H14A 3EI1B 2GC7A 3I2NA 5HE3B 3L4MD 3I7NA 3RSEC 1PI6A 1NEXB 2IUPA 2OJYA 4X63B 5HE1B 5IGQA 2B5MA 3I7LA 4GM9A 5TEEA 3PVUB 2HXCA 1B9YA 3NVNA 4GM3A 5C9ZB 2UZXB 5IJ7E 4CI1A 1PGUA 4O9DA 1XIPA 3RFGA 3EI2A 4J73A 4J86A 4A0AB 4K3JB 2AH0A 2I0RA 5EMMB 4PBZA 2W18A 3B7FA 2H9NA 3FGBA 4PNKB 2H9PA 5FKTA 1GP2B 3OTTA 3OL2B 5FQDA 4CI8A 3ODTA 4PBYA 4D0KA 4U1EI 4GGAA 4E54A 3OKYB 5HE0B 3CFVA 4ZOVA 1XKSA 2Z2OA 3UVNA 4PC0A 3AL9A 3F3FA 3PE7A 4A11A 2CO0C 4MK0B 4CY3A 4FA5D 1TYQC 3MZKA 3JB9L 5CYKA 3GREA 3AL8B 1B9XA 2I3SA 3E0CA 1JJUB 1U2VC 4JSVC 3I8EA 5CXCA 5TEFA 3C99A 2Z2PA 4LG9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SHY B;  2YMU A;  5GSA A;  4L3G D;  3F3G A;  2P9U C;  5I5J A;  3OKY A;  5EAM A;  4E54 B;  5TDH B;  3UVK A;  4FA4 D;  4I79 A;  4J82 A;  5FKS A;  2I0T A;  5EM2 A;  3FRX A;  2PM6 B;  3SBP A;  1OMW B;  5C2V B;  3IIW A;  5IC7 A;  4GZ8 A;  4J0W A;  4PSW B;  1GOT B;  3CIK B;  3SBR A;  4TZ4 A;  4ZN4 A;  2IWF A;  2AQ5 A;  2H9L A;  2I0S A;  2IWK A;  4JSN C;  4A2M A;  4ZOZ A;  4A2L A;  3J80 g;  4N14 A;  5HE2 B;  4QL1 A;  4A7J A;  4CZV A;  3HFQ A;  1N6F A;  1Q47 A;  5SXM A;  3EWE A;  2J55 H;  3VA6 A;  5HQG A;  2XU7 A;  4E5Z B;  2HES X;  5AFU 3;  4JT6 C;  3JZN A;  3I8C A;  4J87 A;  1R5M A;  3ULE C;  3BG1 A;  2YB8 B;  4JXM A;  2UZY B;  4GM8 A;  4X61 B;  4A08 B;  3EI3 B;  3JZG A;  3NVQ A;  4GGC A;  4IMM A;  1FWX A;  3UKU C;  4QRJ A;  1U4C A;  5K19 A;  3PXW D;  4PXW A;  2B4E A;  2P9S C;  3NVX A;  4LG8 A;  2AGL A;  4FHL A;  3FM0 A;  4BUJ C;  1JOF A;  4CI3 A;  2IUV A;  3EI4 A;  3ZWL B;  4A0B A;  2H6N A;  4CY5 A;  4JSX C;  4A08 A;  3DM0 A;  4GGD A;  4FA1 D;  3PVW B;  3SLE D;  4KFM B;  1ERJ A;  2H13 A;  3I7P A;  5C2W B;  2H14 A;  1JMX B;  4E5Z A;  3N0D A;  5AJA A;  4GMB A;  1N6D A;  4Y5R D;  3K27 A;  4HDJ A;  4L1Q D;  3SN6 B;  3DXK C;  3JPX A;  4JT5 C;  2TRC B;  5EMJ B;  3MXX A;  3IIY A;  4L3H D;  3OKT A;  5GXI A;  4OZU A;  1P22 A;  3OW8 A;  4ERZ A;  3EG6 A;  4ZOY A;  4Y7R A;  3DSM A;  2O9K A;  1SQJ A;  5I5M A;  4GQ1 A;  3SVW D;  1GG2 B;  2XL3 A;  4J84 A;  3I7K A;  1NR0 A;  3IJC A;  3L4O D;  2B5L A;  2J57 G;  4J78 A;  2HKM A;  5AMS A;  1OLZ A;  3OKW A;  5EM2 B;  3MKQ A;  4U7A A;  5I5I A;  2CNX A;  2AH1 A;  2EBS A;  4Z8L A;  2AGW A;  5FLX g;  4J81 A;  3I7H A;  3EI4 B;  5CXC B;  2CE9 A;  2QC5 A;  4ERQ A;  4K3I D;  3AL8 A;  5CYK B;  2J56 H;  1GXR A;  3IJ1 A;  5EMK B;  2Q7Q A;  3MMY A;  4A11 B;  2P9P C;  2IUR A;  5EAL A;  2OIZ A;  4ESG A;  4GQ2 P;  2CE8 A;  4A09 B;  2GNQ A;  2PM9 A;  2BCJ B;  1K8K C;  2H47 A;  3MZL A;  1MG3 A;  4O3U B;  5IT9 g;  3UVO A;  2G9A A;  3KRW B;  4QT8 A;  1TBG A;  3OL2 A;  2OK4 A;  4AOW A;  3I89 A;  4J77 A;  2CO0 A;  3AFC A;  4CY1 A;  2PM7 B;  3MKS B;  4D6V A;  2HKR A;  2YBA A;  3C75 H;  4L9O A;  5GXH A;  1XHM A;  2HYE A;  3UVL A;  4FAN D;  4CC9 A;  4A0A A;  1QNI A;  2XYI A;  3ORV D;  4ERY A;  1MG2 A;  3RMZ D;  5K1C C;  3EI2 B;  4BH6 A;  4LGN A;  3BWS A;  4J0X A;  2YNN A;  4XYH A;  2CN2 A;  5EML B;  2P9I C;  5HYN B;  3W15 A;  4CI2 A;  4GQB B;  3SMR A;  2CN3 A;  4J8G A;  2IUQ A;  3U4Y A;  4X60 B;  3RN0 D;  1JMZ B;  3C9C A;  3EI1 A;  4FA9 D;  5IGO A;  3DWL C;  3F3P A;  4OWR A;  5CXB B;  2H3X A;  4CZX A;  3RLM D;  3JRO A;  4EWR A;  3SJL D;  4R7A B;  1MDA H;  3JAM g;  1L0Q A;  2P9N C;  2AGY A;  3SBQ A;  3V5W B;  5JWZ A;  4JSP C;  2PM9 B;  5TF2 A;  1S4U X;  4A09 A;  4O3T B;  4FAV D;  3AH8 B;  2AGZ A;  1PBY B;  2YNP A;  5H1M A;  2H9M A;  2IAA A;  3RRM C;  2YNO A;  2H6K A;  3PSL A;  5H17 A;  3V9F A;  4CY2 A;  5IJ8 E;  4CZY A;  5GMK n;  3BG0 A;  4H5I A;  3PXS D;  3C5M A;  4NSX A;  4PSX B;  5FKQ A;  5FXY A;  2H6Q A;  2Z2N A;  3IKO A;  4O1Q D;  2HJ4 A;  3DXM C;  3I7O A;  2XL2 A;  3K26 A;  3JZH A;  3UVM A;  4O45 A;  2I3T A;  5THA A;  4G56 B;  3SWS D;  3PSC B;  2P9L C;  3RFH A;  3SXT D;  2GC4 A;  4ES0 A;  2BBK H;  3P4F A;  5B4W A;  5EAP A;  4IA9 A;  2OVR B;  1K32 A;  4UI9 R;  3SHF A;  1SQ9 A;  4ZOX A;  4J79 A;  2OVP B;  3PXT D;  4AEZ A;  4YVD A;  2B5N A;  3IJ0 A;  2OK6 A;  3V7D B;  2AGX A;  3JRP A;  3CFS B;  3SCY A;  5EAR A;  3VH0 A;  2HJB A;  5FKR A;  3EMH A;  3N0E A;  4XEI C;  4QQE A;  5KDO B;  1YFQ A;  2OVQ B;  1PEV A;  4FB1 D;  3EU7 A;  3J81 g;  4FWW A;  5FA5 B;  3SFZ A;  3UR4 A;  4A0B B;  1RI6 A;  4J8B A;  4BL0 A;  4X3E A;  3GFC A;  2QXV A;  3UKR C;  4XYI A;  3RN1 D;  4JD2 C;  3A0F A;  5A2Q g;  2PBI B;  3KRX B;  2MTA H;  1VYH C;  3VGZ A;  2H68 A;  2P9K C;  2G99 A;  1N6E A;  1A0R B;  3EI3 A;  4H5J A;  5CXB A;  5H14 A;  3EI1 B;  2GC7 A;  3I2N A;  5HE3 B;  3L4M D;  3I7N A;  3RSE C;  1PI6 A;  1NEX B;  2IUP A;  2OJY A;  4X63 B;  5HE1 B;  5IGQ A;  2B5M A;  3I7L A;  4GM9 A;  5TEE A;  3PVU B;  2HXC A;  1B9Y A;  3NVN A;  4GM3 A;  5C9Z B;  2UZX B;  5IJ7 E;  4CI1 A;  1PGU A;  4O9D A;  1XIP A;  3RFG A;  3EI2 A;  4J73 A;  4J86 A;  4A0A B;  4K3J B;  2AH0 A;  2I0R A;  5EMM B;  4PBZ A;  2W18 A;  3B7F A;  2H9N A;  3FGB A;  4PNK B;  2H9P A;  5FKT A;  1GP2 B;  3OTT A;  3OL2 B;  5FQD A;  4CI8 A;  3ODT A;  4PBY A;  4D0K A;  4U1E I;  4GGA A;  4E54 A;  3OKY B;  5HE0 B;  3CFV A;  4ZOV A;  1XKS A;  2Z2O A;  3UVN A;  4PC0 A;  3AL9 A;  3F3F A;  3PE7 A;  4A11 A;  2CO0 C;  4MK0 B;  4CY3 A;  4FA5 D;  1TYQ C;  3MZK A;  3JB9 L;  5CYK A;  3GRE A;  3AL8 B;  1B9X A;  2I3S A;  3E0C A;  1JJU B;  1U2V C;  4JSV C;  3I8E A;  5CXC A;  5TEF A;  3C99 A;  2Z2P A;  4LG9 A; 
#chains in the Genus database with same CATH topology
 1SHY B;  2YMU A;  4O2W A;  5GSA A;  4L3G D;  2VDQ A;  3F3G A;  3IUM A;  2P9U C;  2VZ1 A;  3IUJ A;  5I5J A;  3OKY A;  5EAM A;  3EQ9 A;  4E54 B;  5TDH B;  3UVK A;  4FA4 D;  4I79 A;  4J82 A;  5FKS A;  4JHN A;  2I0T A;  5EM2 A;  3FRX A;  2EIC A;  2PM6 B;  2VDK A;  1M1X A;  3SBP A;  1OMW B;  5TEF A;  5C2V B;  3IIW A;  5IC7 A;  4GZ8 A;  4J0W A;  4PSW B;  5E6U A;  1GOT B;  3CIK B;  3SBR A;  4DNV A;  4TZ4 A;  4ZN4 A;  2IWF A;  3V4P A;  2AQ5 A;  2H9L A;  2I0S A;  2IWK A;  4JSN C;  4A2M A;  4ZOZ A;  2XZG A;  4A2L A;  3GC3 B;  3J80 g;  4N14 A;  5HE2 B;  2XE4 A;  3K72 A;  4QL1 A;  4A7J A;  4CZV A;  3HFQ A;  1N6F A;  5CXC A;  1Q47 A;  3NIF A;  5SXM A;  3EWE A;  2J55 H;  3VA6 A;  3NIG A;  5HQG A;  3O4J A;  2XU7 A;  4E5Z B;  2HES X;  4MMZ A;  5AFU 3;  4JT6 C;  3JZN A;  3I8C A;  4J87 A;  1R5M A;  3ULE C;  3BG1 A;  2YB8 B;  4JXM A;  2UZY B;  4GM8 A;  4X61 B;  4A08 B;  3EI3 B;  2VDM A;  3JZG A;  3NVQ A;  4GGC A;  4IMM A;  1FWX A;  3UKU C;  1UOO A;  4QRJ A;  1U4C A;  4AMZ A;  5K19 A;  3PXW D;  4PXW A;  1U8C A;  2B4E A;  2P9S C;  3NVX A;  4LG8 A;  3KCI A;  4G55 A;  2AGL A;  4FHL A;  3FM0 A;  4BUJ C;  1JOF A;  4CI3 A;  2IUV A;  1QFS A;  3T3P A;  3ZWL B;  4A0B A;  2H6N A;  1VE6 A;  4CY5 A;  4Z7Q A;  4JSX C;  4A08 A;  3DM0 A;  4GGD A;  4FA1 D;  3QI0 A;  3PVW B;  3SLE D;  4KFM B;  1H2W A;  2QZP A;  3ZE2 A;  1ERJ A;  2H13 A;  3I7P A;  3IUL A;  5C2W B;  2H14 A;  1JMX B;  4E5Z A;  3N0D A;  5AJA A;  4GMB A;  1N6D A;  4Y5R D;  3K27 A;  4HDJ A;  4L1Q D;  3SN6 B;  3DXK C;  3JPX A;  4JT5 C;  2JKX A;  2TRC B;  1VZ3 A;  5EMJ B;  3MXX A;  3IIY A;  3MVD K;  4L3H D;  3OKT A;  5GXI A;  4OZU A;  1P22 A;  3OW8 A;  4ERZ A;  1TYE A;  3EG6 A;  2VDP A;  4ZOY A;  3IUR A;  4Y7R A;  3DSM A;  1JTD B;  2O9K A;  1SQJ A;  5I5M A;  4GQ1 A;  3SVW D;  1GG2 B;  2XL3 A;  4J84 A;  3I7K A;  1NR0 A;  3IJC A;  3L4O D;  2B5L A;  2J57 G;  4J78 A;  2HKM A;  5AMS A;  4BP9 A;  1OLZ A;  3OKW A;  5EM2 B;  3O4I A;  3MKQ A;  1I2M B;  4U7A A;  5I5I A;  1GOF A;  2CNX A;  2AH1 A;  2EBS A;  4Z8L A;  1GOH A;  4AN0 A;  2AGW A;  4AMY A;  5FLX g;  4J81 A;  3I7H A;  3EI4 B;  5CXC B;  2CE9 A;  2QC5 A;  4ERQ A;  4K3I D;  3AL8 A;  5CYK B;  4RE5 A;  4WK4 A;  2J56 H;  1GXR A;  3IJ1 A;  5EMK B;  2Q7Q A;  3MMY A;  4A11 B;  2P9P C;  2IUR A;  5EAL A;  2OIZ A;  2VDO A;  4ESG A;  4GQ2 P;  2CE8 A;  4A09 B;  2VDL A;  2GNQ A;  3K71 A;  2PM9 A;  2VC2 A;  1T2X A;  2BCJ B;  1UTC A;  1K8K C;  2H47 A;  3MZL A;  1MG3 A;  4O3U B;  5IT9 g;  3UVO A;  2G9A A;  3KRW B;  4QT8 A;  1TBG A;  3OL2 A;  2OK4 A;  5FFG A;  4AOW A;  3I89 A;  1C9L A;  4J77 A;  2CO0 A;  3AFC A;  4CY1 A;  2PM7 B;  1VE7 A;  3MKS B;  4NBM A;  4RE6 A;  4D6V A;  2HKR A;  2YBA A;  3C75 H;  4L9O A;  5GXH A;  1XHM A;  3GD1 I;  2HYE A;  1O6F A;  3UVL A;  5E6S A;  4FAN D;  4CC9 A;  2QR5 A;  4A0A A;  1QNI A;  2XYI A;  3ORV D;  4ERY A;  1MG2 A;  3QHY B;  4UM9 A;  3RMZ D;  5K1C C;  3ZDX A;  3EI2 B;  2VZ3 A;  4BH6 A;  4LGN A;  3BWS A;  4J0X A;  2YNN A;  4XYH A;  2CN2 A;  5EML B;  4Z7N A;  2P9I C;  5HYN B;  3W15 A;  4CI2 A;  4GQB B;  5M5T A;  3SMR A;  4BCD A;  1YR2 A;  2CN3 A;  4J8G A;  2IUQ A;  5M61 A;  3U4Y A;  4NEN A;  4BCC A;  4X60 B;  3RN0 D;  1H2Z A;  1JMZ B;  3C9C A;  3VI4 A;  3EI1 A;  4FA9 D;  5IGO A;  3DWL C;  3F3P A;  2BKL A;  4OWR A;  2HU8 A;  2H3X A;  5CXB B;  3RLM D;  3FCU A;  4CZX A;  3JRO A;  4EWR A;  3SJL D;  5M5R A;  2EID A;  4R7A B;  1MDA H;  3JAM g;  1L0Q A;  2P9N C;  2AGY A;  3SBQ A;  3V5W B;  5JWZ A;  4JSP C;  2PM9 B;  5TF2 A;  1S4U X;  4A09 A;  4O3T B;  4FAV D;  3AH8 B;  2AGZ A;  1PBY B;  3MUN A;  3K6S A;  3DDU A;  2YNP A;  5H1M A;  2H9M A;  5FFO A;  3FCS A;  2IAA A;  3RRM C;  2YNO A;  2H6K A;  3PSL A;  5H17 A;  3V9F A;  1C9I A;  4CY2 A;  5IJ8 E;  4CZY A;  3OF7 A;  5GMK n;  3BG0 A;  1GOG A;  2EIE A;  4H5I A;  3PXS D;  3C5M A;  4NSX A;  4PSX B;  5FKQ A;  5FXY A;  2H6Q A;  2Z2N A;  3IKO A;  4O1Q D;  3ZDZ A;  2HJ4 A;  4AN1 A;  3DXM C;  3I7O A;  2XL2 A;  3K26 A;  2XDW A;  3JZH A;  4O45 A;  1QFM A;  2I3T A;  3UVM A;  4BCB A;  5THA A;  4G56 B;  3SWS D;  3PSC B;  2P9L C;  3RFH A;  3SXT D;  2GC4 A;  4ES0 A;  1UOP A;  2BBK H;  4DNW A;  3P4F A;  5B4W A;  5EAP A;  4IA9 A;  2OVR B;  1K32 A;  4UI9 R;  3EQ8 A;  3SHF A;  5C86 A;  1SQ9 A;  4O02 A;  4ZOX A;  4J79 A;  2OVP B;  3PXT D;  4AEZ A;  2WQ8 A;  4YVD A;  2B5N A;  3IJ0 A;  3V4V A;  1H2X A;  4WJK A;  2OK6 A;  3V7D B;  2AGX A;  3JRP A;  3CFS B;  3SCY A;  5EAR A;  3VH0 A;  2HJB A;  5FKR A;  3EMH A;  4AX4 A;  3N0E A;  4NAA A;  4XEI C;  4QQE A;  1E5T A;  5KDO B;  1YFQ A;  4NC4 A;  2OVQ B;  1PEV A;  4FB1 D;  3EU7 A;  3J81 g;  4FWW A;  5FA5 B;  4WK0 A;  3SFZ A;  2VDR A;  1E8N A;  3O4G A;  3UR4 A;  4A0B B;  1RI6 A;  4J8B A;  4BL0 A;  1VZ2 A;  4X3E A;  3ZE0 A;  3GFC A;  2QXV A;  3UKR C;  4XYI A;  3RN1 D;  4JD2 C;  3A0F A;  5A2Q g;  2PBI B;  3O4H A;  4L1M A;  2VDN A;  3KRX B;  2MTA H;  1VYH C;  3VGZ A;  5M5S A;  2H68 A;  2EIB A;  3ZDY A;  1K3I A;  2P9K C;  4G1E A;  1L5G A;  2G99 A;  1N6E A;  1A0R B;  3EI3 A;  4H5J A;  5CXB A;  3T3M A;  5H14 A;  3EI1 B;  5M5U A;  2GC7 A;  3I2N A;  5HE3 B;  3L4M D;  1UOQ A;  4G1M A;  3I7N A;  3RSE C;  1PI6 A;  4MMY A;  1NEX B;  2IUP A;  2OJY A;  4X63 B;  5HE1 B;  5IGQ A;  2B5M A;  3I7L A;  4D9S A;  4GM9 A;  5TEE A;  3PVU B;  2HXC A;  5E6R A;  4MMX A;  1B9Y A;  3NVN A;  4GM3 A;  5C9Z B;  2UZX B;  5IJ7 E;  4CI1 A;  1PGU A;  4O9D A;  1XIP A;  3RFG A;  4IRZ A;  3EI2 A;  5C92 A;  4J73 A;  3IUN A;  4J86 A;  4JHP C;  4A0A B;  4K3J B;  2AH0 A;  2I0R A;  3MUO A;  2HU5 A;  4PBZ A;  5EMM B;  2W18 A;  4Z7O A;  1A12 A;  3B7F A;  2H9N A;  3FGB A;  1BPO A;  4PNK B;  1JV2 A;  2H9P A;  5FKT A;  1GP2 B;  3OTT A;  5M5V A;  3OL2 B;  4UM8 A;  4QAM A;  5FQD A;  4CI8 A;  3ODT A;  4PBY A;  4D0K A;  4U1E I;  1E8M A;  3IUQ A;  3ZE1 A;  4BP8 A;  4GGA A;  4E54 A;  3IJE A;  3IVM A;  3OKY B;  5HE0 B;  4DNU A;  3CFV A;  4ZOV A;  1XKS A;  2Z2O A;  3UVN A;  4PC0 A;  3AL9 A;  3F3F A;  3PE7 A;  4WK2 A;  3VI3 A;  4A11 A;  3EQ7 A;  2CO0 C;  3NID A;  4MK0 B;  4CY3 A;  4FA5 D;  1TYQ C;  3MZK A;  3JB9 L;  5CYK A;  3GRE A;  1H2Y A;  3AL8 B;  1B9X A;  2HU7 A;  2I3S A;  1JJU B;  1U2V C;  3E0C A;  4JSV C;  3I8E A;  1O6G A;  3EI4 A;  5HDB A;  3C99 A;  2Z2P A;  4LG9 A; 
#chains in the Genus database with same CATH homology
 1SHY B;  2YMU A;  5GSA A;  4L3G D;  3F3G A;  2P9U C;  5I5J A;  3OKY A;  5EAM A;  4E54 B;  5TDH B;  3UVK A;  4FA4 D;  4I79 A;  4J82 A;  5FKS A;  2I0T A;  5EM2 A;  3FRX A;  2PM6 B;  3SBP A;  1OMW B;  5C2V B;  3IIW A;  5IC7 A;  4GZ8 A;  4J0W A;  4PSW B;  1GOT B;  3CIK B;  3SBR A;  4TZ4 A;  4ZN4 A;  2IWF A;  2AQ5 A;  2H9L A;  2I0S A;  2IWK A;  4JSN C;  4A2M A;  4ZOZ A;  4A2L A;  3J80 g;  4N14 A;  5HE2 B;  4QL1 A;  4A7J A;  4CZV A;  3HFQ A;  1N6F A;  1Q47 A;  5SXM A;  3EWE A;  2J55 H;  3VA6 A;  5HQG A;  2XU7 A;  4E5Z B;  2HES X;  5AFU 3;  4JT6 C;  3JZN A;  3I8C A;  4J87 A;  1R5M A;  3ULE C;  3BG1 A;  2YB8 B;  4JXM A;  2UZY B;  4GM8 A;  4X61 B;  4A08 B;  3EI3 B;  3JZG A;  3NVQ A;  4GGC A;  4IMM A;  1FWX A;  3UKU C;  4QRJ A;  1U4C A;  5K19 A;  3PXW D;  4PXW A;  2B4E A;  2P9S C;  3NVX A;  4LG8 A;  2AGL A;  4FHL A;  3FM0 A;  4BUJ C;  1JOF A;  4CI3 A;  2IUV A;  3EI4 A;  3ZWL B;  4A0B A;  2H6N A;  4CY5 A;  4JSX C;  4A08 A;  3DM0 A;  4GGD A;  4FA1 D;  3PVW B;  3SLE D;  4KFM B;  1ERJ A;  2H13 A;  3I7P A;  5C2W B;  2H14 A;  1JMX B;  4E5Z A;  3N0D A;  5AJA A;  4GMB A;  1N6D A;  4Y5R D;  3K27 A;  4HDJ A;  4L1Q D;  3SN6 B;  3DXK C;  3JPX A;  4JT5 C;  2TRC B;  5EMJ B;  3MXX A;  3IIY A;  4L3H D;  3OKT A;  5GXI A;  4OZU A;  1P22 A;  3OW8 A;  4ERZ A;  3EG6 A;  4ZOY A;  4Y7R A;  3DSM A;  2O9K A;  1SQJ A;  5I5M A;  4GQ1 A;  3SVW D;  1GG2 B;  2XL3 A;  4J84 A;  3I7K A;  1NR0 A;  3IJC A;  3L4O D;  2B5L A;  2J57 G;  4J78 A;  2HKM A;  5AMS A;  1OLZ A;  3OKW A;  5EM2 B;  3MKQ A;  4U7A A;  5I5I A;  2CNX A;  2AH1 A;  2EBS A;  4Z8L A;  2AGW A;  5FLX g;  4J81 A;  3I7H A;  3EI4 B;  5CXC B;  2CE9 A;  2QC5 A;  4ERQ A;  4K3I D;  3AL8 A;  5CYK B;  2J56 H;  1GXR A;  3IJ1 A;  5EMK B;  2Q7Q A;  3MMY A;  4A11 B;  2P9P C;  2IUR A;  5EAL A;  2OIZ A;  4ESG A;  4GQ2 P;  2CE8 A;  4A09 B;  2GNQ A;  2PM9 A;  2BCJ B;  1K8K C;  2H47 A;  3MZL A;  1MG3 A;  4O3U B;  5IT9 g;  3UVO A;  2G9A A;  3KRW B;  4QT8 A;  1TBG A;  3OL2 A;  2OK4 A;  4AOW A;  3I89 A;  4J77 A;  2CO0 A;  3AFC A;  4CY1 A;  2PM7 B;  3MKS B;  4D6V A;  2HKR A;  2YBA A;  3C75 H;  4L9O A;  5GXH A;  1XHM A;  2HYE A;  3UVL A;  4FAN D;  4CC9 A;  4A0A A;  1QNI A;  2XYI A;  3ORV D;  4ERY A;  1MG2 A;  3RMZ D;  5K1C C;  3EI2 B;  4BH6 A;  4LGN A;  3BWS A;  4J0X A;  2YNN A;  4XYH A;  2CN2 A;  5EML B;  2P9I C;  5HYN B;  3W15 A;  4CI2 A;  4GQB B;  3SMR A;  2CN3 A;  4J8G A;  2IUQ A;  3U4Y A;  4X60 B;  3RN0 D;  1JMZ B;  3C9C A;  3EI1 A;  4FA9 D;  5IGO A;  3DWL C;  3F3P A;  4OWR A;  5CXB B;  2H3X A;  4CZX A;  3RLM D;  3JRO A;  4EWR A;  3SJL D;  4R7A B;  1MDA H;  3JAM g;  1L0Q A;  2P9N C;  2AGY A;  3SBQ A;  3V5W B;  5JWZ A;  4JSP C;  2PM9 B;  5TF2 A;  1S4U X;  4A09 A;  4O3T B;  4FAV D;  3AH8 B;  2AGZ A;  1PBY B;  2YNP A;  5H1M A;  2H9M A;  2IAA A;  3RRM C;  2YNO A;  2H6K A;  3PSL A;  5H17 A;  3V9F A;  4CY2 A;  5IJ8 E;  4CZY A;  5GMK n;  3BG0 A;  4H5I A;  3PXS D;  3C5M A;  4NSX A;  4PSX B;  5FKQ A;  5FXY A;  2H6Q A;  2Z2N A;  3IKO A;  4O1Q D;  2HJ4 A;  3DXM C;  3I7O A;  2XL2 A;  3K26 A;  3JZH A;  3UVM A;  4O45 A;  2I3T A;  5THA A;  4G56 B;  3SWS D;  3PSC B;  2P9L C;  3RFH A;  3SXT D;  2GC4 A;  4ES0 A;  2BBK H;  3P4F A;  5B4W A;  5EAP A;  4IA9 A;  2OVR B;  1K32 A;  4UI9 R;  3SHF A;  1SQ9 A;  4ZOX A;  4J79 A;  2OVP B;  3PXT D;  4AEZ A;  4YVD A;  2B5N A;  3IJ0 A;  2OK6 A;  3V7D B;  2AGX A;  3JRP A;  3CFS B;  3SCY A;  5EAR A;  3VH0 A;  2HJB A;  5FKR A;  3EMH A;  3N0E A;  4XEI C;  4QQE A;  5KDO B;  1YFQ A;  2OVQ B;  1PEV A;  4FB1 D;  3EU7 A;  3J81 g;  4FWW A;  5FA5 B;  3SFZ A;  3UR4 A;  4A0B B;  1RI6 A;  4J8B A;  4BL0 A;  4X3E A;  3GFC A;  2QXV A;  3UKR C;  4XYI A;  3RN1 D;  4JD2 C;  3A0F A;  5A2Q g;  2PBI B;  3KRX B;  2MTA H;  1VYH C;  3VGZ A;  2H68 A;  2P9K C;  2G99 A;  1N6E A;  1A0R B;  3EI3 A;  4H5J A;  5CXB A;  5H14 A;  3EI1 B;  2GC7 A;  3I2N A;  5HE3 B;  3L4M D;  3I7N A;  3RSE C;  1PI6 A;  1NEX B;  2IUP A;  2OJY A;  4X63 B;  5HE1 B;  5IGQ A;  2B5M A;  3I7L A;  4GM9 A;  5TEE A;  3PVU B;  2HXC A;  1B9Y A;  3NVN A;  4GM3 A;  5C9Z B;  2UZX B;  5IJ7 E;  4CI1 A;  1PGU A;  4O9D A;  1XIP A;  3RFG A;  3EI2 A;  4J73 A;  4J86 A;  4A0A B;  4K3J B;  2AH0 A;  2I0R A;  5EMM B;  4PBZ A;  2W18 A;  3B7F A;  2H9N A;  3FGB A;  4PNK B;  2H9P A;  5FKT A;  1GP2 B;  3OTT A;  3OL2 B;  5FQD A;  4CI8 A;  3ODT A;  4PBY A;  4D0K A;  4U1E I;  4GGA A;  4E54 A;  3OKY B;  5HE0 B;  3CFV A;  4ZOV A;  1XKS A;  2Z2O A;  3UVN A;  4PC0 A;  3AL9 A;  3F3F A;  3PE7 A;  4A11 A;  2CO0 C;  4MK0 B;  4CY3 A;  4FA5 D;  1TYQ C;  3MZK A;  3JB9 L;  5CYK A;  3GRE A;  3AL8 B;  1B9X A;  2I3S A;  3E0C A;  1JJU B;  1U2V C;  4JSV C;  3I8E A;  5CXC A;  5TEF A;  3C99 A;  2Z2P A;  4LG9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...