4FA1D

Crystal structure of wt maug in complex with pre-methylamine dehydrogenase aged 130 days.
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
376
structure length
376
Chain Sequence
QETQGQAAARAAAADLAAGQDDEPRILEAPAPDARRVYVNDPAHFAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVEVFDPVTLLPTADIELPDAPRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTFFMHCRDGSLAKVAFGTEGTPEITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEAERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRFVVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALSTGDKTLYIHDAESGEELRSVNQLGHGPQVITTADMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/electron transport
molecule keywords Methylamine utilization protein MauG
publication title Diradical intermediate within the context of tryptophan tryptophylquinone biosynthesis.
pubmed doi rcsb
source organism Paracoccus denitrificans
total genus 96
structure length 376
sequence length 376
chains with identical sequence F
ec nomenclature
pdb deposition date 2012-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4fa1D00
4A2LA 2AGLA 4A09B 5H14A 2AGZA 4O9DA 3SWSD 4X61B 1FWXA 2AGWA 5IJ7E 4CZYA 4BH6A 3I7HA 5CXBA 3AH8B 4IA9A 5GXIA 4U1EI 5FA5B 3JROA 1Q47A 2J55H 3MKQA 5AJAA 5FKQA 5I5MA 4A08A 5EMMB 5K1CC 2IWFA 2HKMA 3RFGA 4GZ8A 5CXCB 2OVRB 3OW8A 3OL2A 3F3GA 2HKRA 3SCYA 3ODTA 5HE1B 3OTTA 1K32A 2XL2A 5FXYA 4XYHA 4GM8A 1OLZA 1A0RB 3RFHA 3ORVD 4GGDA 3I2NA 5TEEA 3NVXA 2H6KA 2P9KC 1XKSA 5K19A 4H5IA 3C99A 2UZXB 2OJYA 3KRWB 3EI3B 3PXWD 4K3JB 5KDOB 4ERQA 4E54B 2CNXA 4L3GD 4QQEA 2B5MA 4A11B 2OVPB 2XU7A 4J87A 5FKRA 4QT8A 3L4OD 3OKYB 2J57G 4J79A 5CYKB 4O3TB 3C5MA 4FWWA 2CO0A 5GXHA 4FA1D 4AOWA 4PBZA 2PM9A 4JSNC 4ESGA 3UVNA 4FA9D 3IJCA 3MXXA 4X60B 3RSEC 5FLXg 1GOTB 2H13A 2P9LC 4J8BA 3RMZD 2YNNA 3MMYA 2B5NA 4AEZA 4OWRA 1B9YA 3IIYA 3UVLA 4J73A 5I5JA 3JAMg 1TYQC 4R7AB 4G56B 4BUJC 4NSXA 5EAMA 3KRXB 3JZNA 2PM6B 5THAA 3UKRC 3RLMD 2I0RA 4E5ZB 3I7KA 1U2VC 3IJ0A 4ZOZA 2I0SA 3L4MD 4J82A 1U4CA 4XYIA 2AQ5A 2H9MA 3VGZA 1JJUB 3BWSA 3EI4A 3PVWB 2HXCA 2PM7B 1GG2B 3DSMA 5HE2B 3SXTD 3JRPA 5TF2A 1PI6A 2H9LA 4JXMA 1GP2B 4A09A 3UVOA 3I8CA 3I7PA 3GREA 2HJBA 3B7FA 5B4WA 2G99A 4D6VA 2GC7A 3VH0A 3N0DA 2AH0A 1ERJA 3SN6B 4BL0A 4O45A 4LG9A 2H68A 1N6FA 4UI9R 4J8GA 5FQDA 2TRCB 4FAND 1JMZB 1GXRA 3EMHA 3IIWA 2B5LA 2H14A 3HFQA 3MZLA 5CXCA 3BG0A 2H6QA 4X3EA 4Z8LA 4I79A 2Z2OA 2AH1A 4J0XA 3UVMA 4CY1A 1XIPA 4CY2A 5IGOA 4ERYA 4GGCA 2OIZA 5EMKB 4ZOVA 4O1QD 3DWLC 3IKOA 4CI1A 3SBRA 2IAAA 4FB1D 2IUVA 3MKSB 4GM3A 1NR0A 3EI3A 4A0AB 4E54A 3I7NA 2CN3A 4ZOYA 5HYNB 3V7DB 3EI2B 4A11A 4CY3A 2P9NC 2CE9A 4JSXC 4CZXA 5TDHB 3OKYA 2H3XA 2IUQA 3FRXA 5CYKA 5C9ZB 3OKTA 2IURA 3K26A 3PXSD 3V9FA 5C2VB 3PSLA 4PBYA 3IJ1A 2QXVA 4A0BB 4ZOXA 5H17A 3AL8B 2OK6A 3P4FA 3JB9L 3W15A 2W18A 2H9PA 4HDJA 1PBYB 3BG1A 5EAPA 1JOFA 1NEXB 3FGBA 3NVNA 2OK4A 4A2MA 1S4UX 2YB8B 2IUPA 4J78A 4ERZA 4L3HD 4Y5RD 1RI6A 2H6NA 4JSVC 4J0WA 2HESX 3CIKB 3SVWD 5AFU3 3AFCA 2GNQA 4JT5C 4QRJA 5EM2B 4X63B 2BBKH 2PBIB 2P9IC 5GSAA 4J81A 2P9UC 2YMUA 5TEFA 4E5ZA 5JWZA 2CO0C 3JPXA 2Z2NA 4LG8A 1MDAH 3ZWLB 2EBSA 3J81g 4J86A 1JMXB 3CFVA 4PC0A 3SJLD 3A0FA 4ZN4A 4Y7RA 3N0EA 5HQGA 4EWRA 2P9SC 4ES0A 4K3ID 3EU7A 1OMWB 3EI1B 1TBGA 3K27A 3EI1A 3PXTD 4CI2A 3MZKA 2I3TA 3U4YA 2I3SA 2Q7QA 1P22A 2IWKA 4CI3A 2YNPA 5CXBB 5H1MA 2BCJB 4A7JA 3EG6A 4J84A 3PSCB 1N6DA 4A08B 3JZGA 4GQBB 5HE0B 3F3PA 5I5IA 3OL2B 2H9NA 3EWEA 1L0QA 4QL1A 3C9CA 2GC4A 5EMLB 4GGAA 4MK0B 5IGQA 2G9AA 4CI8A 4LGNA 3V5WB 3AL9A 2XL3A 4OZUA 4A0AA 2CE8A 4KFMB 1PEVA 3I89A 4IMMA 5FKTA 4L1QD 3EI2A 4FHLA 3PVUB 3SBQA 4O3UB 4H5JA 3NVQA 5EMJB 3SBPA 2CN2A 2QC5A 4YVDA 2H47A 1B9XA 5HE3B 4GQ2P 3SLED 4A0BA 2MTAH 5C2WB 1MG2A 3AL8A 1QNIA 2AGYA 2AGXA 2HYEA 3OKWA 3RN0D 5EALA 2PM9B 2YBAA 1N6EA 2OVQB 5IT9g 2J56H 3DXKC 3PE7A 5IC7A 4N14A 3CFSB 3UR4A 3UKUC 3DXMC 5IJ8E 4GMBA 4TZ4A 2YNOA 2O9KA 3I7OA 4PXWA 2HJ4A 4CZVA 4FA4D 5SXMA 4FAVD 1XHMA 1SQ9A 5EM2A 2Z2PA 1VYHC 3J80g 4XEIC 3C75H 3VA6A 4JD2C 4CY5A 2B4EA 3F3FA 5GMKn 2P9PC 3FM0A 4U7AA 2UZYB 4GQ1A 5EARA 3GFCA 4GM9A 4PSXB 4CC9A 3UVKA 1PGUA 4L9OA 1YFQA 1K8KC 5AMSA 4PSWB 5A2Qg 3E0CA 3I8EA 3ULEC 1MG3A 3RN1D 4JSPC 4JT6C 3DM0A 4J77A 4FA5D 5FKSA 2XYIA 3I7LA 2I0TA 3EI4B 3RRMC 3SFZA 1SQJA 4PNKB 1SHYB 4D0KA 3SHFA 3JZHA 3SMRA 1R5MA
chains in the Genus database with same CATH superfamily
4A2LA 2AGLA 4DNVA 4A09B 5H14A 2AGZA 4O9DA 3SWSD 2WQ8A 4X61B 1FWXA 5M5SA 2AGWA 5M5UA 5IJ7E 4CZYA 4BH6A 3NIGA 3I7HA 5CXBA 3AH8B 3EQ8A 4IA9A 5GXIA 4U1EI 5FA5B 3JROA 1Q47A 2J55H 3MKQA 5AJAA 2VDRA 5FKQA 5I5MA 4A08A 5EMMB 5K1CC 2IWFA 2HKMA 3RFGA 4GZ8A 5CXCB 2OVRB 3OW8A 3OL2A 3F3GA 2HKRA 3SCYA 3ODTA 5HE1B 5E6UA 4BCBA 3OTTA 1K32A 2XL2A 5FXYA 4XYHA 4GM8A 1OLZA 3IULA 1A0RB 3RFHA 5M5RA 3ORVD 3ZE0A 4GGDA 1YR2A 3I2NA 3K72A 5TEEA 3NVXA 2H6KA 2P9KC 1O6GA 1XKSA 5K19A 4H5IA 3C99A 4MMXA 2UZXB 1UOQA 2OJYA 3KRWB 3EI3B 3PXWD 4K3JB 5KDOB 4ERQA 4E54B 2CNXA 3KCIA 4L3GD 4QQEA 2B5MA 4A11B 2OVPB 4Z7QA 2XU7A 4J87A 5FKRA 4QT8A 3L4OD 3OKYB 2J57G 4J79A 5CYKB 4O3TB 1GOGA 3C5MA 4FWWA 1H2YA 1H2ZA 2CO0A 5GXHA 4FA1D 4AOWA 4PBZA 2PM9A 4JSNC 4ESGA 3UVNA 4FA9D 3IJCA 3MXXA 4X60B 3RSEC 5FLXg 1GOTB 2H13A 2P9LC 5M61A 4J8BA 3RMZD 2YNNA 3MMYA 2B5NA 4AEZA 4OWRA 5E6SA 1B9YA 3K6SA 3IIYA 3UVLA 4J73A 1VZ2A 5I5JA 3JAMg 1TYQC 4R7AB 4G56B 4NC4A 3IUNA 4BUJC 3NIFA 4NSXA 5EAMA 3KRXB 3JZNA 2PM6B 4G1EA 4AMZA 2VDNA 5THAA 4BP9A 4WK0A 3V4VA 2EICA 3UKRC 4WK4A 5FFGA 3RLMD 2I0RA 5C92A 4E5ZB 3I7KA 1U2VC 1JTDB 1UTCA 3IJ0A 4ZOZA 2I0SA 3L4MD 4J82A 1U4CA 1E8MA 4XYIA 2AQ5A 2H9MA 3VGZA 1JJUB 3BWSA 3EI4A 3PVWB 2HXCA 2PM7B 1GG2B 3DSMA 5HE2B 1H2XA 3QI0A 2VC2A 3SXTD 3JRPA 5TF2A 1PI6A 2H9LA 1L5GA 1GP2B 4JXMA 3GC3B 3UVOA 3I8CA 3I7PA 4JHPC 4UM8A 3GREA 2HJBA 3MVDK 3B7FA 3MUNA 5B4WA 2G99A 4D6VA 2GC7A 3VH0A 3N0DA 2AH0A 3OF7A 1ERJA 3SN6B 1VE7A 4BL0A 4O45A 1K3IA 4LG9A 4AN0A 2H68A 1N6FA 4UI9R 4J8GA 2EIBA 5FQDA 2TRCB 4RE5A 4FAND 5M5VA 1JMZB 1GXRA 3EMHA 3IIWA 2B5LA 2H14A 3HFQA 3MZLA 5CXCA 3BG0A 4G1MA 2H6QA 4X3EA 4Z8LA 2HU5A 4I79A 2HU8A 2Z2OA 2AH1A 4J0XA 3UVMA 4O2WA 4CY1A 1XIPA 4CY2A 5IGOA 4ERYA 4GGCA 2OIZA 4A09A 5EMKB 3T3MA 4ZOVA 4BP8A 4O1QD 2QR5A 3DWLC 3IKOA 4DNWA 4RE6A 4CI1A 3SBRA 2IAAA 3ZDXA 3IVMA 4FB1D 2IUVA 3MKSB 4GM3A 1NR0A 3EI3A 4A0AB 4E54A 3I7NA 2CN3A 4ZOYA 5HYNB 3V7DB 3EI2B 4A11A 4CY3A 2P9NC 2CE9A 4JSXC 5FFOA 4CZXA 5TDHB 3OKYA 2H3XA 5C86A 4NAAA 2IUQA 3FRXA 3ZE2A 5CYKA 5C9ZB 2VDQA 2IURA 3OKTA 4Z7OA 3K26A 3PXSD 3V9FA 5C2VB 3PSLA 1C9LA 4PBYA 3IJ1A 2QXVA 4A0BB 4ZOXA 5H17A 3AL8B 2OK6A 3IUJA 2VDOA 3P4FA 3JB9L 3VI4A 3W15A 2W18A 2H9PA 2VDPA 4HDJA 1PBYB 3BG1A 5EAPA 4JHNA 2VDKA 4QAMA 1JOFA 1NEXB 3FGBA 5E6RA 3NVNA 2OK4A 4A2MA 1S4UX 2YB8B 2IUPA 4J78A 4ERZA 2BKLA 4L3HD 4Y5RD 1RI6A 2H6NA 3O4JA 4JSVC 1UOPA 4J0WA 2HESX 3CIKB 3SVWD 5AFU3 1QFMA 4AMYA 3ZDZA 3AFCA 2GNQA 4JT5C 4QRJA 5EM2B 4X63B 2BBKH 1QFSA 2PBIB 2P9IC 4UM9A 5GSAA 4J81A 2EIDA 2VDMA 2P9UC 2YMUA 5TEFA 4E5ZA 1UOOA 5JWZA 2CO0C 3JPXA 2Z2NA 3IJEA 4LG8A 1MDAH 3ZWLB 3NIDA 2EBSA 4AN1A 3J81g 3IURA 4J86A 1JMXB 3CFVA 4PC0A 3SJLD 3A0FA 4ZN4A 4Y7RA 3ZDYA 3N0EA 1JV2A 5HQGA 4EWRA 2P9SC 4ES0A 3IUMA 4K3ID 3EU7A 1OMWB 3EI1B 1TBGA 3FCSA 4NENA 3K27A 3EI1A 3PXTD 4CI2A 2XDWA 3MZKA 3ZE1A 2VDLA 2I3TA 3U4YA 2I3SA 2Q7QA 1P22A 2IWKA 4CI3A 2YNPA 5CXBB 3IUQA 5H1MA 4O02A 2BCJB 4A7JA 3EG6A 5M5TA 4J84A 3PSCB 2JKXA 3EQ9A 1O6FA 1N6DA 4MMYA 3MUOA 4A08B 3JZGA 2VZ1A 4GQBB 1GOFA 4BCCA 1C9IA 3O4GA 1E8NA 5HE0B 4IRZA 3F3PA 5I5IA 3OL2B 1H2WA 2H9NA 3EWEA 1L0QA 4QL1A 3C9CA 2GC4A 5EMLB 4GGAA 4MK0B 5IGQA 1M1XA 2G9AA 4NBMA 4CI8A 4LGNA 5HDBA 3V5WB 3AL9A 2XL3A 4OZUA 4A0AA 2CE8A 4KFMB 1PEVA 3I89A 4IMMA 5FKTA 4L1QD 3EI2A 4FHLA 3PVUB 3EQ7A 3SBQA 4O3UB 1VE6A 4H5JA 3GD1I 1U8CA 3VI3A 1I2MB 2HU7A 3NVQA 5EMJB 3SBPA 2CN2A 3FCUA 2QC5A 4YVDA 2H47A 1B9XA 5HE3B 4GQ2P 3SLED 4A0BA 2MTAH 4DNUA 5C2WB 1MG2A 3AL8A 1QNIA 2AGYA 2XE4A 2AGXA 3O4HA 4AX4A 4Z7NA 4L1MA 1T2XA 2HYEA 3OKWA 3RN0D 3O4IA 1A12A 5EALA 2PM9B 2YBAA 2QZPA 1N6EA 2OVQB 5IT9g 2J56H 3DXKC 3PE7A 5IC7A 4N14A 3CFSB 4G55A 4MMZA 2EIEA 3UR4A 3UKUC 3DXMC 5IJ8E 4GMBA 4TZ4A 2YNOA 2O9KA 3I7OA 4PXWA 2HJ4A 4CZVA 4BCDA 4FA4D 5SXMA 4FAVD 1XHMA 1SQ9A 1VZ3A 5EM2A 2Z2PA 3K71A 4WK2A 1VYHC 3J80g 4XEIC 3C75H 2XZGA 3VA6A 1BPOA 1GOHA 3QHYB 4JD2C 1E5TA 4CY5A 2B4EA 3F3FA 5GMKn 2P9PC 3FM0A 4U7AA 2UZYB 4GQ1A 3V4PA 3DDUA 5EARA 3GFCA 4GM9A 4PSXB 1TYEA 3UVKA 4CC9A 1PGUA 4L9OA 3T3PA 1YFQA 1K8KC 5AMSA 4PSWB 5A2Qg 3E0CA 3I8EA 2VZ3A 3ULEC 1MG3A 3RN1D 4JSPC 4JT6C 3DM0A 4J77A 4FA5D 5FKSA 2XYIA 3I7LA 2I0TA 4WJKA 3EI4B 3RRMC 3SFZA 1SQJA 4PNKB 1SHYB 4D0KA 4D9SA 3SHFA 3JZHA 3SMRA 1R5MA
chains in the Genus database with same CATH topology
4A2LA 2AGLA 4A09B 5H14A 2AGZA 4O9DA 3SWSD 4X61B 1FWXA 2AGWA 5IJ7E 4CZYA 4BH6A 3I7HA 5CXBA 3AH8B 4IA9A 5GXIA 4U1EI 5FA5B 3JROA 1Q47A 2J55H 3MKQA 5AJAA 5FKQA 5I5MA 4A08A 5EMMB 5K1CC 2IWFA 2HKMA 3RFGA 4GZ8A 5CXCB 2OVRB 3OW8A 3OL2A 3F3GA 2HKRA 3SCYA 3ODTA 5HE1B 3OTTA 1K32A 2XL2A 5FXYA 4XYHA 4GM8A 1OLZA 1A0RB 3RFHA 3ORVD 4GGDA 3I2NA 5TEEA 3NVXA 2H6KA 2P9KC 1XKSA 5K19A 4H5IA 3C99A 2UZXB 2OJYA 3KRWB 3EI3B 3PXWD 4K3JB 5KDOB 4ERQA 4E54B 2CNXA 4L3GD 4QQEA 2B5MA 4A11B 2OVPB 2XU7A 4J87A 5FKRA 4QT8A 3L4OD 3OKYB 2J57G 4J79A 5CYKB 4O3TB 3C5MA 4FWWA 2CO0A 5GXHA 4FA1D 4AOWA 4PBZA 2PM9A 4JSNC 4ESGA 3UVNA 4FA9D 3IJCA 3MXXA 4X60B 3RSEC 5FLXg 1GOTB 2H13A 2P9LC 4J8BA 3RMZD 2YNNA 3MMYA 2B5NA 4AEZA 4OWRA 1B9YA 3IIYA 3UVLA 4J73A 5I5JA 3JAMg 1TYQC 4R7AB 4G56B 4BUJC 4NSXA 5EAMA 3KRXB 3JZNA 2PM6B 5THAA 3UKRC 3RLMD 2I0RA 4E5ZB 3I7KA 1U2VC 3IJ0A 4ZOZA 2I0SA 3L4MD 4J82A 1U4CA 4XYIA 2AQ5A 2H9MA 3VGZA 1JJUB 3BWSA 3EI4A 3PVWB 2HXCA 2PM7B 1GG2B 3DSMA 5HE2B 3SXTD 3JRPA 5TF2A 1PI6A 2H9LA 4JXMA 1GP2B 4A09A 3UVOA 3I8CA 3I7PA 3GREA 2HJBA 3B7FA 5B4WA 2G99A 4D6VA 2GC7A 3VH0A 3N0DA 2AH0A 1ERJA 3SN6B 4BL0A 4O45A 4LG9A 2H68A 1N6FA 4UI9R 4J8GA 5FQDA 2TRCB 4FAND 1JMZB 1GXRA 3EMHA 3IIWA 2B5LA 2H14A 3HFQA 3MZLA 5CXCA 3BG0A 2H6QA 4X3EA 4Z8LA 4I79A 2Z2OA 2AH1A 4J0XA 3UVMA 4CY1A 1XIPA 4CY2A 5IGOA 4ERYA 4GGCA 2OIZA 5EMKB 4ZOVA 4O1QD 3DWLC 3IKOA 4CI1A 3SBRA 2IAAA 4FB1D 2IUVA 3MKSB 4GM3A 1NR0A 3EI3A 4A0AB 4E54A 3I7NA 2CN3A 4ZOYA 5HYNB 3V7DB 3EI2B 4A11A 4CY3A 2P9NC 2CE9A 4JSXC 4CZXA 5TDHB 3OKYA 2H3XA 2IUQA 3FRXA 5CYKA 5C9ZB 3OKTA 2IURA 3K26A 3PXSD 3V9FA 5C2VB 3PSLA 4PBYA 3IJ1A 2QXVA 4A0BB 4ZOXA 5H17A 3AL8B 2OK6A 3P4FA 3JB9L 3W15A 2W18A 2H9PA 4HDJA 1PBYB 3BG1A 5EAPA 1JOFA 1NEXB 3FGBA 3NVNA 2OK4A 4A2MA 1S4UX 2YB8B 2IUPA 4J78A 4ERZA 4L3HD 4Y5RD 1RI6A 2H6NA 4JSVC 4J0WA 2HESX 3CIKB 3SVWD 5AFU3 3AFCA 2GNQA 4JT5C 4QRJA 5EM2B 4X63B 2BBKH 2PBIB 2P9IC 5GSAA 4J81A 2P9UC 2YMUA 5TEFA 4E5ZA 5JWZA 2CO0C 3JPXA 2Z2NA 4LG8A 1MDAH 3ZWLB 2EBSA 3J81g 4J86A 1JMXB 3CFVA 4PC0A 3SJLD 3A0FA 4ZN4A 4Y7RA 3N0EA 5HQGA 4EWRA 2P9SC 4ES0A 4K3ID 3EU7A 1OMWB 3EI1B 1TBGA 3K27A 3EI1A 3PXTD 4CI2A 3MZKA 2I3TA 3U4YA 2I3SA 2Q7QA 1P22A 2IWKA 4CI3A 2YNPA 5CXBB 5H1MA 2BCJB 4A7JA 3EG6A 4J84A 3PSCB 1N6DA 4A08B 3JZGA 4GQBB 5HE0B 3F3PA 5I5IA 3OL2B 2H9NA 3EWEA 1L0QA 4QL1A 3C9CA 2GC4A 5EMLB 4GGAA 4MK0B 5IGQA 2G9AA 4CI8A 4LGNA 3V5WB 3AL9A 2XL3A 4OZUA 4A0AA 2CE8A 4KFMB 1PEVA 3I89A 4IMMA 5FKTA 4L1QD 3EI2A 4FHLA 3PVUB 3SBQA 4O3UB 4H5JA 3NVQA 5EMJB 3SBPA 2CN2A 2QC5A 4YVDA 2H47A 1B9XA 5HE3B 4GQ2P 3SLED 4A0BA 2MTAH 5C2WB 1MG2A 3AL8A 1QNIA 2AGYA 2AGXA 2HYEA 3OKWA 3RN0D 5EALA 2PM9B 2YBAA 1N6EA 2OVQB 5IT9g 2J56H 3DXKC 3PE7A 5IC7A 4N14A 3CFSB 3UR4A 3UKUC 3DXMC 5IJ8E 4GMBA 4TZ4A 2YNOA 2O9KA 3I7OA 4PXWA 2HJ4A 4CZVA 4FA4D 5SXMA 4FAVD 1XHMA 1SQ9A 5EM2A 2Z2PA 1VYHC 3J80g 4XEIC 3C75H 3VA6A 4JD2C 4CY5A 2B4EA 3F3FA 5GMKn 2P9PC 3FM0A 4U7AA 2UZYB 4GQ1A 5EARA 3GFCA 4GM9A 4PSXB 4CC9A 3UVKA 1PGUA 4L9OA 1YFQA 1K8KC 5AMSA 4PSWB 5A2Qg 3E0CA 3I8EA 3ULEC 1MG3A 3RN1D 4JSPC 4JT6C 3DM0A 4J77A 4FA5D 5FKSA 2XYIA 3I7LA 2I0TA 3EI4B 3RRMC 3SFZA 1SQJA 4PNKB 1SHYB 4D0KA 3SHFA 3JZHA 3SMRA 1R5MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A2L A;  2AGL A;  4A09 B;  5H14 A;  2AGZ A;  4O9D A;  3SWS D;  4X61 B;  1FWX A;  2AGW A;  5IJ7 E;  4CZY A;  4BH6 A;  3I7H A;  5CXB A;  3AH8 B;  4IA9 A;  5GXI A;  4U1E I;  5FA5 B;  3JRO A;  1Q47 A;  2J55 H;  3MKQ A;  5AJA A;  5FKQ A;  5I5M A;  4A08 A;  5EMM B;  5K1C C;  2IWF A;  2HKM A;  3RFG A;  4GZ8 A;  5CXC B;  2OVR B;  3OW8 A;  3OL2 A;  3F3G A;  2HKR A;  3SCY A;  3ODT A;  5HE1 B;  3OTT A;  1K32 A;  2XL2 A;  5FXY A;  4XYH A;  4GM8 A;  1OLZ A;  1A0R B;  3RFH A;  3ORV D;  4GGD A;  3I2N A;  5TEE A;  3NVX A;  2H6K A;  2P9K C;  1XKS A;  5K19 A;  4H5I A;  3C99 A;  2UZX B;  2OJY A;  3KRW B;  3EI3 B;  3PXW D;  4K3J B;  5KDO B;  4ERQ A;  4E54 B;  2CNX A;  4L3G D;  4QQE A;  2B5M A;  4A11 B;  2OVP B;  2XU7 A;  4J87 A;  5FKR A;  4QT8 A;  3L4O D;  3OKY B;  2J57 G;  4J79 A;  5CYK B;  4O3T B;  3C5M A;  4FWW A;  2CO0 A;  5GXH A;  4FA1 D;  4AOW A;  4PBZ A;  2PM9 A;  4JSN C;  4ESG A;  3UVN A;  4FA9 D;  3IJC A;  3MXX A;  4X60 B;  3RSE C;  5FLX g;  1GOT B;  2H13 A;  2P9L C;  4J8B A;  3RMZ D;  2YNN A;  3MMY A;  2B5N A;  4AEZ A;  4OWR A;  1B9Y A;  3IIY A;  3UVL A;  4J73 A;  5I5J A;  3JAM g;  1TYQ C;  4R7A B;  4G56 B;  4BUJ C;  4NSX A;  5EAM A;  3KRX B;  3JZN A;  2PM6 B;  5THA A;  3UKR C;  3RLM D;  2I0R A;  4E5Z B;  3I7K A;  1U2V C;  3IJ0 A;  4ZOZ A;  2I0S A;  3L4M D;  4J82 A;  1U4C A;  4XYI A;  2AQ5 A;  2H9M A;  3VGZ A;  1JJU B;  3BWS A;  3EI4 A;  3PVW B;  2HXC A;  2PM7 B;  1GG2 B;  3DSM A;  5HE2 B;  3SXT D;  3JRP A;  5TF2 A;  1PI6 A;  2H9L A;  4JXM A;  1GP2 B;  4A09 A;  3UVO A;  3I8C A;  3I7P A;  3GRE A;  2HJB A;  3B7F A;  5B4W A;  2G99 A;  4D6V A;  2GC7 A;  3VH0 A;  3N0D A;  2AH0 A;  1ERJ A;  3SN6 B;  4BL0 A;  4O45 A;  4LG9 A;  2H68 A;  1N6F A;  4UI9 R;  4J8G A;  5FQD A;  2TRC B;  4FAN D;  1JMZ B;  1GXR A;  3EMH A;  3IIW A;  2B5L A;  2H14 A;  3HFQ A;  3MZL A;  5CXC A;  3BG0 A;  2H6Q A;  4X3E A;  4Z8L A;  4I79 A;  2Z2O A;  2AH1 A;  4J0X A;  3UVM A;  4CY1 A;  1XIP A;  4CY2 A;  5IGO A;  4ERY A;  4GGC A;  2OIZ A;  5EMK B;  4ZOV A;  4O1Q D;  3DWL C;  3IKO A;  4CI1 A;  3SBR A;  2IAA A;  4FB1 D;  2IUV A;  3MKS B;  4GM3 A;  1NR0 A;  3EI3 A;  4A0A B;  4E54 A;  3I7N A;  2CN3 A;  4ZOY A;  5HYN B;  3V7D B;  3EI2 B;  4A11 A;  4CY3 A;  2P9N C;  2CE9 A;  4JSX C;  4CZX A;  5TDH B;  3OKY A;  2H3X A;  2IUQ A;  3FRX A;  5CYK A;  5C9Z B;  3OKT A;  2IUR A;  3K26 A;  3PXS D;  3V9F A;  5C2V B;  3PSL A;  4PBY A;  3IJ1 A;  2QXV A;  4A0B B;  4ZOX A;  5H17 A;  3AL8 B;  2OK6 A;  3P4F A;  3JB9 L;  3W15 A;  2W18 A;  2H9P A;  4HDJ A;  1PBY B;  3BG1 A;  5EAP A;  1JOF A;  1NEX B;  3FGB A;  3NVN A;  2OK4 A;  4A2M A;  1S4U X;  2YB8 B;  2IUP A;  4J78 A;  4ERZ A;  4L3H D;  4Y5R D;  1RI6 A;  2H6N A;  4JSV C;  4J0W A;  2HES X;  3CIK B;  3SVW D;  5AFU 3;  3AFC A;  2GNQ A;  4JT5 C;  4QRJ A;  5EM2 B;  4X63 B;  2BBK H;  2PBI B;  2P9I C;  5GSA A;  4J81 A;  2P9U C;  2YMU A;  5TEF A;  4E5Z A;  5JWZ A;  2CO0 C;  3JPX A;  2Z2N A;  4LG8 A;  1MDA H;  3ZWL B;  2EBS A;  3J81 g;  4J86 A;  1JMX B;  3CFV A;  4PC0 A;  3SJL D;  3A0F A;  4ZN4 A;  4Y7R A;  3N0E A;  5HQG A;  4EWR A;  2P9S C;  4ES0 A;  4K3I D;  3EU7 A;  1OMW B;  3EI1 B;  1TBG A;  3K27 A;  3EI1 A;  3PXT D;  4CI2 A;  3MZK A;  2I3T A;  3U4Y A;  2I3S A;  2Q7Q A;  1P22 A;  2IWK A;  4CI3 A;  2YNP A;  5CXB B;  5H1M A;  2BCJ B;  4A7J A;  3EG6 A;  4J84 A;  3PSC B;  1N6D A;  4A08 B;  3JZG A;  4GQB B;  5HE0 B;  3F3P A;  5I5I A;  3OL2 B;  2H9N A;  3EWE A;  1L0Q A;  4QL1 A;  3C9C A;  2GC4 A;  5EML B;  4GGA A;  4MK0 B;  5IGQ A;  2G9A A;  4CI8 A;  4LGN A;  3V5W B;  3AL9 A;  2XL3 A;  4OZU A;  4A0A A;  2CE8 A;  4KFM B;  1PEV A;  3I89 A;  4IMM A;  5FKT A;  4L1Q D;  3EI2 A;  4FHL A;  3PVU B;  3SBQ A;  4O3U B;  4H5J A;  3NVQ A;  5EMJ B;  3SBP A;  2CN2 A;  2QC5 A;  4YVD A;  2H47 A;  1B9X A;  5HE3 B;  4GQ2 P;  3SLE D;  4A0B A;  2MTA H;  5C2W B;  1MG2 A;  3AL8 A;  1QNI A;  2AGY A;  2AGX A;  2HYE A;  3OKW A;  3RN0 D;  5EAL A;  2PM9 B;  2YBA A;  1N6E A;  2OVQ B;  5IT9 g;  2J56 H;  3DXK C;  3PE7 A;  5IC7 A;  4N14 A;  3CFS B;  3UR4 A;  3UKU C;  3DXM C;  5IJ8 E;  4GMB A;  4TZ4 A;  2YNO A;  2O9K A;  3I7O A;  4PXW A;  2HJ4 A;  4CZV A;  4FA4 D;  5SXM A;  4FAV D;  1XHM A;  1SQ9 A;  5EM2 A;  2Z2P A;  1VYH C;  3J80 g;  4XEI C;  3C75 H;  3VA6 A;  4JD2 C;  4CY5 A;  2B4E A;  3F3F A;  5GMK n;  2P9P C;  3FM0 A;  4U7A A;  2UZY B;  4GQ1 A;  5EAR A;  3GFC A;  4GM9 A;  4PSX B;  4CC9 A;  3UVK A;  1PGU A;  4L9O A;  1YFQ A;  1K8K C;  5AMS A;  4PSW B;  5A2Q g;  3E0C A;  3I8E A;  3ULE C;  1MG3 A;  3RN1 D;  4JSP C;  4JT6 C;  3DM0 A;  4J77 A;  4FA5 D;  5FKS A;  2XYI A;  3I7L A;  2I0T A;  3EI4 B;  3RRM C;  3SFZ A;  1SQJ A;  4PNK B;  1SHY B;  4D0K A;  3SHF A;  3JZH A;  3SMR A;  1R5M A; 
#chains in the Genus database with same CATH topology
 4A2L A;  2AGL A;  4DNV A;  4A09 B;  5H14 A;  2AGZ A;  4O9D A;  3SWS D;  2WQ8 A;  4X61 B;  1FWX A;  5M5S A;  2AGW A;  5M5U A;  5IJ7 E;  4CZY A;  4BH6 A;  3NIG A;  3I7H A;  5CXB A;  3AH8 B;  3EQ8 A;  4IA9 A;  5GXI A;  4U1E I;  5FA5 B;  3JRO A;  1Q47 A;  2J55 H;  3MKQ A;  5AJA A;  2VDR A;  5FKQ A;  5I5M A;  4A08 A;  5EMM B;  5K1C C;  2IWF A;  2HKM A;  3RFG A;  4GZ8 A;  5CXC B;  2OVR B;  3OW8 A;  3OL2 A;  3F3G A;  2HKR A;  3SCY A;  3ODT A;  5HE1 B;  5E6U A;  4BCB A;  3OTT A;  1K32 A;  2XL2 A;  5FXY A;  4XYH A;  4GM8 A;  1OLZ A;  3IUL A;  1A0R B;  3RFH A;  5M5R A;  3ORV D;  3ZE0 A;  4GGD A;  1YR2 A;  3I2N A;  3K72 A;  5TEE A;  3NVX A;  2H6K A;  2P9K C;  1O6G A;  1XKS A;  5K19 A;  4H5I A;  3C99 A;  4MMX A;  2UZX B;  1UOQ A;  2OJY A;  3KRW B;  3EI3 B;  3PXW D;  4K3J B;  5KDO B;  4ERQ A;  4E54 B;  2CNX A;  3KCI A;  4L3G D;  4QQE A;  2B5M A;  4A11 B;  2OVP B;  4Z7Q A;  2XU7 A;  4J87 A;  5FKR A;  4QT8 A;  3L4O D;  3OKY B;  2J57 G;  4J79 A;  5CYK B;  4O3T B;  1GOG A;  3C5M A;  4FWW A;  1H2Y A;  1H2Z A;  2CO0 A;  5GXH A;  4FA1 D;  4AOW A;  4PBZ A;  2PM9 A;  4JSN C;  4ESG A;  3UVN A;  4FA9 D;  3IJC A;  3MXX A;  4X60 B;  3RSE C;  5FLX g;  1GOT B;  2H13 A;  2P9L C;  5M61 A;  4J8B A;  3RMZ D;  2YNN A;  3MMY A;  2B5N A;  4AEZ A;  4OWR A;  5E6S A;  1B9Y A;  3K6S A;  3IIY A;  3UVL A;  4J73 A;  1VZ2 A;  5I5J A;  3JAM g;  1TYQ C;  4R7A B;  4G56 B;  4NC4 A;  3IUN A;  4BUJ C;  3NIF A;  4NSX A;  5EAM A;  3KRX B;  3JZN A;  2PM6 B;  4G1E A;  4AMZ A;  2VDN A;  5THA A;  4BP9 A;  4WK0 A;  3V4V A;  2EIC A;  3UKR C;  4WK4 A;  5FFG A;  3RLM D;  2I0R A;  5C92 A;  4E5Z B;  3I7K A;  1U2V C;  1JTD B;  1UTC A;  3IJ0 A;  4ZOZ A;  2I0S A;  3L4M D;  4J82 A;  1U4C A;  1E8M A;  4XYI A;  2AQ5 A;  2H9M A;  3VGZ A;  1JJU B;  3BWS A;  3EI4 A;  3PVW B;  2HXC A;  2PM7 B;  1GG2 B;  3DSM A;  5HE2 B;  1H2X A;  3QI0 A;  2VC2 A;  3SXT D;  3JRP A;  5TF2 A;  1PI6 A;  2H9L A;  1L5G A;  1GP2 B;  4JXM A;  3GC3 B;  3UVO A;  3I8C A;  3I7P A;  4JHP C;  4UM8 A;  3GRE A;  2HJB A;  3MVD K;  3B7F A;  3MUN A;  5B4W A;  2G99 A;  4D6V A;  2GC7 A;  3VH0 A;  3N0D A;  2AH0 A;  3OF7 A;  1ERJ A;  3SN6 B;  1VE7 A;  4BL0 A;  4O45 A;  1K3I A;  4LG9 A;  4AN0 A;  2H68 A;  1N6F A;  4UI9 R;  4J8G A;  2EIB A;  5FQD A;  2TRC B;  4RE5 A;  4FAN D;  5M5V A;  1JMZ B;  1GXR A;  3EMH A;  3IIW A;  2B5L A;  2H14 A;  3HFQ A;  3MZL A;  5CXC A;  3BG0 A;  4G1M A;  2H6Q A;  4X3E A;  4Z8L A;  2HU5 A;  4I79 A;  2HU8 A;  2Z2O A;  2AH1 A;  4J0X A;  3UVM A;  4O2W A;  4CY1 A;  1XIP A;  4CY2 A;  5IGO A;  4ERY A;  4GGC A;  2OIZ A;  4A09 A;  5EMK B;  3T3M A;  4ZOV A;  4BP8 A;  4O1Q D;  2QR5 A;  3DWL C;  3IKO A;  4DNW A;  4RE6 A;  4CI1 A;  3SBR A;  2IAA A;  3ZDX A;  3IVM A;  4FB1 D;  2IUV A;  3MKS B;  4GM3 A;  1NR0 A;  3EI3 A;  4A0A B;  4E54 A;  3I7N A;  2CN3 A;  4ZOY A;  5HYN B;  3V7D B;  3EI2 B;  4A11 A;  4CY3 A;  2P9N C;  2CE9 A;  4JSX C;  5FFO A;  4CZX A;  5TDH B;  3OKY A;  2H3X A;  5C86 A;  4NAA A;  2IUQ A;  3FRX A;  3ZE2 A;  5CYK A;  5C9Z B;  2VDQ A;  2IUR A;  3OKT A;  4Z7O A;  3K26 A;  3PXS D;  3V9F A;  5C2V B;  3PSL A;  1C9L A;  4PBY A;  3IJ1 A;  2QXV A;  4A0B B;  4ZOX A;  5H17 A;  3AL8 B;  2OK6 A;  3IUJ A;  2VDO A;  3P4F A;  3JB9 L;  3VI4 A;  3W15 A;  2W18 A;  2H9P A;  2VDP A;  4HDJ A;  1PBY B;  3BG1 A;  5EAP A;  4JHN A;  2VDK A;  4QAM A;  1JOF A;  1NEX B;  3FGB A;  5E6R A;  3NVN A;  2OK4 A;  4A2M A;  1S4U X;  2YB8 B;  2IUP A;  4J78 A;  4ERZ A;  2BKL A;  4L3H D;  4Y5R D;  1RI6 A;  2H6N A;  3O4J A;  4JSV C;  1UOP A;  4J0W A;  2HES X;  3CIK B;  3SVW D;  5AFU 3;  1QFM A;  4AMY A;  3ZDZ A;  3AFC A;  2GNQ A;  4JT5 C;  4QRJ A;  5EM2 B;  4X63 B;  2BBK H;  1QFS A;  2PBI B;  2P9I C;  4UM9 A;  5GSA A;  4J81 A;  2EID A;  2VDM A;  2P9U C;  2YMU A;  5TEF A;  4E5Z A;  1UOO A;  5JWZ A;  2CO0 C;  3JPX A;  2Z2N A;  3IJE A;  4LG8 A;  1MDA H;  3ZWL B;  3NID A;  2EBS A;  4AN1 A;  3J81 g;  3IUR A;  4J86 A;  1JMX B;  3CFV A;  4PC0 A;  3SJL D;  3A0F A;  4ZN4 A;  4Y7R A;  3ZDY A;  3N0E A;  1JV2 A;  5HQG A;  4EWR A;  2P9S C;  4ES0 A;  3IUM A;  4K3I D;  3EU7 A;  1OMW B;  3EI1 B;  1TBG A;  3FCS A;  4NEN A;  3K27 A;  3EI1 A;  3PXT D;  4CI2 A;  2XDW A;  3MZK A;  3ZE1 A;  2VDL A;  2I3T A;  3U4Y A;  2I3S A;  2Q7Q A;  1P22 A;  2IWK A;  4CI3 A;  2YNP A;  5CXB B;  3IUQ A;  5H1M A;  4O02 A;  2BCJ B;  4A7J A;  3EG6 A;  5M5T A;  4J84 A;  3PSC B;  2JKX A;  3EQ9 A;  1O6F A;  1N6D A;  4MMY A;  3MUO A;  4A08 B;  3JZG A;  2VZ1 A;  4GQB B;  1GOF A;  4BCC A;  1C9I A;  3O4G A;  1E8N A;  5HE0 B;  4IRZ A;  3F3P A;  5I5I A;  3OL2 B;  1H2W A;  2H9N A;  3EWE A;  1L0Q A;  4QL1 A;  3C9C A;  2GC4 A;  5EML B;  4GGA A;  4MK0 B;  5IGQ A;  1M1X A;  2G9A A;  4NBM A;  4CI8 A;  4LGN A;  5HDB A;  3V5W B;  3AL9 A;  2XL3 A;  4OZU A;  4A0A A;  2CE8 A;  4KFM B;  1PEV A;  3I89 A;  4IMM A;  5FKT A;  4L1Q D;  3EI2 A;  4FHL A;  3PVU B;  3EQ7 A;  3SBQ A;  4O3U B;  1VE6 A;  4H5J A;  3GD1 I;  1U8C A;  3VI3 A;  1I2M B;  2HU7 A;  3NVQ A;  5EMJ B;  3SBP A;  2CN2 A;  3FCU A;  2QC5 A;  4YVD A;  2H47 A;  1B9X A;  5HE3 B;  4GQ2 P;  3SLE D;  4A0B A;  2MTA H;  4DNU A;  5C2W B;  1MG2 A;  3AL8 A;  1QNI A;  2AGY A;  2XE4 A;  2AGX A;  3O4H A;  4AX4 A;  4Z7N A;  4L1M A;  1T2X A;  2HYE A;  3OKW A;  3RN0 D;  3O4I A;  1A12 A;  5EAL A;  2PM9 B;  2YBA A;  2QZP A;  1N6E A;  2OVQ B;  5IT9 g;  2J56 H;  3DXK C;  3PE7 A;  5IC7 A;  4N14 A;  3CFS B;  4G55 A;  4MMZ A;  2EIE A;  3UR4 A;  3UKU C;  3DXM C;  5IJ8 E;  4GMB A;  4TZ4 A;  2YNO A;  2O9K A;  3I7O A;  4PXW A;  2HJ4 A;  4CZV A;  4BCD A;  4FA4 D;  5SXM A;  4FAV D;  1XHM A;  1SQ9 A;  1VZ3 A;  5EM2 A;  2Z2P A;  3K71 A;  4WK2 A;  1VYH C;  3J80 g;  4XEI C;  3C75 H;  2XZG A;  3VA6 A;  1BPO A;  1GOH A;  3QHY B;  4JD2 C;  1E5T A;  4CY5 A;  2B4E A;  3F3F A;  5GMK n;  2P9P C;  3FM0 A;  4U7A A;  2UZY B;  4GQ1 A;  3V4P A;  3DDU A;  5EAR A;  3GFC A;  4GM9 A;  4PSX B;  1TYE A;  3UVK A;  4CC9 A;  1PGU A;  4L9O A;  3T3P A;  1YFQ A;  1K8K C;  5AMS A;  4PSW B;  5A2Q g;  3E0C A;  3I8E A;  2VZ3 A;  3ULE C;  1MG3 A;  3RN1 D;  4JSP C;  4JT6 C;  3DM0 A;  4J77 A;  4FA5 D;  5FKS A;  2XYI A;  3I7L A;  2I0T A;  4WJK A;  3EI4 B;  3RRM C;  3SFZ A;  1SQJ A;  4PNK B;  1SHY B;  4D0K A;  4D9S A;  3SHF A;  3JZH A;  3SMR A;  1R5M A; 
#chains in the Genus database with same CATH homology
 4A2L A;  2AGL A;  4A09 B;  5H14 A;  2AGZ A;  4O9D A;  3SWS D;  4X61 B;  1FWX A;  2AGW A;  5IJ7 E;  4CZY A;  4BH6 A;  3I7H A;  5CXB A;  3AH8 B;  4IA9 A;  5GXI A;  4U1E I;  5FA5 B;  3JRO A;  1Q47 A;  2J55 H;  3MKQ A;  5AJA A;  5FKQ A;  5I5M A;  4A08 A;  5EMM B;  5K1C C;  2IWF A;  2HKM A;  3RFG A;  4GZ8 A;  5CXC B;  2OVR B;  3OW8 A;  3OL2 A;  3F3G A;  2HKR A;  3SCY A;  3ODT A;  5HE1 B;  3OTT A;  1K32 A;  2XL2 A;  5FXY A;  4XYH A;  4GM8 A;  1OLZ A;  1A0R B;  3RFH A;  3ORV D;  4GGD A;  3I2N A;  5TEE A;  3NVX A;  2H6K A;  2P9K C;  1XKS A;  5K19 A;  4H5I A;  3C99 A;  2UZX B;  2OJY A;  3KRW B;  3EI3 B;  3PXW D;  4K3J B;  5KDO B;  4ERQ A;  4E54 B;  2CNX A;  4L3G D;  4QQE A;  2B5M A;  4A11 B;  2OVP B;  2XU7 A;  4J87 A;  5FKR A;  4QT8 A;  3L4O D;  3OKY B;  2J57 G;  4J79 A;  5CYK B;  4O3T B;  3C5M A;  4FWW A;  2CO0 A;  5GXH A;  4FA1 D;  4AOW A;  4PBZ A;  2PM9 A;  4JSN C;  4ESG A;  3UVN A;  4FA9 D;  3IJC A;  3MXX A;  4X60 B;  3RSE C;  5FLX g;  1GOT B;  2H13 A;  2P9L C;  4J8B A;  3RMZ D;  2YNN A;  3MMY A;  2B5N A;  4AEZ A;  4OWR A;  1B9Y A;  3IIY A;  3UVL A;  4J73 A;  5I5J A;  3JAM g;  1TYQ C;  4R7A B;  4G56 B;  4BUJ C;  4NSX A;  5EAM A;  3KRX B;  3JZN A;  2PM6 B;  5THA A;  3UKR C;  3RLM D;  2I0R A;  4E5Z B;  3I7K A;  1U2V C;  3IJ0 A;  4ZOZ A;  2I0S A;  3L4M D;  4J82 A;  1U4C A;  4XYI A;  2AQ5 A;  2H9M A;  3VGZ A;  1JJU B;  3BWS A;  3EI4 A;  3PVW B;  2HXC A;  2PM7 B;  1GG2 B;  3DSM A;  5HE2 B;  3SXT D;  3JRP A;  5TF2 A;  1PI6 A;  2H9L A;  4JXM A;  1GP2 B;  4A09 A;  3UVO A;  3I8C A;  3I7P A;  3GRE A;  2HJB A;  3B7F A;  5B4W A;  2G99 A;  4D6V A;  2GC7 A;  3VH0 A;  3N0D A;  2AH0 A;  1ERJ A;  3SN6 B;  4BL0 A;  4O45 A;  4LG9 A;  2H68 A;  1N6F A;  4UI9 R;  4J8G A;  5FQD A;  2TRC B;  4FAN D;  1JMZ B;  1GXR A;  3EMH A;  3IIW A;  2B5L A;  2H14 A;  3HFQ A;  3MZL A;  5CXC A;  3BG0 A;  2H6Q A;  4X3E A;  4Z8L A;  4I79 A;  2Z2O A;  2AH1 A;  4J0X A;  3UVM A;  4CY1 A;  1XIP A;  4CY2 A;  5IGO A;  4ERY A;  4GGC A;  2OIZ A;  5EMK B;  4ZOV A;  4O1Q D;  3DWL C;  3IKO A;  4CI1 A;  3SBR A;  2IAA A;  4FB1 D;  2IUV A;  3MKS B;  4GM3 A;  1NR0 A;  3EI3 A;  4A0A B;  4E54 A;  3I7N A;  2CN3 A;  4ZOY A;  5HYN B;  3V7D B;  3EI2 B;  4A11 A;  4CY3 A;  2P9N C;  2CE9 A;  4JSX C;  4CZX A;  5TDH B;  3OKY A;  2H3X A;  2IUQ A;  3FRX A;  5CYK A;  5C9Z B;  3OKT A;  2IUR A;  3K26 A;  3PXS D;  3V9F A;  5C2V B;  3PSL A;  4PBY A;  3IJ1 A;  2QXV A;  4A0B B;  4ZOX A;  5H17 A;  3AL8 B;  2OK6 A;  3P4F A;  3JB9 L;  3W15 A;  2W18 A;  2H9P A;  4HDJ A;  1PBY B;  3BG1 A;  5EAP A;  1JOF A;  1NEX B;  3FGB A;  3NVN A;  2OK4 A;  4A2M A;  1S4U X;  2YB8 B;  2IUP A;  4J78 A;  4ERZ A;  4L3H D;  4Y5R D;  1RI6 A;  2H6N A;  4JSV C;  4J0W A;  2HES X;  3CIK B;  3SVW D;  5AFU 3;  3AFC A;  2GNQ A;  4JT5 C;  4QRJ A;  5EM2 B;  4X63 B;  2BBK H;  2PBI B;  2P9I C;  5GSA A;  4J81 A;  2P9U C;  2YMU A;  5TEF A;  4E5Z A;  5JWZ A;  2CO0 C;  3JPX A;  2Z2N A;  4LG8 A;  1MDA H;  3ZWL B;  2EBS A;  3J81 g;  4J86 A;  1JMX B;  3CFV A;  4PC0 A;  3SJL D;  3A0F A;  4ZN4 A;  4Y7R A;  3N0E A;  5HQG A;  4EWR A;  2P9S C;  4ES0 A;  4K3I D;  3EU7 A;  1OMW B;  3EI1 B;  1TBG A;  3K27 A;  3EI1 A;  3PXT D;  4CI2 A;  3MZK A;  2I3T A;  3U4Y A;  2I3S A;  2Q7Q A;  1P22 A;  2IWK A;  4CI3 A;  2YNP A;  5CXB B;  5H1M A;  2BCJ B;  4A7J A;  3EG6 A;  4J84 A;  3PSC B;  1N6D A;  4A08 B;  3JZG A;  4GQB B;  5HE0 B;  3F3P A;  5I5I A;  3OL2 B;  2H9N A;  3EWE A;  1L0Q A;  4QL1 A;  3C9C A;  2GC4 A;  5EML B;  4GGA A;  4MK0 B;  5IGQ A;  2G9A A;  4CI8 A;  4LGN A;  3V5W B;  3AL9 A;  2XL3 A;  4OZU A;  4A0A A;  2CE8 A;  4KFM B;  1PEV A;  3I89 A;  4IMM A;  5FKT A;  4L1Q D;  3EI2 A;  4FHL A;  3PVU B;  3SBQ A;  4O3U B;  4H5J A;  3NVQ A;  5EMJ B;  3SBP A;  2CN2 A;  2QC5 A;  4YVD A;  2H47 A;  1B9X A;  5HE3 B;  4GQ2 P;  3SLE D;  4A0B A;  2MTA H;  5C2W B;  1MG2 A;  3AL8 A;  1QNI A;  2AGY A;  2AGX A;  2HYE A;  3OKW A;  3RN0 D;  5EAL A;  2PM9 B;  2YBA A;  1N6E A;  2OVQ B;  5IT9 g;  2J56 H;  3DXK C;  3PE7 A;  5IC7 A;  4N14 A;  3CFS B;  3UR4 A;  3UKU C;  3DXM C;  5IJ8 E;  4GMB A;  4TZ4 A;  2YNO A;  2O9K A;  3I7O A;  4PXW A;  2HJ4 A;  4CZV A;  4FA4 D;  5SXM A;  4FAV D;  1XHM A;  1SQ9 A;  5EM2 A;  2Z2P A;  1VYH C;  3J80 g;  4XEI C;  3C75 H;  3VA6 A;  4JD2 C;  4CY5 A;  2B4E A;  3F3F A;  5GMK n;  2P9P C;  3FM0 A;  4U7A A;  2UZY B;  4GQ1 A;  5EAR A;  3GFC A;  4GM9 A;  4PSX B;  4CC9 A;  3UVK A;  1PGU A;  4L9O A;  1YFQ A;  1K8K C;  5AMS A;  4PSW B;  5A2Q g;  3E0C A;  3I8E A;  3ULE C;  1MG3 A;  3RN1 D;  4JSP C;  4JT6 C;  3DM0 A;  4J77 A;  4FA5 D;  5FKS A;  2XYI A;  3I7L A;  2I0T A;  3EI4 B;  3RRM C;  3SFZ A;  1SQJ A;  4PNK B;  1SHY B;  4D0K A;  3SHF A;  3JZH A;  3SMR A;  1R5M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...