4FA1D

Crystal structure of wt maug in complex with pre-methylamine dehydrogenase aged 130 days.
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
376
structure length
376
Chain Sequence
QETQGQAAARAAAADLAAGQDDEPRILEAPAPDARRVYVNDPAHFAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVEVFDPVTLLPTADIELPDAPRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTFFMHCRDGSLAKVAFGTEGTPEITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEAERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRFVVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALSTGDKTLYIHDAESGEELRSVNQLGHGPQVITTADMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylamine utilization protein MauG
publication title Diradical intermediate within the context of tryptophan tryptophylquinone biosynthesis.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Oxidoreductase/electron transport
total genus 96
structure length 376
sequence length 376
chains with identical sequence F
ec nomenclature
pdb deposition date 2012-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4fa1D00
2B5MA 3EMHA 2HJBA 4I79A 2XL3A 5CXBA 3JZNA 3W15A 4JT5C 3RLMD 3B7FA 3SCYA 2B5NA 3SFZA 4A2MA 4CZYA 4FAND 4A08A 2H9LA 2IUQA 3PXTD 4A0AB 3MMYA 2YB8B 2P9PC 2HESX 4XEIC 1TBGA 2BCJB 3EI3B 2H9MA 2TRCB 3NVQA 3SBPA 3I7OA 2OVRB 3C99A 3IKOA 5CYKB 2IURA 3I8CA 4ZOVA 5CXCB 2B4EA 3BG0A 3CFVA 4MK0B 2I0TA 2AGWA 5HQGA 4GM9A 4J73A 4JSVC 5EMLB 2HJ4A 5HE2B 4E5ZB 4A2LA 2CN2A 2H9PA 4FB1D 4ZOXA 4CY3A 4L3HD 4J79A 4PBZA 4ZOZA 4GGAA 2G99A 5TDHB 2CN3A 3OL2A 5IJ8E 5H14A 5AFU3 4JSXC 2YNPA 2B5LA 5JWZA 4A7JA 4D0KA 5I5MA 2Z2PA 4LG9A 1JOFA 5EM2B 2IWFA 5HYNB 3DWLC 4GM8A 3DSMA 4E54B 4O3UB 4PSXB 3I7HA 2H14A 4EWRA 3OTTA 3DXKC 2P9NC 5FKTA 4ERQA 4PC0A 2I3TA 2J55H 3BWSA 4X61B 3JAMg 2XU7A 2W18A 3UKRC 2OVPB 5EMJB 4J78A 4O1QD 4PBYA 2Z2NA 4J0XA 2Q7QA 4J8GA 3V9FA 4N14A 4FA9D 3E0CA 4H5IA 1N6FA 3EU7A 3OKTA 4PNKB 5FKSA 3CFSB 3PSLA 5TEEA 4PSWB 3L4MD 3IJ0A 4J87A 4CZVA 3V5WB 4ZN4A 3JB9L 5KDOB 3JPXA 3J80g 1MG3A 2GC7A 2I3SA 3EI2B 4O9DA 2IUVA 2P9UC 2O9KA 5FQDA 4X3EA 4JSNC 5IGQA 5EAMA 2YMUA 1K32A 2CNXA 1L0QA 2QC5A 1SQ9A 2AGLA 2PM6B 3EI3A 4ERZA 3MKQA 2OIZA 2CO0C 3SBRA 5CYKA 1JMXB 1OLZA 3OW8A 3SBQA 5EARA 4GM3A 4K3ID 4ESGA 1SQJA 5CXCA 1R5MA 1FWXA 2MTAH 4FA1D 1JJUB 4J0WA 5IC7A 4CI2A 2PM9B 5TF2A 4CI3A 5IJ7E 4E5ZA 3UVKA 5I5IA 1XHMA 2OJYA 3SVWD 3F3GA 4H5JA 3SXTD 3IJ1A 2OK6A 3C9CA 3PSCB 4GGCA 3VH0A 3RFGA 4R7AB 3VA6A 2H13A 3OKYB 2H6KA 4X63B 4IA9A 2PM7B 5EM2A 4QT8A 1A0RB 4E54A 4A11B 4CY1A 4U1EI 4ZOYA 1XIPA 4Y5RD 3N0DA 1PI6A 3N0EA 4CZXA 1U2VC 4O45A 4ES0A 2H3XA 1GOTB 3FM0A 1B9YA 2AGXA 5FA5B 5HE0B 5FXYA 2GC4A 1NEXB 2YBAA 4G56B 4L3GD 1MG2A 2H47A 4ERYA 3ODTA 5FKRA 5THAA 4LGNA 3J81g 1OMWB 4J82A 1XKSA 5TEFA 2AQ5A 4L9OA 2P9LC 3I89A 4FHLA 2BBKH 3SMRA 2XYIA 4BUJC 4IMMA 4GMBA 2UZYB 3I7KA 2EBSA 2Z2OA 3EI2A 3ZWLB 5B4WA 1B9XA 2GNQA 4NSXA 2YNOA 5IGOA 1VYHC 3EI4B 3I7NA 2XL2A 3IIYA 3ORVD 4PXWA 1PGUA 2P9KC 4QRJA 4CI1A 4OZUA 3FRXA 3A0FA 2AGZA 4XYIA 4J81A 4J86A 3PXWD 3ULEC 1U4CA 1Q47A 4QQEA 3I2NA 2PM9A 4GQ1A 1JMZB 1N6EA 3UKUC 4XYHA 2I0RA 3UVMA 3U4YA 3I7LA 3VGZA 2CE8A 3SLED 3JRPA 4A0BA 3AL8B 2CO0A 3SJLD 4LG8A 2PBIB 3EG6A 1GP2B 4JXMA 4L1QD 3K26A 3OKYA 4K3JB 4HDJA 4QL1A 4A09B 2HKRA 5IT9g 2H9NA 5H1MA 4OWRA 3F3PA 4CI8A 4CC9A 2HXCA 3MKSB 3I8EA 4A11A 3K27A 4D6VA 1PBYB 4A0BB 3HFQA 3PXSD 5FLXg 3RN1D 3EI1B 3MXXA 5EALA 5K19A 4FWWA 3C75H 3C5MA 2H6NA 3RSEC 3IJCA 2J57G 1S4UX 4Y7RA 3AH8B 2CE9A 4YVDA 4AOWA 2YNNA 5EAPA 3UVLA 2AH0A 3PVWB 5HE1B 3IIWA 5CXBB 2IWKA 2IAAA 2IUPA 5H17A 3UVNA 5GMKn 4KFMB 3F3FA 3GFCA 1K8KC 4GQBB 4J8BA 3GREA 3DXMC 3NVXA 3FGBA 4CY2A 5AMSA 4A08B 4Z8LA 5GXHA 4TZ4A 4FA4D 2QXVA 3RFHA 1PEVA 4FAVD 3PE7A 2AH1A 1MDAH 3EI4A 3V7DB 5C2VB 3SWSD 3UR4A 5I5JA 4BH6A 2P9IC 4JD2C 1RI6A 5SXMA 3I7PA 5AJAA 5FKQA 5HE3B 3JZHA 4CY5A 4GGDA 4GQ2P 3SHFA 3OL2B 1P22A 5K1CC 4FA5D 2OVQB 3KRWB 3EWEA 3DM0A 1YFQA 5GXIA 2H6QA 2HYEA 3AL8A 4AEZA 3MZLA 5GSAA 3JZGA 1GG2B 2J56H 1SHYB 1ERJA 5EMKB 4JSPC 4A09A 2HKMA 2G9AA 3JROA 3MZKA 2I0SA 3AFCA 5A2Qg 1GXRA 1N6DA 4O3TB 4X60B 3P4FA 4U7AA 3RRMC 3OKWA 3CIKB 4JT6C 3RN0D 5EMMB 1QNIA 3EI1A 2UZXB 3L4OD 2AGYA 3UVOA 1NR0A 4J84A 4J77A 3PVUB 3KRXB 5C9ZB 4GZ8A 3AL9A 4A0AA 3SN6B 1TYQC 4BL0A 3BG1A 2P9SC 2H68A 4UI9R 3RMZD 5C2WB 2OK4A 3NVNA
chains in the Genus database with same CATH superfamily
2B5MA 3EMHA 2HJBA 4I79A 2XL3A 5CXBA 2QZPA 3JZNA 3W15A 4UM8A 4JT5C 3RLMD 3B7FA 3SCYA 2B5NA 3SFZA 4A2MA 4CZYA 4NC4A 4FAND 4A08A 1UOPA 2H9LA 2IUQA 3PXTD 4A0AB 3MMYA 2YB8B 3MVDK 4BCBA 2P9PC 4AMYA 2HESX 4XEIC 3IVMA 3KCIA 1TBGA 1QFSA 2BCJB 2H9MA 2TRCB 3EI3B 3NVQA 3SBPA 3I7OA 2OVRB 3C99A 3IKOA 5CYKB 4DNVA 2IURA 2VDQA 3I8CA 4ZOVA 5CXCB 2B4EA 3BG0A 3CFVA 4MK0B 2I0TA 2AGWA 5HQGA 1GOFA 4GM9A 4J73A 4JSVC 5EMLB 2HJ4A 5HE2B 4O2WA 4E5ZB 4A2LA 2CN2A 2H9PA 4FB1D 3IUNA 4D9SA 4ZOXA 3NIFA 4CY3A 4L3HD 3QI0A 4J79A 4PBZA 4GGAA 2G99A 4ZOZA 2CN3A 5TDHB 3OL2A 5IJ8E 5H14A 4QAMA 4AN0A 5AFU3 2VDMA 4JSXC 2YNPA 2B5LA 5JWZA 4A7JA 4D0KA 5M61A 5I5MA 2Z2PA 4LG9A 2VDLA 1VE7A 1JOFA 5EM2B 2IWFA 5HYNB 3DWLC 4GM8A 1O6FA 3ZDZA 3DSMA 4DNUA 4E54B 4O3UB 4PSXB 3I7HA 2H14A 1GOGA 4EWRA 1E8MA 4O02A 3OTTA 3DXKC 2P9NC 5FKTA 4ERQA 4PC0A 2I3TA 2J55H 3BWSA 4X61B 3JAMg 2XU7A 2W18A 3UKRC 2OVPB 5M5SA 5EMJB 5HDBA 4J78A 4O1QD 4PBYA 4DNWA 2Z2NA 4J0XA 2VZ3A 2Q7QA 2XE4A 4J8GA 3V9FA 4N14A 3T3MA 1QFMA 4FA9D 3E0CA 4H5IA 1N6FA 3EU7A 3OKTA 4PNKB 5FFGA 5FKSA 3CFSB 2VC2A 3PSLA 5TEEA 4PSWB 1JTDB 3L4MD 2XZGA 3IJ0A 4J87A 4CZVA 3V5WB 4ZN4A 3K6SA 3JB9L 5KDOB 3JPXA 3J80g 1MG3A 2GC7A 2I3SA 3EI2B 4O9DA 2IUVA 1UOOA 2HU8A 2HU7A 2P9UC 2O9KA 5FQDA 4X3EA 4JSNC 5IGQA 5EAMA 2YMUA 1K32A 2BKLA 2CNXA 1L0QA 2QC5A 1SQ9A 2AGLA 2PM6B 3EI3A 4ERZA 3MKQA 2OIZA 1M1XA 1VZ2A 2CO0C 3SBRA 5CYKA 1JMXB 1OLZA 3OW8A 3O4GA 4MMXA 1VE6A 3SBQA 4G1MA 5EARA 4GM3A 4K3ID 4ESGA 1SQJA 5CXCA 2HU5A 1R5MA 1FWXA 4WK4A 3ZE1A 2MTAH 4AMZA 4FA1D 1JJUB 2VDOA 4J0WA 4UM9A 5IC7A 4CI2A 2PM9B 5TF2A 4CI3A 5IJ7E 1UOQA 4E5ZA 3UVKA 5I5IA 1XHMA 2OJYA 5M5RA 3SVWD 3F3GA 3O4HA 4H5JA 3SXTD 3IJ1A 1H2ZA 3V4PA 2OK6A 3C9CA 3GD1I 3PSCB 4GGCA 3VH0A 3RFGA 3FCSA 4R7AB 3IJEA 4NENA 3VA6A 2EICA 2H13A 3OKYB 4JHPC 1C9IA 2H6KA 4X63B 4IA9A 2PM7B 5EM2A 4QT8A 1A0RB 3IUMA 4E54A 4RE5A 1K3IA 4A11B 4CY1A 4U1EI 1A12A 4ZOYA 1XIPA 4Y5RD 3N0DA 4L1MA 1PI6A 2VZ1A 3N0EA 4CZXA 3ZDXA 1U2VC 4O45A 4ES0A 2EIEA 3IURA 2H3XA 1GOTB 3FM0A 1B9YA 2AGXA 5FA5B 5HE0B 3IULA 5FXYA 2GC4A 4AN1A 1NEXB 2YBAA 4G56B 4L3GD 1MG2A 2H47A 4ERYA 4NBMA 3ODTA 5FKRA 5THAA 4LGNA 4WK0A 5E6UA 2VDNA 3J81g 1OMWB 4J82A 1XKSA 5TEFA 2AQ5A 3GC3B 3K72A 2P9LC 3I89A 4FHLA 4L9OA 2BBKH 3SMRA 5C86A 2XYIA 4BUJC 4IMMA 4GMBA 2UZYB 3I7KA 2EBSA 2Z2OA 3EI2A 3ZWLB 5B4WA 3ZDYA 1B9XA 2GNQA 4NSXA 2YNOA 4BCDA 5IGOA 1VYHC 3EI4B 3I7NA 5M5VA 5C92A 4Z7NA 3NIGA 2XL2A 3IIYA 3ORVD 4PXWA 1PGUA 2P9KC 4NAAA 1O6GA 4QRJA 3O4IA 4CI1A 4OZUA 3FRXA 3A0FA 2AGZA 4XYIA 4J81A 4J86A 3PXWD 3ULEC 1C9LA 3V4VA 1U4CA 1Q47A 4QQEA 3VI4A 3I2NA 1E8NA 2PM9A 4GQ1A 1JMZB 1N6EA 3UKUC 4XYHA 2I0RA 3UVMA 3U4YA 3VI3A 3I7LA 3FCUA 3VGZA 2CE8A 3SLED 3JRPA 3IUJA 4A0BA 3AL8B 4BP9A 2CO0A 2VDPA 3SJLD 4LG8A 3DDUA 2PBIB 3EG6A 1GP2B 4JXMA 4L1QD 3K26A 3OKYA 4K3JB 4HDJA 4QL1A 4A09B 2HKRA 5IT9g 2H9NA 5H1MA 4OWRA 3F3PA 4CI8A 3ZE2A 4CC9A 2HXCA 3MKSB 3I8EA 4A11A 3K27A 3EQ8A 1PBYB 4D6VA 4A0BB 3HFQA 3PXSD 5FLXg 1E5TA 3RN1D 3EI1B 3MXXA 5EALA 5K19A 4FWWA 5E6SA 4JHNA 3C75H 3C5MA 2H6NA 3RSEC 3IJCA 2J57G 1S4UX 4Y7RA 3AH8B 2CE9A 3ZE0A 4YVDA 4AOWA 2YNNA 5EAPA 3UVLA 2AH0A 3K71A 1UTCA 3PVWB 4MMZA 5HE1B 5E6RA 3IIWA 5CXBB 2IWKA 2IAAA 3MUNA 1I2MB 2IUPA 5H17A 3UVNA 5GMKn 3F3FA 4KFMB 4AX4A 3GFCA 1K8KC 4GQBB 1BPOA 4J8BA 3GREA 3DXMC 3NVXA 3FGBA 4CY2A 5AMSA 2QR5A 4A08B 4Z8LA 4Z7OA 4RE6A 5GXHA 4TZ4A 2XDWA 4G55A 4FA4D 2QXVA 3RFHA 4IRZA 5FFOA 2VDKA 1PEVA 4FAVD 1L5GA 3PE7A 2AH1A 1VZ3A 3EQ7A 1GOHA 1MDAH 3EI4A 3OF7A 3V7DB 5C2VB 1H2YA 3SWSD 3UR4A 5I5JA 4BP8A 4BH6A 2P9IC 4JD2C 4MMYA 1RI6A 5SXMA 1U8CA 3EQ9A 3I7PA 5AJAA 1H2WA 3JZHA 5FKQA 5HE3B 4CY5A 5M5UA 5M5TA 4GGDA 4GQ2P 1H2XA 2WQ8A 4WJKA 3SHFA 3OL2B 1P22A 5K1CC 4Z7QA 4FA5D 2JKXA 2OVQB 3KRWB 3EWEA 3DM0A 1YFQA 5GXIA 4WK2A 2H6QA 2HYEA 3AL8A 4AEZA 3MZLA 5GSAA 3JZGA 1GG2B 2J56H 1SHYB 3MUOA 3IUQA 1ERJA 5EMKB 4JSPC 4A09A 2HKMA 2G9AA 2EIDA 3JROA 3MZKA 2I0SA 3QHYB 3AFCA 5A2Qg 1GXRA 1N6DA 4O3TB 4X60B 3P4FA 4G1EA 4U7AA 3RRMC 4BCCA 1T2XA 3OKWA 3CIKB 4JT6C 3RN0D 5EMMB 1QNIA 3EI1A 3NIDA 2UZXB 3L4OD 2AGYA 3UVOA 1NR0A 4J84A 2VDRA 4J77A 3PVUB 3KRXB 5C9ZB 1YR2A 4GZ8A 1TYEA 3O4JA 3AL9A 4A0AA 3SN6B 1TYQC 4BL0A 3BG1A 2P9SC 2H68A 3T3PA 4UI9R 3RMZD 2EIBA 5C2WB 1JV2A 2OK4A 3NVNA
chains in the Genus database with same CATH topology
2B5MA 3EMHA 2HJBA 4I79A 2XL3A 5CXBA 3JZNA 3W15A 4JT5C 3RLMD 3B7FA 3SCYA 2B5NA 3SFZA 4A2MA 4CZYA 4FAND 4A08A 2H9LA 2IUQA 3PXTD 4A0AB 3MMYA 2YB8B 2P9PC 2HESX 4XEIC 1TBGA 2BCJB 3EI3B 2H9MA 2TRCB 3NVQA 3SBPA 3I7OA 2OVRB 3C99A 3IKOA 5CYKB 2IURA 3I8CA 4ZOVA 5CXCB 2B4EA 3BG0A 3CFVA 4MK0B 2I0TA 2AGWA 5HQGA 4GM9A 4J73A 4JSVC 5EMLB 2HJ4A 5HE2B 4E5ZB 4A2LA 2CN2A 2H9PA 4FB1D 4ZOXA 4CY3A 4L3HD 4J79A 4PBZA 4ZOZA 4GGAA 2G99A 5TDHB 2CN3A 3OL2A 5IJ8E 5H14A 5AFU3 4JSXC 2YNPA 2B5LA 5JWZA 4A7JA 4D0KA 5I5MA 2Z2PA 4LG9A 1JOFA 5EM2B 2IWFA 5HYNB 3DWLC 4GM8A 3DSMA 4E54B 4O3UB 4PSXB 3I7HA 2H14A 4EWRA 3OTTA 3DXKC 2P9NC 5FKTA 4ERQA 4PC0A 2I3TA 2J55H 3BWSA 4X61B 3JAMg 2XU7A 2W18A 3UKRC 2OVPB 5EMJB 4J78A 4O1QD 4PBYA 2Z2NA 4J0XA 2Q7QA 4J8GA 3V9FA 4N14A 4FA9D 3E0CA 4H5IA 1N6FA 3EU7A 3OKTA 4PNKB 5FKSA 3CFSB 3PSLA 5TEEA 4PSWB 3L4MD 3IJ0A 4J87A 4CZVA 3V5WB 4ZN4A 3JB9L 5KDOB 3JPXA 3J80g 1MG3A 2GC7A 2I3SA 3EI2B 4O9DA 2IUVA 2P9UC 2O9KA 5FQDA 4X3EA 4JSNC 5IGQA 5EAMA 2YMUA 1K32A 2CNXA 1L0QA 2QC5A 1SQ9A 2AGLA 2PM6B 3EI3A 4ERZA 3MKQA 2OIZA 2CO0C 3SBRA 5CYKA 1JMXB 1OLZA 3OW8A 3SBQA 5EARA 4GM3A 4K3ID 4ESGA 1SQJA 5CXCA 1R5MA 1FWXA 2MTAH 4FA1D 1JJUB 4J0WA 5IC7A 4CI2A 2PM9B 5TF2A 4CI3A 5IJ7E 4E5ZA 3UVKA 5I5IA 1XHMA 2OJYA 3SVWD 3F3GA 4H5JA 3SXTD 3IJ1A 2OK6A 3C9CA 3PSCB 4GGCA 3VH0A 3RFGA 4R7AB 3VA6A 2H13A 3OKYB 2H6KA 4X63B 4IA9A 2PM7B 5EM2A 4QT8A 1A0RB 4E54A 4A11B 4CY1A 4U1EI 4ZOYA 1XIPA 4Y5RD 3N0DA 1PI6A 3N0EA 4CZXA 1U2VC 4O45A 4ES0A 2H3XA 1GOTB 3FM0A 1B9YA 2AGXA 5FA5B 5HE0B 5FXYA 2GC4A 1NEXB 2YBAA 4G56B 4L3GD 1MG2A 2H47A 4ERYA 3ODTA 5FKRA 5THAA 4LGNA 3J81g 1OMWB 4J82A 1XKSA 5TEFA 2AQ5A 4L9OA 2P9LC 3I89A 4FHLA 2BBKH 3SMRA 2XYIA 4BUJC 4IMMA 4GMBA 2UZYB 3I7KA 2EBSA 2Z2OA 3EI2A 3ZWLB 5B4WA 1B9XA 2GNQA 4NSXA 2YNOA 5IGOA 1VYHC 3EI4B 3I7NA 2XL2A 3IIYA 3ORVD 4PXWA 1PGUA 2P9KC 4QRJA 4CI1A 4OZUA 3FRXA 3A0FA 2AGZA 4XYIA 4J81A 4J86A 3PXWD 3ULEC 1U4CA 1Q47A 4QQEA 3I2NA 2PM9A 4GQ1A 1JMZB 1N6EA 3UKUC 4XYHA 2I0RA 3UVMA 3U4YA 3I7LA 3VGZA 2CE8A 3SLED 3JRPA 4A0BA 3AL8B 2CO0A 3SJLD 4LG8A 2PBIB 3EG6A 1GP2B 4JXMA 4L1QD 3K26A 3OKYA 4K3JB 4HDJA 4QL1A 4A09B 2HKRA 5IT9g 2H9NA 5H1MA 4OWRA 3F3PA 4CI8A 4CC9A 2HXCA 3MKSB 3I8EA 4A11A 3K27A 4D6VA 1PBYB 4A0BB 3HFQA 3PXSD 5FLXg 3RN1D 3EI1B 3MXXA 5EALA 5K19A 4FWWA 3C75H 3C5MA 2H6NA 3RSEC 3IJCA 2J57G 1S4UX 4Y7RA 3AH8B 2CE9A 4YVDA 4AOWA 2YNNA 5EAPA 3UVLA 2AH0A 3PVWB 5HE1B 3IIWA 5CXBB 2IWKA 2IAAA 2IUPA 5H17A 3UVNA 5GMKn 4KFMB 3F3FA 3GFCA 1K8KC 4GQBB 4J8BA 3GREA 3DXMC 3NVXA 3FGBA 4CY2A 5AMSA 4A08B 4Z8LA 5GXHA 4TZ4A 4FA4D 2QXVA 3RFHA 1PEVA 4FAVD 3PE7A 2AH1A 1MDAH 3EI4A 3V7DB 5C2VB 3SWSD 3UR4A 5I5JA 4BH6A 2P9IC 4JD2C 1RI6A 5SXMA 3I7PA 5AJAA 5FKQA 5HE3B 3JZHA 4CY5A 4GGDA 4GQ2P 3SHFA 3OL2B 1P22A 5K1CC 4FA5D 2OVQB 3KRWB 3EWEA 3DM0A 1YFQA 5GXIA 2H6QA 2HYEA 3AL8A 4AEZA 3MZLA 5GSAA 3JZGA 1GG2B 2J56H 1SHYB 1ERJA 5EMKB 4JSPC 4A09A 2HKMA 2G9AA 3JROA 3MZKA 2I0SA 3AFCA 5A2Qg 1GXRA 1N6DA 4O3TB 4X60B 3P4FA 4U7AA 3RRMC 3OKWA 3CIKB 4JT6C 3RN0D 5EMMB 1QNIA 3EI1A 2UZXB 3L4OD 2AGYA 3UVOA 1NR0A 4J84A 4J77A 3PVUB 3KRXB 5C9ZB 4GZ8A 3AL9A 4A0AA 3SN6B 1TYQC 4BL0A 3BG1A 2P9SC 2H68A 4UI9R 3RMZD 5C2WB 2OK4A 3NVNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B5M A;  3EMH A;  2HJB A;  4I79 A;  2XL3 A;  5CXB A;  3JZN A;  3W15 A;  4JT5 C;  3RLM D;  3B7F A;  3SCY A;  2B5N A;  3SFZ A;  4A2M A;  4CZY A;  4FAN D;  4A08 A;  2H9L A;  2IUQ A;  3PXT D;  4A0A B;  3MMY A;  2YB8 B;  2P9P C;  2HES X;  4XEI C;  1TBG A;  2BCJ B;  3EI3 B;  2H9M A;  2TRC B;  3NVQ A;  3SBP A;  3I7O A;  2OVR B;  3C99 A;  3IKO A;  5CYK B;  2IUR A;  3I8C A;  4ZOV A;  5CXC B;  2B4E A;  3BG0 A;  3CFV A;  4MK0 B;  2I0T A;  2AGW A;  5HQG A;  4GM9 A;  4J73 A;  4JSV C;  5EML B;  2HJ4 A;  5HE2 B;  4E5Z B;  4A2L A;  2CN2 A;  2H9P A;  4FB1 D;  4ZOX A;  4CY3 A;  4L3H D;  4J79 A;  4PBZ A;  4ZOZ A;  4GGA A;  2G99 A;  5TDH B;  2CN3 A;  3OL2 A;  5IJ8 E;  5H14 A;  5AFU 3;  4JSX C;  2YNP A;  2B5L A;  5JWZ A;  4A7J A;  4D0K A;  5I5M A;  2Z2P A;  4LG9 A;  1JOF A;  5EM2 B;  2IWF A;  5HYN B;  3DWL C;  4GM8 A;  3DSM A;  4E54 B;  4O3U B;  4PSX B;  3I7H A;  2H14 A;  4EWR A;  3OTT A;  3DXK C;  2P9N C;  5FKT A;  4ERQ A;  4PC0 A;  2I3T A;  2J55 H;  3BWS A;  4X61 B;  3JAM g;  2XU7 A;  2W18 A;  3UKR C;  2OVP B;  5EMJ B;  4J78 A;  4O1Q D;  4PBY A;  2Z2N A;  4J0X A;  2Q7Q A;  4J8G A;  3V9F A;  4N14 A;  4FA9 D;  3E0C A;  4H5I A;  1N6F A;  3EU7 A;  3OKT A;  4PNK B;  5FKS A;  3CFS B;  3PSL A;  5TEE A;  4PSW B;  3L4M D;  3IJ0 A;  4J87 A;  4CZV A;  3V5W B;  4ZN4 A;  3JB9 L;  5KDO B;  3JPX A;  3J80 g;  1MG3 A;  2GC7 A;  2I3S A;  3EI2 B;  4O9D A;  2IUV A;  2P9U C;  2O9K A;  5FQD A;  4X3E A;  4JSN C;  5IGQ A;  5EAM A;  2YMU A;  1K32 A;  2CNX A;  1L0Q A;  2QC5 A;  1SQ9 A;  2AGL A;  2PM6 B;  3EI3 A;  4ERZ A;  3MKQ A;  2OIZ A;  2CO0 C;  3SBR A;  5CYK A;  1JMX B;  1OLZ A;  3OW8 A;  3SBQ A;  5EAR A;  4GM3 A;  4K3I D;  4ESG A;  1SQJ A;  5CXC A;  1R5M A;  1FWX A;  2MTA H;  4FA1 D;  1JJU B;  4J0W A;  5IC7 A;  4CI2 A;  2PM9 B;  5TF2 A;  4CI3 A;  5IJ7 E;  4E5Z A;  3UVK A;  5I5I A;  1XHM A;  2OJY A;  3SVW D;  3F3G A;  4H5J A;  3SXT D;  3IJ1 A;  2OK6 A;  3C9C A;  3PSC B;  4GGC A;  3VH0 A;  3RFG A;  4R7A B;  3VA6 A;  2H13 A;  3OKY B;  2H6K A;  4X63 B;  4IA9 A;  2PM7 B;  5EM2 A;  4QT8 A;  1A0R B;  4E54 A;  4A11 B;  4CY1 A;  4U1E I;  4ZOY A;  1XIP A;  4Y5R D;  3N0D A;  1PI6 A;  3N0E A;  4CZX A;  1U2V C;  4O45 A;  4ES0 A;  2H3X A;  1GOT B;  3FM0 A;  1B9Y A;  2AGX A;  5FA5 B;  5HE0 B;  5FXY A;  2GC4 A;  1NEX B;  2YBA A;  4G56 B;  4L3G D;  1MG2 A;  2H47 A;  4ERY A;  3ODT A;  5FKR A;  5THA A;  4LGN A;  3J81 g;  1OMW B;  4J82 A;  1XKS A;  5TEF A;  2AQ5 A;  4L9O A;  2P9L C;  3I89 A;  4FHL A;  2BBK H;  3SMR A;  2XYI A;  4BUJ C;  4IMM A;  4GMB A;  2UZY B;  3I7K A;  2EBS A;  2Z2O A;  3EI2 A;  3ZWL B;  5B4W A;  1B9X A;  2GNQ A;  4NSX A;  2YNO A;  5IGO A;  1VYH C;  3EI4 B;  3I7N A;  2XL2 A;  3IIY A;  3ORV D;  4PXW A;  1PGU A;  2P9K C;  4QRJ A;  4CI1 A;  4OZU A;  3FRX A;  3A0F A;  2AGZ A;  4XYI A;  4J81 A;  4J86 A;  3PXW D;  3ULE C;  1U4C A;  1Q47 A;  4QQE A;  3I2N A;  2PM9 A;  4GQ1 A;  1JMZ B;  1N6E A;  3UKU C;  4XYH A;  2I0R A;  3UVM A;  3U4Y A;  3I7L A;  3VGZ A;  2CE8 A;  3SLE D;  3JRP A;  4A0B A;  3AL8 B;  2CO0 A;  3SJL D;  4LG8 A;  2PBI B;  3EG6 A;  1GP2 B;  4JXM A;  4L1Q D;  3K26 A;  3OKY A;  4K3J B;  4HDJ A;  4QL1 A;  4A09 B;  2HKR A;  5IT9 g;  2H9N A;  5H1M A;  4OWR A;  3F3P A;  4CI8 A;  4CC9 A;  2HXC A;  3MKS B;  3I8E A;  4A11 A;  3K27 A;  4D6V A;  1PBY B;  4A0B B;  3HFQ A;  3PXS D;  5FLX g;  3RN1 D;  3EI1 B;  3MXX A;  5EAL A;  5K19 A;  4FWW A;  3C75 H;  3C5M A;  2H6N A;  3RSE C;  3IJC A;  2J57 G;  1S4U X;  4Y7R A;  3AH8 B;  2CE9 A;  4YVD A;  4AOW A;  2YNN A;  5EAP A;  3UVL A;  2AH0 A;  3PVW B;  5HE1 B;  3IIW A;  5CXB B;  2IWK A;  2IAA A;  2IUP A;  5H17 A;  3UVN A;  5GMK n;  4KFM B;  3F3F A;  3GFC A;  1K8K C;  4GQB B;  4J8B A;  3GRE A;  3DXM C;  3NVX A;  3FGB A;  4CY2 A;  5AMS A;  4A08 B;  4Z8L A;  5GXH A;  4TZ4 A;  4FA4 D;  2QXV A;  3RFH A;  1PEV A;  4FAV D;  3PE7 A;  2AH1 A;  1MDA H;  3EI4 A;  3V7D B;  5C2V B;  3SWS D;  3UR4 A;  5I5J A;  4BH6 A;  2P9I C;  4JD2 C;  1RI6 A;  5SXM A;  3I7P A;  5AJA A;  5FKQ A;  5HE3 B;  3JZH A;  4CY5 A;  4GGD A;  4GQ2 P;  3SHF A;  3OL2 B;  1P22 A;  5K1C C;  4FA5 D;  2OVQ B;  3KRW B;  3EWE A;  3DM0 A;  1YFQ A;  5GXI A;  2H6Q A;  2HYE A;  3AL8 A;  4AEZ A;  3MZL A;  5GSA A;  3JZG A;  1GG2 B;  2J56 H;  1SHY B;  1ERJ A;  5EMK B;  4JSP C;  4A09 A;  2HKM A;  2G9A A;  3JRO A;  3MZK A;  2I0S A;  3AFC A;  5A2Q g;  1GXR A;  1N6D A;  4O3T B;  4X60 B;  3P4F A;  4U7A A;  3RRM C;  3OKW A;  3CIK B;  4JT6 C;  3RN0 D;  5EMM B;  1QNI A;  3EI1 A;  2UZX B;  3L4O D;  2AGY A;  3UVO A;  1NR0 A;  4J84 A;  4J77 A;  3PVU B;  3KRX B;  5C9Z B;  4GZ8 A;  3AL9 A;  4A0A A;  3SN6 B;  1TYQ C;  4BL0 A;  3BG1 A;  2P9S C;  2H68 A;  4UI9 R;  3RMZ D;  5C2W B;  2OK4 A;  3NVN A; 
#chains in the Genus database with same CATH topology
 2B5M A;  3EMH A;  2HJB A;  4I79 A;  2XL3 A;  5CXB A;  2QZP A;  3JZN A;  3W15 A;  4UM8 A;  4JT5 C;  3RLM D;  3B7F A;  3SCY A;  2B5N A;  3SFZ A;  4A2M A;  4CZY A;  4NC4 A;  4FAN D;  4A08 A;  1UOP A;  2H9L A;  2IUQ A;  3PXT D;  4A0A B;  3MMY A;  2YB8 B;  3MVD K;  4BCB A;  2P9P C;  4AMY A;  2HES X;  4XEI C;  3IVM A;  3KCI A;  1TBG A;  1QFS A;  2BCJ B;  2H9M A;  2TRC B;  3EI3 B;  3NVQ A;  3SBP A;  3I7O A;  2OVR B;  3C99 A;  3IKO A;  5CYK B;  4DNV A;  2IUR A;  2VDQ A;  3I8C A;  4ZOV A;  5CXC B;  2B4E A;  3BG0 A;  3CFV A;  4MK0 B;  2I0T A;  2AGW A;  5HQG A;  1GOF A;  4GM9 A;  4J73 A;  4JSV C;  5EML B;  2HJ4 A;  5HE2 B;  4O2W A;  4E5Z B;  4A2L A;  2CN2 A;  2H9P A;  4FB1 D;  3IUN A;  4D9S A;  4ZOX A;  3NIF A;  4CY3 A;  4L3H D;  3QI0 A;  4J79 A;  4PBZ A;  4GGA A;  2G99 A;  4ZOZ A;  2CN3 A;  5TDH B;  3OL2 A;  5IJ8 E;  5H14 A;  4QAM A;  4AN0 A;  5AFU 3;  2VDM A;  4JSX C;  2YNP A;  2B5L A;  5JWZ A;  4A7J A;  4D0K A;  5M61 A;  5I5M A;  2Z2P A;  4LG9 A;  2VDL A;  1VE7 A;  1JOF A;  5EM2 B;  2IWF A;  5HYN B;  3DWL C;  4GM8 A;  1O6F A;  3ZDZ A;  3DSM A;  4DNU A;  4E54 B;  4O3U B;  4PSX B;  3I7H A;  2H14 A;  1GOG A;  4EWR A;  1E8M A;  4O02 A;  3OTT A;  3DXK C;  2P9N C;  5FKT A;  4ERQ A;  4PC0 A;  2I3T A;  2J55 H;  3BWS A;  4X61 B;  3JAM g;  2XU7 A;  2W18 A;  3UKR C;  2OVP B;  5M5S A;  5EMJ B;  5HDB A;  4J78 A;  4O1Q D;  4PBY A;  4DNW A;  2Z2N A;  4J0X A;  2VZ3 A;  2Q7Q A;  2XE4 A;  4J8G A;  3V9F A;  4N14 A;  3T3M A;  1QFM A;  4FA9 D;  3E0C A;  4H5I A;  1N6F A;  3EU7 A;  3OKT A;  4PNK B;  5FFG A;  5FKS A;  3CFS B;  2VC2 A;  3PSL A;  5TEE A;  4PSW B;  1JTD B;  3L4M D;  2XZG A;  3IJ0 A;  4J87 A;  4CZV A;  3V5W B;  4ZN4 A;  3K6S A;  3JB9 L;  5KDO B;  3JPX A;  3J80 g;  1MG3 A;  2GC7 A;  2I3S A;  3EI2 B;  4O9D A;  2IUV A;  1UOO A;  2HU8 A;  2HU7 A;  2P9U C;  2O9K A;  5FQD A;  4X3E A;  4JSN C;  5IGQ A;  5EAM A;  2YMU A;  1K32 A;  2BKL A;  2CNX A;  1L0Q A;  2QC5 A;  1SQ9 A;  2AGL A;  2PM6 B;  3EI3 A;  4ERZ A;  3MKQ A;  2OIZ A;  1M1X A;  1VZ2 A;  2CO0 C;  3SBR A;  5CYK A;  1JMX B;  1OLZ A;  3OW8 A;  3O4G A;  4MMX A;  1VE6 A;  3SBQ A;  4G1M A;  5EAR A;  4GM3 A;  4K3I D;  4ESG A;  1SQJ A;  5CXC A;  2HU5 A;  1R5M A;  1FWX A;  4WK4 A;  3ZE1 A;  2MTA H;  4AMZ A;  4FA1 D;  1JJU B;  2VDO A;  4J0W A;  4UM9 A;  5IC7 A;  4CI2 A;  2PM9 B;  5TF2 A;  4CI3 A;  5IJ7 E;  1UOQ A;  4E5Z A;  3UVK A;  5I5I A;  1XHM A;  2OJY A;  5M5R A;  3SVW D;  3F3G A;  3O4H A;  4H5J A;  3SXT D;  3IJ1 A;  1H2Z A;  3V4P A;  2OK6 A;  3C9C A;  3GD1 I;  3PSC B;  4GGC A;  3VH0 A;  3RFG A;  3FCS A;  4R7A B;  3IJE A;  4NEN A;  3VA6 A;  2EIC A;  2H13 A;  3OKY B;  4JHP C;  1C9I A;  2H6K A;  4X63 B;  4IA9 A;  2PM7 B;  5EM2 A;  4QT8 A;  1A0R B;  3IUM A;  4E54 A;  4RE5 A;  1K3I A;  4A11 B;  4CY1 A;  4U1E I;  1A12 A;  4ZOY A;  1XIP A;  4Y5R D;  3N0D A;  4L1M A;  1PI6 A;  2VZ1 A;  3N0E A;  4CZX A;  3ZDX A;  1U2V C;  4O45 A;  4ES0 A;  2EIE A;  3IUR A;  2H3X A;  1GOT B;  3FM0 A;  1B9Y A;  2AGX A;  5FA5 B;  5HE0 B;  3IUL A;  5FXY A;  2GC4 A;  4AN1 A;  1NEX B;  2YBA A;  4G56 B;  4L3G D;  1MG2 A;  2H47 A;  4ERY A;  4NBM A;  3ODT A;  5FKR A;  5THA A;  4LGN A;  4WK0 A;  5E6U A;  2VDN A;  3J81 g;  1OMW B;  4J82 A;  1XKS A;  5TEF A;  2AQ5 A;  3GC3 B;  3K72 A;  2P9L C;  3I89 A;  4FHL A;  4L9O A;  2BBK H;  3SMR A;  5C86 A;  2XYI A;  4BUJ C;  4IMM A;  4GMB A;  2UZY B;  3I7K A;  2EBS A;  2Z2O A;  3EI2 A;  3ZWL B;  5B4W A;  3ZDY A;  1B9X A;  2GNQ A;  4NSX A;  2YNO A;  4BCD A;  5IGO A;  1VYH C;  3EI4 B;  3I7N A;  5M5V A;  5C92 A;  4Z7N A;  3NIG A;  2XL2 A;  3IIY A;  3ORV D;  4PXW A;  1PGU A;  2P9K C;  4NAA A;  1O6G A;  4QRJ A;  3O4I A;  4CI1 A;  4OZU A;  3FRX A;  3A0F A;  2AGZ A;  4XYI A;  4J81 A;  4J86 A;  3PXW D;  3ULE C;  1C9L A;  3V4V A;  1U4C A;  1Q47 A;  4QQE A;  3VI4 A;  3I2N A;  1E8N A;  2PM9 A;  4GQ1 A;  1JMZ B;  1N6E A;  3UKU C;  4XYH A;  2I0R A;  3UVM A;  3U4Y A;  3VI3 A;  3I7L A;  3FCU A;  3VGZ A;  2CE8 A;  3SLE D;  3JRP A;  3IUJ A;  4A0B A;  3AL8 B;  4BP9 A;  2CO0 A;  2VDP A;  3SJL D;  4LG8 A;  3DDU A;  2PBI B;  3EG6 A;  1GP2 B;  4JXM A;  4L1Q D;  3K26 A;  3OKY A;  4K3J B;  4HDJ A;  4QL1 A;  4A09 B;  2HKR A;  5IT9 g;  2H9N A;  5H1M A;  4OWR A;  3F3P A;  4CI8 A;  3ZE2 A;  4CC9 A;  2HXC A;  3MKS B;  3I8E A;  4A11 A;  3K27 A;  3EQ8 A;  1PBY B;  4D6V A;  4A0B B;  3HFQ A;  3PXS D;  5FLX g;  1E5T A;  3RN1 D;  3EI1 B;  3MXX A;  5EAL A;  5K19 A;  4FWW A;  5E6S A;  4JHN A;  3C75 H;  3C5M A;  2H6N A;  3RSE C;  3IJC A;  2J57 G;  1S4U X;  4Y7R A;  3AH8 B;  2CE9 A;  3ZE0 A;  4YVD A;  4AOW A;  2YNN A;  5EAP A;  3UVL A;  2AH0 A;  3K71 A;  1UTC A;  3PVW B;  4MMZ A;  5HE1 B;  5E6R A;  3IIW A;  5CXB B;  2IWK A;  2IAA A;  3MUN A;  1I2M B;  2IUP A;  5H17 A;  3UVN A;  5GMK n;  3F3F A;  4KFM B;  4AX4 A;  3GFC A;  1K8K C;  4GQB B;  1BPO A;  4J8B A;  3GRE A;  3DXM C;  3NVX A;  3FGB A;  4CY2 A;  5AMS A;  2QR5 A;  4A08 B;  4Z8L A;  4Z7O A;  4RE6 A;  5GXH A;  4TZ4 A;  2XDW A;  4G55 A;  4FA4 D;  2QXV A;  3RFH A;  4IRZ A;  5FFO A;  2VDK A;  1PEV A;  4FAV D;  1L5G A;  3PE7 A;  2AH1 A;  1VZ3 A;  3EQ7 A;  1GOH A;  1MDA H;  3EI4 A;  3OF7 A;  3V7D B;  5C2V B;  1H2Y A;  3SWS D;  3UR4 A;  5I5J A;  4BP8 A;  4BH6 A;  2P9I C;  4JD2 C;  4MMY A;  1RI6 A;  5SXM A;  1U8C A;  3EQ9 A;  3I7P A;  5AJA A;  1H2W A;  3JZH A;  5FKQ A;  5HE3 B;  4CY5 A;  5M5U A;  5M5T A;  4GGD A;  4GQ2 P;  1H2X A;  2WQ8 A;  4WJK A;  3SHF A;  3OL2 B;  1P22 A;  5K1C C;  4Z7Q A;  4FA5 D;  2JKX A;  2OVQ B;  3KRW B;  3EWE A;  3DM0 A;  1YFQ A;  5GXI A;  4WK2 A;  2H6Q A;  2HYE A;  3AL8 A;  4AEZ A;  3MZL A;  5GSA A;  3JZG A;  1GG2 B;  2J56 H;  1SHY B;  3MUO A;  3IUQ A;  1ERJ A;  5EMK B;  4JSP C;  4A09 A;  2HKM A;  2G9A A;  2EID A;  3JRO A;  3MZK A;  2I0S A;  3QHY B;  3AFC A;  5A2Q g;  1GXR A;  1N6D A;  4O3T B;  4X60 B;  3P4F A;  4G1E A;  4U7A A;  3RRM C;  4BCC A;  1T2X A;  3OKW A;  3CIK B;  4JT6 C;  3RN0 D;  5EMM B;  1QNI A;  3EI1 A;  3NID A;  2UZX B;  3L4O D;  2AGY A;  3UVO A;  1NR0 A;  4J84 A;  2VDR A;  4J77 A;  3PVU B;  3KRX B;  5C9Z B;  1YR2 A;  4GZ8 A;  1TYE A;  3O4J A;  3AL9 A;  4A0A A;  3SN6 B;  1TYQ C;  4BL0 A;  3BG1 A;  2P9S C;  2H68 A;  3T3P A;  4UI9 R;  3RMZ D;  2EIB A;  5C2W B;  1JV2 A;  2OK4 A;  3NVN A; 
#chains in the Genus database with same CATH homology
 2B5M A;  3EMH A;  2HJB A;  4I79 A;  2XL3 A;  5CXB A;  3JZN A;  3W15 A;  4JT5 C;  3RLM D;  3B7F A;  3SCY A;  2B5N A;  3SFZ A;  4A2M A;  4CZY A;  4FAN D;  4A08 A;  2H9L A;  2IUQ A;  3PXT D;  4A0A B;  3MMY A;  2YB8 B;  2P9P C;  2HES X;  4XEI C;  1TBG A;  2BCJ B;  3EI3 B;  2H9M A;  2TRC B;  3NVQ A;  3SBP A;  3I7O A;  2OVR B;  3C99 A;  3IKO A;  5CYK B;  2IUR A;  3I8C A;  4ZOV A;  5CXC B;  2B4E A;  3BG0 A;  3CFV A;  4MK0 B;  2I0T A;  2AGW A;  5HQG A;  4GM9 A;  4J73 A;  4JSV C;  5EML B;  2HJ4 A;  5HE2 B;  4E5Z B;  4A2L A;  2CN2 A;  2H9P A;  4FB1 D;  4ZOX A;  4CY3 A;  4L3H D;  4J79 A;  4PBZ A;  4ZOZ A;  4GGA A;  2G99 A;  5TDH B;  2CN3 A;  3OL2 A;  5IJ8 E;  5H14 A;  5AFU 3;  4JSX C;  2YNP A;  2B5L A;  5JWZ A;  4A7J A;  4D0K A;  5I5M A;  2Z2P A;  4LG9 A;  1JOF A;  5EM2 B;  2IWF A;  5HYN B;  3DWL C;  4GM8 A;  3DSM A;  4E54 B;  4O3U B;  4PSX B;  3I7H A;  2H14 A;  4EWR A;  3OTT A;  3DXK C;  2P9N C;  5FKT A;  4ERQ A;  4PC0 A;  2I3T A;  2J55 H;  3BWS A;  4X61 B;  3JAM g;  2XU7 A;  2W18 A;  3UKR C;  2OVP B;  5EMJ B;  4J78 A;  4O1Q D;  4PBY A;  2Z2N A;  4J0X A;  2Q7Q A;  4J8G A;  3V9F A;  4N14 A;  4FA9 D;  3E0C A;  4H5I A;  1N6F A;  3EU7 A;  3OKT A;  4PNK B;  5FKS A;  3CFS B;  3PSL A;  5TEE A;  4PSW B;  3L4M D;  3IJ0 A;  4J87 A;  4CZV A;  3V5W B;  4ZN4 A;  3JB9 L;  5KDO B;  3JPX A;  3J80 g;  1MG3 A;  2GC7 A;  2I3S A;  3EI2 B;  4O9D A;  2IUV A;  2P9U C;  2O9K A;  5FQD A;  4X3E A;  4JSN C;  5IGQ A;  5EAM A;  2YMU A;  1K32 A;  2CNX A;  1L0Q A;  2QC5 A;  1SQ9 A;  2AGL A;  2PM6 B;  3EI3 A;  4ERZ A;  3MKQ A;  2OIZ A;  2CO0 C;  3SBR A;  5CYK A;  1JMX B;  1OLZ A;  3OW8 A;  3SBQ A;  5EAR A;  4GM3 A;  4K3I D;  4ESG A;  1SQJ A;  5CXC A;  1R5M A;  1FWX A;  2MTA H;  4FA1 D;  1JJU B;  4J0W A;  5IC7 A;  4CI2 A;  2PM9 B;  5TF2 A;  4CI3 A;  5IJ7 E;  4E5Z A;  3UVK A;  5I5I A;  1XHM A;  2OJY A;  3SVW D;  3F3G A;  4H5J A;  3SXT D;  3IJ1 A;  2OK6 A;  3C9C A;  3PSC B;  4GGC A;  3VH0 A;  3RFG A;  4R7A B;  3VA6 A;  2H13 A;  3OKY B;  2H6K A;  4X63 B;  4IA9 A;  2PM7 B;  5EM2 A;  4QT8 A;  1A0R B;  4E54 A;  4A11 B;  4CY1 A;  4U1E I;  4ZOY A;  1XIP A;  4Y5R D;  3N0D A;  1PI6 A;  3N0E A;  4CZX A;  1U2V C;  4O45 A;  4ES0 A;  2H3X A;  1GOT B;  3FM0 A;  1B9Y A;  2AGX A;  5FA5 B;  5HE0 B;  5FXY A;  2GC4 A;  1NEX B;  2YBA A;  4G56 B;  4L3G D;  1MG2 A;  2H47 A;  4ERY A;  3ODT A;  5FKR A;  5THA A;  4LGN A;  3J81 g;  1OMW B;  4J82 A;  1XKS A;  5TEF A;  2AQ5 A;  4L9O A;  2P9L C;  3I89 A;  4FHL A;  2BBK H;  3SMR A;  2XYI A;  4BUJ C;  4IMM A;  4GMB A;  2UZY B;  3I7K A;  2EBS A;  2Z2O A;  3EI2 A;  3ZWL B;  5B4W A;  1B9X A;  2GNQ A;  4NSX A;  2YNO A;  5IGO A;  1VYH C;  3EI4 B;  3I7N A;  2XL2 A;  3IIY A;  3ORV D;  4PXW A;  1PGU A;  2P9K C;  4QRJ A;  4CI1 A;  4OZU A;  3FRX A;  3A0F A;  2AGZ A;  4XYI A;  4J81 A;  4J86 A;  3PXW D;  3ULE C;  1U4C A;  1Q47 A;  4QQE A;  3I2N A;  2PM9 A;  4GQ1 A;  1JMZ B;  1N6E A;  3UKU C;  4XYH A;  2I0R A;  3UVM A;  3U4Y A;  3I7L A;  3VGZ A;  2CE8 A;  3SLE D;  3JRP A;  4A0B A;  3AL8 B;  2CO0 A;  3SJL D;  4LG8 A;  2PBI B;  3EG6 A;  1GP2 B;  4JXM A;  4L1Q D;  3K26 A;  3OKY A;  4K3J B;  4HDJ A;  4QL1 A;  4A09 B;  2HKR A;  5IT9 g;  2H9N A;  5H1M A;  4OWR A;  3F3P A;  4CI8 A;  4CC9 A;  2HXC A;  3MKS B;  3I8E A;  4A11 A;  3K27 A;  4D6V A;  1PBY B;  4A0B B;  3HFQ A;  3PXS D;  5FLX g;  3RN1 D;  3EI1 B;  3MXX A;  5EAL A;  5K19 A;  4FWW A;  3C75 H;  3C5M A;  2H6N A;  3RSE C;  3IJC A;  2J57 G;  1S4U X;  4Y7R A;  3AH8 B;  2CE9 A;  4YVD A;  4AOW A;  2YNN A;  5EAP A;  3UVL A;  2AH0 A;  3PVW B;  5HE1 B;  3IIW A;  5CXB B;  2IWK A;  2IAA A;  2IUP A;  5H17 A;  3UVN A;  5GMK n;  4KFM B;  3F3F A;  3GFC A;  1K8K C;  4GQB B;  4J8B A;  3GRE A;  3DXM C;  3NVX A;  3FGB A;  4CY2 A;  5AMS A;  4A08 B;  4Z8L A;  5GXH A;  4TZ4 A;  4FA4 D;  2QXV A;  3RFH A;  1PEV A;  4FAV D;  3PE7 A;  2AH1 A;  1MDA H;  3EI4 A;  3V7D B;  5C2V B;  3SWS D;  3UR4 A;  5I5J A;  4BH6 A;  2P9I C;  4JD2 C;  1RI6 A;  5SXM A;  3I7P A;  5AJA A;  5FKQ A;  5HE3 B;  3JZH A;  4CY5 A;  4GGD A;  4GQ2 P;  3SHF A;  3OL2 B;  1P22 A;  5K1C C;  4FA5 D;  2OVQ B;  3KRW B;  3EWE A;  3DM0 A;  1YFQ A;  5GXI A;  2H6Q A;  2HYE A;  3AL8 A;  4AEZ A;  3MZL A;  5GSA A;  3JZG A;  1GG2 B;  2J56 H;  1SHY B;  1ERJ A;  5EMK B;  4JSP C;  4A09 A;  2HKM A;  2G9A A;  3JRO A;  3MZK A;  2I0S A;  3AFC A;  5A2Q g;  1GXR A;  1N6D A;  4O3T B;  4X60 B;  3P4F A;  4U7A A;  3RRM C;  3OKW A;  3CIK B;  4JT6 C;  3RN0 D;  5EMM B;  1QNI A;  3EI1 A;  2UZX B;  3L4O D;  2AGY A;  3UVO A;  1NR0 A;  4J84 A;  4J77 A;  3PVU B;  3KRX B;  5C9Z B;  4GZ8 A;  3AL9 A;  4A0A A;  3SN6 B;  1TYQ C;  4BL0 A;  3BG1 A;  2P9S C;  2H68 A;  4UI9 R;  3RMZ D;  5C2W B;  2OK4 A;  3NVN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...