4J87A

Crystal structure of alpha-cop
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
327
structure length
316
Chain Sequence
MAMLTKFESRSSRAKGVAFHPTQPWILTSLHNGRIQLWDYRMGTLLDRFDGHDGPVRGIAFHPTQPIFVSGGDDYKVNVWNYKSRKLLFSLCGHMDYVRVCTFHHEYPWILSCSDDQTIRIWNWQSRNCIAILTGHSHYVMCAAFHPSEDLIVSASLDQTVRVWDISGLRMKNAAPVSMSKEDQKAQAADAIVKFVLEGHDRGVNWCAFHPTLPLILSAGDDRLVKLWRMTASKAWEVDTCRGHFNNVSCCLFHPHQELILSASEDKTIRVWDLNRRTAVQTFRRANDRFWFITVHPKLNLFAAAHDSGVMVFKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords coatomer subunit alpha
publication title Rules for the recognition of dilysine retrieval motifs by coatomer.
pubmed doi rcsb
total genus 79
structure length 316
sequence length 327
ec nomenclature
pdb deposition date 2013-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4j87A00
3B7FA 3EG6A 4BH6A 4A7JA 3P4FA 3I7NA 1P22A 2I0RA 4IA9A 4PNKB 2YNNA 3AL9A 4GM9A 3VGZA 4A08A 1GG2B 4D6VA 3ZWLB 4X61B 2PM6B 2AGYA 5HE1B 4JD2C 2PM9B 1SHYB 3HFQA 4CI3A 5IJ7E 4UI9R 2GC7A 2B5MA 1MDAH 2YB8B 5IJ8E 4PC0A 3SBQA 2HESX 4X60B 5C2WB 1FWXA 3JAMg 2HKMA 3C99A 2IUPA 4L9OA 4CY5A 2OK4A 5CYKB 2YNPA 3RFHA 1XKSA 3ODTA 3AH8B 2YNOA 1QNIA 5AFU3 3PSLA 3PVWB 5C9ZB 3F3PA 2AGXA 1NEXB 2G99A 5THAA 4ZOVA 4O3UB 4BL0A 3OKYA 1OLZA 3NVXA 4J86A 1K32A 4A0AB 1JJUB 5FQDA 3CFVA 4GGDA 2H9NA 2UZYB 2H3XA 5IC7A 1PBYB 4QRJA 3RFGA 4R7AB 1XIPA 2O9KA 3K26A 4E5ZB 5GMKn 3SN6B 3SCYA 2IAAA 4FWWA 5EARA 2B5LA 5IT9g 2BCJB 3SFZA 4KFMB 3FGBA 2H9LA 1YFQA 2CO0C 2AGLA 3MKQA 3UR4A 2B4EA 2XYIA 5H17A 2H13A 3EI2B 5FKRA 1SQJA 3J81g 3JZHA 4E54B 1NR0A 2H9MA 4H5IA 2CNXA 2IUVA 4A0BB 2P9UC 1TYQC 2J55H 3NVNA 3I2NA 2EBSA 4Y7RA 4J73A 3DXMC 5HE2B 3FRXA 4JT5C 4YVDA 3SVWD 3SBPA 1XHMA 1JMZB 3EI1A 2HJ4A 4L1QD 5CXBA 5TEEA 4CZXA 2GC4A 4ZOZA 1JOFA 4LG8A 2J56H 4J8GA 3SWSD 4OZUA 4FA4D 2P9NC 2YMUA 3OL2A 1PEVA 3JROA 3EWEA 5TDHB 3DXKC 3VH0A 3MZKA 4J8BA 1PGUA 3DM0A 3SMRA 1JMXB 3IKOA 3SXTD 4K3JB 3RLMD 5EMJB 4X63B 5HQGA 3EU7A 3EMHA 3IJCA 2YBAA 2IWFA 3PSCB 4JSVC 5FKSA 4PBYA 4GQBB 4J87A 4G56B 4AEZA 4FAVD 2PM9A 2UZXB 4ZOYA 3W15A 1OMWB 3I8EA 4GM3A 5EAMA 3ULEC 3K27A 1GOTB 4PBZA 4XYHA 5FXYA 2OK6A 4X3EA 5CXCB 1N6DA 3JZGA 4HDJA 2Z2OA 4ERYA 4LGNA 4NSXA 3PVUB 3I7KA 5TF2A 5CYKA 4PSXB 2XU7A 5EMLB 5EM2B 3E0CA 2P9SC 2Z2NA 4N14A 4FA9D 5K19A 1MG2A 3PXTD 3BG1A 4XYIA 3I7HA 4Z8LA 3AL8B 3RSEC 4L3HD 3U4YA 4GMBA 5SXMA 3UVLA 5EM2A 2J57G 1MG3A 4PXWA 2XL2A 4A09B 3EI3B 3PXSD 4CY2A 3EI4B 3GREA 2H6NA 4A0AA 4GGAA 4J77A 2H9PA 3I89A 3MMYA 4ES0A 4O1QD 3CFSB 2IWKA 4JSNC 4TZ4A 5EAPA 5IGOA 1R5MA 3OW8A 4E5ZA 3N0DA 5AJAA 2I3TA 5I5IA 2XL3A 3OTTA 4A11B 3UKRC 4D0KA 2CE8A 3V9FA 5FLXg 1RI6A 3SLED 4ERZA 3C9CA 5GXHA 2I0SA 4XEIC 5H1MA 4GQ1A 2P9LC 4JT6C 4A11A 3EI2A 4J79A 4E54A 2GNQA 4A0BA 3IJ0A 3IJ1A 4GZ8A 4PSWB 5K1CC 3FM0A 2CE9A 3NVQA 4BUJC 1B9YA 2TRCB 4ESGA 2MTAH 4J84A 2I3SA 3I7OA 2HJBA 5FKQA 3RRMC 5IGQA 4L3GD 1SQ9A 4QQEA 4CZVA 4FAND 2AQ5A 5KDOB 4IMMA 3RN1D 3UVMA 3L4MD 3RN0D 2CN2A 1TBGA 3SHFA 5A2Qg 2W18A 3GFCA 1PI6A 3ORVD 3I8CA 4OWRA 5EALA 3IIYA 2QC5A 3UVNA 3PXWD 3OKWA 2OVRB 5C2VB 4CI1A 3UVKA 4O9DA 4K3ID 4MK0B 2H6QA 3I7PA 1Q47A 1A0RB 5AMSA 2B5NA 4FB1D 2OVPB 4Y5RD 5HYNB 3BG0A 2PM7B 3F3FA 3L4OD 1L0QA 2Z2PA 4JSPC 2IUQA 2IURA 1B9XA 3N0EA 3KRWB 4GQ2P 3MXXA 5HE0B 2AGZA 5I5JA 4J82A 4QL1A 4FHLA 4H5JA 2H6KA 3V7DB 4CI8A 3AFCA 3JB9L 5B4WA 3KRXB 1N6EA 4JXMA 3JPXA 5CXCA 2I0TA 3A0FA 3CIKB 4CI2A 3OKYB 4LG9A 4J81A 2PBIB 2QXVA 4CY1A 2CN3A 4ZN4A 3BWSA 2HXCA 1U4CA 2AH1A 3DWLC 4CZYA 4J0WA 5I5MA 2BBKH 5GSAA 1K8KC 3SJLD 3V5WB 2H14A 3MKSB 4GGCA 3AL8A 4AOWA 4A2MA 4ZOXA 3C5MA 4A09A 5EMMB 3EI3A 5HE3B 3EI4A 3C75H 3VA6A 1ERJA 3MZLA 5FA5B 4U1EI 3UVOA 2OIZA 4O45A 4EWRA 2OJYA 2H47A 2AH0A 2P9PC 2H68A 1GXRA 1S4UX 3DSMA 4CY3A 4U7AA 5H14A 4ERQA 3RMZD 4A2LA 4J78A 1U2VC 5EMKB 3SBRA 2HYEA 5FKTA 4J0XA 1VYHC 4QT8A 4CC9A 4FA5D 3F3GA 3EI1B 4I79A 3JZNA 5CXBB 3PE7A 2OVQB 3JRPA 2AGWA 2P9IC 1GP2B 4GM8A 2CO0A 3J80g 2HKRA 3I7LA 3OKTA 3IIWA 4FA1D 5GXIA 2P9KC 3UKUC 5TEFA 2Q7QA 4O3TB 2G9AA 5JWZA 3OL2B 4JSXC 4A08B 1N6FA
chains in the Genus database with same CATH superfamily
3B7FA 3EG6A 5C86A 3FCSA 4BH6A 4A7JA 4Z7QA 3P4FA 3I7NA 3K72A 3NIGA 3IURA 1P22A 2I0RA 4IA9A 4PNKB 1E5TA 2YNNA 3AL9A 4GM9A 1TYEA 3VGZA 4UM9A 1H2WA 4A08A 1GG2B 1QFMA 4D6VA 1BPOA 3ZWLB 4X61B 2PM6B 1H2YA 2AGYA 5HE1B 3O4GA 4JD2C 2PM9B 1SHYB 3HFQA 4CI3A 3MUNA 5IJ7E 4UI9R 2GC7A 2B5MA 1MDAH 2YB8B 5C92A 5IJ8E 4UM8A 4PC0A 2EICA 3SBQA 3NIFA 3T3PA 3ZDXA 1U8CA 2HESX 4X60B 5C2WB 1FWXA 5E6SA 3JAMg 2HKMA 3C99A 4JHNA 2IUPA 3MVDK 4L9OA 2VDNA 4NAAA 4CY5A 2OK4A 2HU5A 4MMZA 5CYKB 5FFOA 2YNPA 3RFHA 1XKSA 3ODTA 3T3MA 2VC2A 2EIEA 3AH8B 2YNOA 1QNIA 3O4HA 5M61A 5AFU3 3PSLA 4Z7NA 3PVWB 5C9ZB 3F3PA 2AGXA 1NEXB 2G99A 3V4PA 5THAA 4ZOVA 4O3UB 4QAMA 4BL0A 2XZGA 3OKYA 1OLZA 1VE6A 3NVXA 4J86A 1GOFA 1K32A 4A0AB 1JJUB 5FQDA 1L5GA 3CFVA 4GGDA 3IVMA 2H9NA 2UZYB 2H3XA 5IC7A 1PBYB 4QRJA 3RFGA 3IJEA 4R7AB 1XIPA 2O9KA 3K26A 4E5ZB 5GMKn 3SN6B 3SCYA 2IAAA 4FWWA 5EARA 1GOHA 2B5LA 5IT9g 2BCJB 3SFZA 1VZ3A 4KFMB 3FGBA 2H9LA 1YFQA 2CO0C 2AGLA 3MKQA 3UR4A 2B4EA 2XYIA 3EQ7A 4NENA 5H17A 2H13A 2VDMA 3IUJA 3EI2B 5FKRA 1SQJA 3J81g 3O4JA 3JZHA 4E54B 1NR0A 2H9MA 4H5IA 2CNXA 2IUVA 4A0BB 2P9UC 1TYQC 2J55H 2VDLA 3NVNA 3I2NA 5E6UA 2EBSA 4Y7RA 4J73A 3DXMC 5HE2B 3ZDZA 3FRXA 4JT5C 2QR5A 4YVDA 3SVWD 3SBPA 1XHMA 1JMZB 3EI1A 2QZPA 2HJ4A 3DDUA 4L1QD 5CXBA 5TEEA 4CZXA 2GC4A 4ZOZA 1JOFA 4LG8A 1QFSA 4G1EA 2J56H 2VDOA 4WK4A 4J8GA 2WQ8A 4G55A 4OZUA 3SWSD 4FA4D 2P9NC 4AN1A 1YR2A 2YMUA 3OL2A 1PEVA 3JROA 3EWEA 5TDHB 1T2XA 3DXKC 3VH0A 3MZKA 4J8BA 1PGUA 3DM0A 3SMRA 5M5SA 1JMXB 3IKOA 4G1MA 3SXTD 4NC4A 4K3JB 3RLMD 3O4IA 5EMJB 3QI0A 4X63B 5HQGA 3EU7A 3EMHA 3IJCA 2YBAA 2IWFA 3PSCB 1H2ZA 4JSVC 5FKSA 4PBYA 2JKXA 4GQBB 4MMYA 4J87A 4G56B 4AEZA 4AMYA 2PM9A 2UZXB 4FAVD 4ZOYA 3W15A 1OMWB 3I8EA 3K6SA 4GM3A 5EAMA 3ULEC 2VZ3A 3K27A 1GOTB 4PBZA 4XYHA 5FXYA 2OK6A 4X3EA 5CXCB 1N6DA 3JZGA 4HDJA 2Z2OA 4ERYA 4LGNA 4NSXA 3PVUB 3GC3B 3I7KA 5TF2A 5CYKA 1UTCA 4PSXB 2XU7A 5EMLB 3ZE2A 1O6FA 1E8NA 5EM2B 3E0CA 2P9SC 2Z2NA 3MUOA 4N14A 4FA9D 4IRZA 5K19A 1MG2A 3PXTD 3BG1A 4XYIA 3I7HA 4Z8LA 3AL8B 3RSEC 4L3HD 3U4YA 4GMBA 4BP9A 2VZ1A 5SXMA 3UVLA 5EM2A 2J57G 1MG3A 1E8MA 4PXWA 5M5RA 2XL2A 4AMZA 4A09B 5M5TA 3EI3B 3PXSD 4CY2A 3EI4B 3GREA 2H6NA 1UOOA 4A0AA 4O2WA 4GGAA 4J77A 2H9PA 2HU8A 3I89A 3MMYA 4ES0A 4O1QD 3CFSB 3ZE0A 2IWKA 5M5UA 4JSNC 4TZ4A 5EAPA 5IGOA 1R5MA 3OW8A 2EIDA 4E5ZA 3N0DA 5AJAA 2I3TA 5I5IA 2XL3A 3OTTA 4A11B 3UKRC 4D0KA 4DNVA 2CE8A 3V9FA 5FLXg 1RI6A 3SLED 4ERZA 3C9CA 5GXHA 2I0SA 4XEIC 5H1MA 4GQ1A 2P9LC 4JT6C 4A11A 3EI2A 4J79A 4E54A 2GNQA 3NIDA 4A0BA 3IJ0A 3IJ1A 4GZ8A 4PSWB 3QHYB 3FM0A 2CE9A 3NVQA 5K1CC 1B9YA 2TRCB 3ZE1A 4AX4A 4BUJC 2MTAH 3GD1I 4ESGA 4J84A 1GOGA 2I3SA 3I7OA 1UOQA 2HJBA 5FKQA 3RRMC 5IGQA 2XDWA 4L3GD 4RE6A 3VI4A 1SQ9A 4QQEA 4CZVA 2VDPA 4FAND 2AQ5A 5KDOB 4IMMA 3RN1D 1C9LA 3UVMA 1I2MB 3L4MD 3RN0D 2CN2A 1TBGA 5M5VA 3SHFA 5A2Qg 2W18A 1O6GA 3GFCA 1PI6A 3ORVD 3I8CA 4OWRA 5EALA 3K71A 3IIYA 2QC5A 3UVNA 3PXWD 3OKWA 2OVRB 3V4VA 5C2VB 4CI1A 3UVKA 4O9DA 4K3ID 4MK0B 2H6QA 2HU7A 3I7PA 1Q47A 1A0RB 3IUQA 5AMSA 3VI3A 2XE4A 2B5NA 3IUNA 4FB1D 2OVPB 4Y5RD 5HYNB 3BG0A 2PM7B 3F3FA 3L4OD 1K3IA 1L0QA 4JHPC 2Z2PA 4JSPC 2IUQA 2IURA 1B9XA 3N0EA 3KRWB 4BP8A 4WK2A 4GQ2P 3MXXA 5HE0B 2AGZA 2VDRA 5I5JA 4J82A 1VZ2A 4QL1A 4FHLA 4H5JA 2H6KA 1M1XA 3V7DB 4CI8A 3AFCA 3JB9L 5B4WA 2VDQA 3KRXB 1N6EA 4JXMA 3JPXA 5CXCA 2I0TA 1VE7A 3A0FA 3CIKB 3ZDYA 3FCUA 4CI2A 4RE5A 3OKYB 4NBMA 4LG9A 4J81A 2PBIB 2QXVA 4CY1A 2CN3A 4ZN4A 3BWSA 2HXCA 1U4CA 4AN0A 2AH1A 3DWLC 4CZYA 4J0WA 5I5MA 2BBKH 5GSAA 1K8KC 3SJLD 1H2XA 3IUMA 5E6RA 3V5WB 2H14A 3MKSB 4GGCA 3AL8A 4AOWA 4A2MA 4ZOXA 2VDKA 3C5MA 4A09A 5EMMB 3EI3A 5HE3B 3IULA 3EI4A 3C75H 3VA6A 1ERJA 2EIBA 3MZLA 5FA5B 4DNWA 4U1EI 3UVOA 2OIZA 4O45A 4EWRA 2OJYA 2H47A 2AH0A 2P9PC 2H68A 1GXRA 1S4UX 3DSMA 5HDBA 4CY3A 4U7AA 5H14A 3OF7A 4ERQA 4Z7OA 4MMXA 3RMZD 4A2LA 1C9IA 4J78A 1U2VC 5EMKB 3SBRA 2HYEA 5FKTA 3EQ9A 4J0XA 1VYHC 4QT8A 4CC9A 4FA5D 3KCIA 5FFGA 4BCCA 3F3GA 3EI1B 4I79A 3JZNA 5CXBB 2BKLA 3PE7A 2OVQB 3JRPA 2AGWA 2P9IC 1GP2B 4BCBA 4BCDA 4D9SA 4WJKA 1A12A 4GM8A 2CO0A 3J80g 2HKRA 3EQ8A 4DNUA 4L1MA 1JTDB 3I7LA 3OKTA 3IIWA 4O02A 4FA1D 5GXIA 1UOPA 2P9KC 3UKUC 5TEFA 2Q7QA 4O3TB 2G9AA 5JWZA 3OL2B 4JSXC 4A08B 1N6FA 4WK0A 1JV2A
chains in the Genus database with same CATH topology
3B7FA 3EG6A 4BH6A 4A7JA 3P4FA 3I7NA 1P22A 2I0RA 4IA9A 4PNKB 2YNNA 3AL9A 4GM9A 3VGZA 4A08A 1GG2B 4D6VA 3ZWLB 4X61B 2PM6B 2AGYA 5HE1B 4JD2C 2PM9B 1SHYB 3HFQA 4CI3A 5IJ7E 4UI9R 2GC7A 2B5MA 1MDAH 2YB8B 5IJ8E 4PC0A 3SBQA 2HESX 4X60B 5C2WB 1FWXA 3JAMg 2HKMA 3C99A 2IUPA 4L9OA 4CY5A 2OK4A 5CYKB 2YNPA 3RFHA 1XKSA 3ODTA 3AH8B 2YNOA 1QNIA 5AFU3 3PSLA 3PVWB 5C9ZB 3F3PA 2AGXA 1NEXB 2G99A 5THAA 4ZOVA 4O3UB 4BL0A 3OKYA 1OLZA 3NVXA 4J86A 1K32A 4A0AB 1JJUB 5FQDA 3CFVA 4GGDA 2H9NA 2UZYB 2H3XA 5IC7A 1PBYB 4QRJA 3RFGA 4R7AB 1XIPA 2O9KA 3K26A 4E5ZB 5GMKn 3SN6B 3SCYA 2IAAA 4FWWA 5EARA 2B5LA 5IT9g 2BCJB 3SFZA 4KFMB 3FGBA 2H9LA 1YFQA 2CO0C 2AGLA 3MKQA 3UR4A 2B4EA 2XYIA 5H17A 2H13A 3EI2B 5FKRA 1SQJA 3J81g 3JZHA 4E54B 1NR0A 2H9MA 4H5IA 2CNXA 2IUVA 4A0BB 2P9UC 1TYQC 2J55H 3NVNA 3I2NA 2EBSA 4Y7RA 4J73A 3DXMC 5HE2B 3FRXA 4JT5C 4YVDA 3SVWD 3SBPA 1XHMA 1JMZB 3EI1A 2HJ4A 4L1QD 5CXBA 5TEEA 4CZXA 2GC4A 4ZOZA 1JOFA 4LG8A 2J56H 4J8GA 3SWSD 4OZUA 4FA4D 2P9NC 2YMUA 3OL2A 1PEVA 3JROA 3EWEA 5TDHB 3DXKC 3VH0A 3MZKA 4J8BA 1PGUA 3DM0A 3SMRA 1JMXB 3IKOA 3SXTD 4K3JB 3RLMD 5EMJB 4X63B 5HQGA 3EU7A 3EMHA 3IJCA 2YBAA 2IWFA 3PSCB 4JSVC 5FKSA 4PBYA 4GQBB 4J87A 4G56B 4AEZA 4FAVD 2PM9A 2UZXB 4ZOYA 3W15A 1OMWB 3I8EA 4GM3A 5EAMA 3ULEC 3K27A 1GOTB 4PBZA 4XYHA 5FXYA 2OK6A 4X3EA 5CXCB 1N6DA 3JZGA 4HDJA 2Z2OA 4ERYA 4LGNA 4NSXA 3PVUB 3I7KA 5TF2A 5CYKA 4PSXB 2XU7A 5EMLB 5EM2B 3E0CA 2P9SC 2Z2NA 4N14A 4FA9D 5K19A 1MG2A 3PXTD 3BG1A 4XYIA 3I7HA 4Z8LA 3AL8B 3RSEC 4L3HD 3U4YA 4GMBA 5SXMA 3UVLA 5EM2A 2J57G 1MG3A 4PXWA 2XL2A 4A09B 3EI3B 3PXSD 4CY2A 3EI4B 3GREA 2H6NA 4A0AA 4GGAA 4J77A 2H9PA 3I89A 3MMYA 4ES0A 4O1QD 3CFSB 2IWKA 4JSNC 4TZ4A 5EAPA 5IGOA 1R5MA 3OW8A 4E5ZA 3N0DA 5AJAA 2I3TA 5I5IA 2XL3A 3OTTA 4A11B 3UKRC 4D0KA 2CE8A 3V9FA 5FLXg 1RI6A 3SLED 4ERZA 3C9CA 5GXHA 2I0SA 4XEIC 5H1MA 4GQ1A 2P9LC 4JT6C 4A11A 3EI2A 4J79A 4E54A 2GNQA 4A0BA 3IJ0A 3IJ1A 4GZ8A 4PSWB 5K1CC 3FM0A 2CE9A 3NVQA 4BUJC 1B9YA 2TRCB 4ESGA 2MTAH 4J84A 2I3SA 3I7OA 2HJBA 5FKQA 3RRMC 5IGQA 4L3GD 1SQ9A 4QQEA 4CZVA 4FAND 2AQ5A 5KDOB 4IMMA 3RN1D 3UVMA 3L4MD 3RN0D 2CN2A 1TBGA 3SHFA 5A2Qg 2W18A 3GFCA 1PI6A 3ORVD 3I8CA 4OWRA 5EALA 3IIYA 2QC5A 3UVNA 3PXWD 3OKWA 2OVRB 5C2VB 4CI1A 3UVKA 4O9DA 4K3ID 4MK0B 2H6QA 3I7PA 1Q47A 1A0RB 5AMSA 2B5NA 4FB1D 2OVPB 4Y5RD 5HYNB 3BG0A 2PM7B 3F3FA 3L4OD 1L0QA 2Z2PA 4JSPC 2IUQA 2IURA 1B9XA 3N0EA 3KRWB 4GQ2P 3MXXA 5HE0B 2AGZA 5I5JA 4J82A 4QL1A 4FHLA 4H5JA 2H6KA 3V7DB 4CI8A 3AFCA 3JB9L 5B4WA 3KRXB 1N6EA 4JXMA 3JPXA 5CXCA 2I0TA 3A0FA 3CIKB 4CI2A 3OKYB 4LG9A 4J81A 2PBIB 2QXVA 4CY1A 2CN3A 4ZN4A 3BWSA 2HXCA 1U4CA 2AH1A 3DWLC 4CZYA 4J0WA 5I5MA 2BBKH 5GSAA 1K8KC 3SJLD 3V5WB 2H14A 3MKSB 4GGCA 3AL8A 4AOWA 4A2MA 4ZOXA 3C5MA 4A09A 5EMMB 3EI3A 5HE3B 3EI4A 3C75H 3VA6A 1ERJA 3MZLA 5FA5B 4U1EI 3UVOA 2OIZA 4O45A 4EWRA 2OJYA 2H47A 2AH0A 2P9PC 2H68A 1GXRA 1S4UX 3DSMA 4CY3A 4U7AA 5H14A 4ERQA 3RMZD 4A2LA 4J78A 1U2VC 5EMKB 3SBRA 2HYEA 5FKTA 4J0XA 1VYHC 4QT8A 4CC9A 4FA5D 3F3GA 3EI1B 4I79A 3JZNA 5CXBB 3PE7A 2OVQB 3JRPA 2AGWA 2P9IC 1GP2B 4GM8A 2CO0A 3J80g 2HKRA 3I7LA 3OKTA 3IIWA 4FA1D 5GXIA 2P9KC 3UKUC 5TEFA 2Q7QA 4O3TB 2G9AA 5JWZA 3OL2B 4JSXC 4A08B 1N6FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B7F A;  3EG6 A;  4BH6 A;  4A7J A;  3P4F A;  3I7N A;  1P22 A;  2I0R A;  4IA9 A;  4PNK B;  2YNN A;  3AL9 A;  4GM9 A;  3VGZ A;  4A08 A;  1GG2 B;  4D6V A;  3ZWL B;  4X61 B;  2PM6 B;  2AGY A;  5HE1 B;  4JD2 C;  2PM9 B;  1SHY B;  3HFQ A;  4CI3 A;  5IJ7 E;  4UI9 R;  2GC7 A;  2B5M A;  1MDA H;  2YB8 B;  5IJ8 E;  4PC0 A;  3SBQ A;  2HES X;  4X60 B;  5C2W B;  1FWX A;  3JAM g;  2HKM A;  3C99 A;  2IUP A;  4L9O A;  4CY5 A;  2OK4 A;  5CYK B;  2YNP A;  3RFH A;  1XKS A;  3ODT A;  3AH8 B;  2YNO A;  1QNI A;  5AFU 3;  3PSL A;  3PVW B;  5C9Z B;  3F3P A;  2AGX A;  1NEX B;  2G99 A;  5THA A;  4ZOV A;  4O3U B;  4BL0 A;  3OKY A;  1OLZ A;  3NVX A;  4J86 A;  1K32 A;  4A0A B;  1JJU B;  5FQD A;  3CFV A;  4GGD A;  2H9N A;  2UZY B;  2H3X A;  5IC7 A;  1PBY B;  4QRJ A;  3RFG A;  4R7A B;  1XIP A;  2O9K A;  3K26 A;  4E5Z B;  5GMK n;  3SN6 B;  3SCY A;  2IAA A;  4FWW A;  5EAR A;  2B5L A;  5IT9 g;  2BCJ B;  3SFZ A;  4KFM B;  3FGB A;  2H9L A;  1YFQ A;  2CO0 C;  2AGL A;  3MKQ A;  3UR4 A;  2B4E A;  2XYI A;  5H17 A;  2H13 A;  3EI2 B;  5FKR A;  1SQJ A;  3J81 g;  3JZH A;  4E54 B;  1NR0 A;  2H9M A;  4H5I A;  2CNX A;  2IUV A;  4A0B B;  2P9U C;  1TYQ C;  2J55 H;  3NVN A;  3I2N A;  2EBS A;  4Y7R A;  4J73 A;  3DXM C;  5HE2 B;  3FRX A;  4JT5 C;  4YVD A;  3SVW D;  3SBP A;  1XHM A;  1JMZ B;  3EI1 A;  2HJ4 A;  4L1Q D;  5CXB A;  5TEE A;  4CZX A;  2GC4 A;  4ZOZ A;  1JOF A;  4LG8 A;  2J56 H;  4J8G A;  3SWS D;  4OZU A;  4FA4 D;  2P9N C;  2YMU A;  3OL2 A;  1PEV A;  3JRO A;  3EWE A;  5TDH B;  3DXK C;  3VH0 A;  3MZK A;  4J8B A;  1PGU A;  3DM0 A;  3SMR A;  1JMX B;  3IKO A;  3SXT D;  4K3J B;  3RLM D;  5EMJ B;  4X63 B;  5HQG A;  3EU7 A;  3EMH A;  3IJC A;  2YBA A;  2IWF A;  3PSC B;  4JSV C;  5FKS A;  4PBY A;  4GQB B;  4J87 A;  4G56 B;  4AEZ A;  4FAV D;  2PM9 A;  2UZX B;  4ZOY A;  3W15 A;  1OMW B;  3I8E A;  4GM3 A;  5EAM A;  3ULE C;  3K27 A;  1GOT B;  4PBZ A;  4XYH A;  5FXY A;  2OK6 A;  4X3E A;  5CXC B;  1N6D A;  3JZG A;  4HDJ A;  2Z2O A;  4ERY A;  4LGN A;  4NSX A;  3PVU B;  3I7K A;  5TF2 A;  5CYK A;  4PSX B;  2XU7 A;  5EML B;  5EM2 B;  3E0C A;  2P9S C;  2Z2N A;  4N14 A;  4FA9 D;  5K19 A;  1MG2 A;  3PXT D;  3BG1 A;  4XYI A;  3I7H A;  4Z8L A;  3AL8 B;  3RSE C;  4L3H D;  3U4Y A;  4GMB A;  5SXM A;  3UVL A;  5EM2 A;  2J57 G;  1MG3 A;  4PXW A;  2XL2 A;  4A09 B;  3EI3 B;  3PXS D;  4CY2 A;  3EI4 B;  3GRE A;  2H6N A;  4A0A A;  4GGA A;  4J77 A;  2H9P A;  3I89 A;  3MMY A;  4ES0 A;  4O1Q D;  3CFS B;  2IWK A;  4JSN C;  4TZ4 A;  5EAP A;  5IGO A;  1R5M A;  3OW8 A;  4E5Z A;  3N0D A;  5AJA A;  2I3T A;  5I5I A;  2XL3 A;  3OTT A;  4A11 B;  3UKR C;  4D0K A;  2CE8 A;  3V9F A;  5FLX g;  1RI6 A;  3SLE D;  4ERZ A;  3C9C A;  5GXH A;  2I0S A;  4XEI C;  5H1M A;  4GQ1 A;  2P9L C;  4JT6 C;  4A11 A;  3EI2 A;  4J79 A;  4E54 A;  2GNQ A;  4A0B A;  3IJ0 A;  3IJ1 A;  4GZ8 A;  4PSW B;  5K1C C;  3FM0 A;  2CE9 A;  3NVQ A;  4BUJ C;  1B9Y A;  2TRC B;  4ESG A;  2MTA H;  4J84 A;  2I3S A;  3I7O A;  2HJB A;  5FKQ A;  3RRM C;  5IGQ A;  4L3G D;  1SQ9 A;  4QQE A;  4CZV A;  4FAN D;  2AQ5 A;  5KDO B;  4IMM A;  3RN1 D;  3UVM A;  3L4M D;  3RN0 D;  2CN2 A;  1TBG A;  3SHF A;  5A2Q g;  2W18 A;  3GFC A;  1PI6 A;  3ORV D;  3I8C A;  4OWR A;  5EAL A;  3IIY A;  2QC5 A;  3UVN A;  3PXW D;  3OKW A;  2OVR B;  5C2V B;  4CI1 A;  3UVK A;  4O9D A;  4K3I D;  4MK0 B;  2H6Q A;  3I7P A;  1Q47 A;  1A0R B;  5AMS A;  2B5N A;  4FB1 D;  2OVP B;  4Y5R D;  5HYN B;  3BG0 A;  2PM7 B;  3F3F A;  3L4O D;  1L0Q A;  2Z2P A;  4JSP C;  2IUQ A;  2IUR A;  1B9X A;  3N0E A;  3KRW B;  4GQ2 P;  3MXX A;  5HE0 B;  2AGZ A;  5I5J A;  4J82 A;  4QL1 A;  4FHL A;  4H5J A;  2H6K A;  3V7D B;  4CI8 A;  3AFC A;  3JB9 L;  5B4W A;  3KRX B;  1N6E A;  4JXM A;  3JPX A;  5CXC A;  2I0T A;  3A0F A;  3CIK B;  4CI2 A;  3OKY B;  4LG9 A;  4J81 A;  2PBI B;  2QXV A;  4CY1 A;  2CN3 A;  4ZN4 A;  3BWS A;  2HXC A;  1U4C A;  2AH1 A;  3DWL C;  4CZY A;  4J0W A;  5I5M A;  2BBK H;  5GSA A;  1K8K C;  3SJL D;  3V5W B;  2H14 A;  3MKS B;  4GGC A;  3AL8 A;  4AOW A;  4A2M A;  4ZOX A;  3C5M A;  4A09 A;  5EMM B;  3EI3 A;  5HE3 B;  3EI4 A;  3C75 H;  3VA6 A;  1ERJ A;  3MZL A;  5FA5 B;  4U1E I;  3UVO A;  2OIZ A;  4O45 A;  4EWR A;  2OJY A;  2H47 A;  2AH0 A;  2P9P C;  2H68 A;  1GXR A;  1S4U X;  3DSM A;  4CY3 A;  4U7A A;  5H14 A;  4ERQ A;  3RMZ D;  4A2L A;  4J78 A;  1U2V C;  5EMK B;  3SBR A;  2HYE A;  5FKT A;  4J0X A;  1VYH C;  4QT8 A;  4CC9 A;  4FA5 D;  3F3G A;  3EI1 B;  4I79 A;  3JZN A;  5CXB B;  3PE7 A;  2OVQ B;  3JRP A;  2AGW A;  2P9I C;  1GP2 B;  4GM8 A;  2CO0 A;  3J80 g;  2HKR A;  3I7L A;  3OKT A;  3IIW A;  4FA1 D;  5GXI A;  2P9K C;  3UKU C;  5TEF A;  2Q7Q A;  4O3T B;  2G9A A;  5JWZ A;  3OL2 B;  4JSX C;  4A08 B;  1N6F A; 
#chains in the Genus database with same CATH topology
 3B7F A;  3EG6 A;  5C86 A;  3FCS A;  4BH6 A;  4A7J A;  4Z7Q A;  3P4F A;  3I7N A;  3K72 A;  3NIG A;  3IUR A;  1P22 A;  2I0R A;  4IA9 A;  4PNK B;  1E5T A;  2YNN A;  3AL9 A;  4GM9 A;  1TYE A;  3VGZ A;  4UM9 A;  1H2W A;  4A08 A;  1GG2 B;  1QFM A;  4D6V A;  1BPO A;  3ZWL B;  4X61 B;  2PM6 B;  1H2Y A;  2AGY A;  5HE1 B;  3O4G A;  4JD2 C;  2PM9 B;  1SHY B;  3HFQ A;  4CI3 A;  3MUN A;  5IJ7 E;  4UI9 R;  2GC7 A;  2B5M A;  1MDA H;  2YB8 B;  5C92 A;  5IJ8 E;  4UM8 A;  4PC0 A;  2EIC A;  3SBQ A;  3NIF A;  3T3P A;  3ZDX A;  1U8C A;  2HES X;  4X60 B;  5C2W B;  1FWX A;  5E6S A;  3JAM g;  2HKM A;  3C99 A;  4JHN A;  2IUP A;  3MVD K;  4L9O A;  2VDN A;  4NAA A;  4CY5 A;  2OK4 A;  2HU5 A;  4MMZ A;  5CYK B;  5FFO A;  2YNP A;  3RFH A;  1XKS A;  3ODT A;  3T3M A;  2VC2 A;  2EIE A;  3AH8 B;  2YNO A;  1QNI A;  3O4H A;  5M61 A;  5AFU 3;  3PSL A;  4Z7N A;  3PVW B;  5C9Z B;  3F3P A;  2AGX A;  1NEX B;  2G99 A;  3V4P A;  5THA A;  4ZOV A;  4O3U B;  4QAM A;  4BL0 A;  2XZG A;  3OKY A;  1OLZ A;  1VE6 A;  3NVX A;  4J86 A;  1GOF A;  1K32 A;  4A0A B;  1JJU B;  5FQD A;  1L5G A;  3CFV A;  4GGD A;  3IVM A;  2H9N A;  2UZY B;  2H3X A;  5IC7 A;  1PBY B;  4QRJ A;  3RFG A;  3IJE A;  4R7A B;  1XIP A;  2O9K A;  3K26 A;  4E5Z B;  5GMK n;  3SN6 B;  3SCY A;  2IAA A;  4FWW A;  5EAR A;  1GOH A;  2B5L A;  5IT9 g;  2BCJ B;  3SFZ A;  1VZ3 A;  4KFM B;  3FGB A;  2H9L A;  1YFQ A;  2CO0 C;  2AGL A;  3MKQ A;  3UR4 A;  2B4E A;  2XYI A;  3EQ7 A;  4NEN A;  5H17 A;  2H13 A;  2VDM A;  3IUJ A;  3EI2 B;  5FKR A;  1SQJ A;  3J81 g;  3O4J A;  3JZH A;  4E54 B;  1NR0 A;  2H9M A;  4H5I A;  2CNX A;  2IUV A;  4A0B B;  2P9U C;  1TYQ C;  2J55 H;  2VDL A;  3NVN A;  3I2N A;  5E6U A;  2EBS A;  4Y7R A;  4J73 A;  3DXM C;  5HE2 B;  3ZDZ A;  3FRX A;  4JT5 C;  2QR5 A;  4YVD A;  3SVW D;  3SBP A;  1XHM A;  1JMZ B;  3EI1 A;  2QZP A;  2HJ4 A;  3DDU A;  4L1Q D;  5CXB A;  5TEE A;  4CZX A;  2GC4 A;  4ZOZ A;  1JOF A;  4LG8 A;  1QFS A;  4G1E A;  2J56 H;  2VDO A;  4WK4 A;  4J8G A;  2WQ8 A;  4G55 A;  4OZU A;  3SWS D;  4FA4 D;  2P9N C;  4AN1 A;  1YR2 A;  2YMU A;  3OL2 A;  1PEV A;  3JRO A;  3EWE A;  5TDH B;  1T2X A;  3DXK C;  3VH0 A;  3MZK A;  4J8B A;  1PGU A;  3DM0 A;  3SMR A;  5M5S A;  1JMX B;  3IKO A;  4G1M A;  3SXT D;  4NC4 A;  4K3J B;  3RLM D;  3O4I A;  5EMJ B;  3QI0 A;  4X63 B;  5HQG A;  3EU7 A;  3EMH A;  3IJC A;  2YBA A;  2IWF A;  3PSC B;  1H2Z A;  4JSV C;  5FKS A;  4PBY A;  2JKX A;  4GQB B;  4MMY A;  4J87 A;  4G56 B;  4AEZ A;  4AMY A;  2PM9 A;  2UZX B;  4FAV D;  4ZOY A;  3W15 A;  1OMW B;  3I8E A;  3K6S A;  4GM3 A;  5EAM A;  3ULE C;  2VZ3 A;  3K27 A;  1GOT B;  4PBZ A;  4XYH A;  5FXY A;  2OK6 A;  4X3E A;  5CXC B;  1N6D A;  3JZG A;  4HDJ A;  2Z2O A;  4ERY A;  4LGN A;  4NSX A;  3PVU B;  3GC3 B;  3I7K A;  5TF2 A;  5CYK A;  1UTC A;  4PSX B;  2XU7 A;  5EML B;  3ZE2 A;  1O6F A;  1E8N A;  5EM2 B;  3E0C A;  2P9S C;  2Z2N A;  3MUO A;  4N14 A;  4FA9 D;  4IRZ A;  5K19 A;  1MG2 A;  3PXT D;  3BG1 A;  4XYI A;  3I7H A;  4Z8L A;  3AL8 B;  3RSE C;  4L3H D;  3U4Y A;  4GMB A;  4BP9 A;  2VZ1 A;  5SXM A;  3UVL A;  5EM2 A;  2J57 G;  1MG3 A;  1E8M A;  4PXW A;  5M5R A;  2XL2 A;  4AMZ A;  4A09 B;  5M5T A;  3EI3 B;  3PXS D;  4CY2 A;  3EI4 B;  3GRE A;  2H6N A;  1UOO A;  4A0A A;  4O2W A;  4GGA A;  4J77 A;  2H9P A;  2HU8 A;  3I89 A;  3MMY A;  4ES0 A;  4O1Q D;  3CFS B;  3ZE0 A;  2IWK A;  5M5U A;  4JSN C;  4TZ4 A;  5EAP A;  5IGO A;  1R5M A;  3OW8 A;  2EID A;  4E5Z A;  3N0D A;  5AJA A;  2I3T A;  5I5I A;  2XL3 A;  3OTT A;  4A11 B;  3UKR C;  4D0K A;  4DNV A;  2CE8 A;  3V9F A;  5FLX g;  1RI6 A;  3SLE D;  4ERZ A;  3C9C A;  5GXH A;  2I0S A;  4XEI C;  5H1M A;  4GQ1 A;  2P9L C;  4JT6 C;  4A11 A;  3EI2 A;  4J79 A;  4E54 A;  2GNQ A;  3NID A;  4A0B A;  3IJ0 A;  3IJ1 A;  4GZ8 A;  4PSW B;  3QHY B;  3FM0 A;  2CE9 A;  3NVQ A;  5K1C C;  1B9Y A;  2TRC B;  3ZE1 A;  4AX4 A;  4BUJ C;  2MTA H;  3GD1 I;  4ESG A;  4J84 A;  1GOG A;  2I3S A;  3I7O A;  1UOQ A;  2HJB A;  5FKQ A;  3RRM C;  5IGQ A;  2XDW A;  4L3G D;  4RE6 A;  3VI4 A;  1SQ9 A;  4QQE A;  4CZV A;  2VDP A;  4FAN D;  2AQ5 A;  5KDO B;  4IMM A;  3RN1 D;  1C9L A;  3UVM A;  1I2M B;  3L4M D;  3RN0 D;  2CN2 A;  1TBG A;  5M5V A;  3SHF A;  5A2Q g;  2W18 A;  1O6G A;  3GFC A;  1PI6 A;  3ORV D;  3I8C A;  4OWR A;  5EAL A;  3K71 A;  3IIY A;  2QC5 A;  3UVN A;  3PXW D;  3OKW A;  2OVR B;  3V4V A;  5C2V B;  4CI1 A;  3UVK A;  4O9D A;  4K3I D;  4MK0 B;  2H6Q A;  2HU7 A;  3I7P A;  1Q47 A;  1A0R B;  3IUQ A;  5AMS A;  3VI3 A;  2XE4 A;  2B5N A;  3IUN A;  4FB1 D;  2OVP B;  4Y5R D;  5HYN B;  3BG0 A;  2PM7 B;  3F3F A;  3L4O D;  1K3I A;  1L0Q A;  4JHP C;  2Z2P A;  4JSP C;  2IUQ A;  2IUR A;  1B9X A;  3N0E A;  3KRW B;  4BP8 A;  4WK2 A;  4GQ2 P;  3MXX A;  5HE0 B;  2AGZ A;  2VDR A;  5I5J A;  4J82 A;  1VZ2 A;  4QL1 A;  4FHL A;  4H5J A;  2H6K A;  1M1X A;  3V7D B;  4CI8 A;  3AFC A;  3JB9 L;  5B4W A;  2VDQ A;  3KRX B;  1N6E A;  4JXM A;  3JPX A;  5CXC A;  2I0T A;  1VE7 A;  3A0F A;  3CIK B;  3ZDY A;  3FCU A;  4CI2 A;  4RE5 A;  3OKY B;  4NBM A;  4LG9 A;  4J81 A;  2PBI B;  2QXV A;  4CY1 A;  2CN3 A;  4ZN4 A;  3BWS A;  2HXC A;  1U4C A;  4AN0 A;  2AH1 A;  3DWL C;  4CZY A;  4J0W A;  5I5M A;  2BBK H;  5GSA A;  1K8K C;  3SJL D;  1H2X A;  3IUM A;  5E6R A;  3V5W B;  2H14 A;  3MKS B;  4GGC A;  3AL8 A;  4AOW A;  4A2M A;  4ZOX A;  2VDK A;  3C5M A;  4A09 A;  5EMM B;  3EI3 A;  5HE3 B;  3IUL A;  3EI4 A;  3C75 H;  3VA6 A;  1ERJ A;  2EIB A;  3MZL A;  5FA5 B;  4DNW A;  4U1E I;  3UVO A;  2OIZ A;  4O45 A;  4EWR A;  2OJY A;  2H47 A;  2AH0 A;  2P9P C;  2H68 A;  1GXR A;  1S4U X;  3DSM A;  5HDB A;  4CY3 A;  4U7A A;  5H14 A;  3OF7 A;  4ERQ A;  4Z7O A;  4MMX A;  3RMZ D;  4A2L A;  1C9I A;  4J78 A;  1U2V C;  5EMK B;  3SBR A;  2HYE A;  5FKT A;  3EQ9 A;  4J0X A;  1VYH C;  4QT8 A;  4CC9 A;  4FA5 D;  3KCI A;  5FFG A;  4BCC A;  3F3G A;  3EI1 B;  4I79 A;  3JZN A;  5CXB B;  2BKL A;  3PE7 A;  2OVQ B;  3JRP A;  2AGW A;  2P9I C;  1GP2 B;  4BCB A;  4BCD A;  4D9S A;  4WJK A;  1A12 A;  4GM8 A;  2CO0 A;  3J80 g;  2HKR A;  3EQ8 A;  4DNU A;  4L1M A;  1JTD B;  3I7L A;  3OKT A;  3IIW A;  4O02 A;  4FA1 D;  5GXI A;  1UOP A;  2P9K C;  3UKU C;  5TEF A;  2Q7Q A;  4O3T B;  2G9A A;  5JWZ A;  3OL2 B;  4JSX C;  4A08 B;  1N6F A;  4WK0 A;  1JV2 A; 
#chains in the Genus database with same CATH homology
 3B7F A;  3EG6 A;  4BH6 A;  4A7J A;  3P4F A;  3I7N A;  1P22 A;  2I0R A;  4IA9 A;  4PNK B;  2YNN A;  3AL9 A;  4GM9 A;  3VGZ A;  4A08 A;  1GG2 B;  4D6V A;  3ZWL B;  4X61 B;  2PM6 B;  2AGY A;  5HE1 B;  4JD2 C;  2PM9 B;  1SHY B;  3HFQ A;  4CI3 A;  5IJ7 E;  4UI9 R;  2GC7 A;  2B5M A;  1MDA H;  2YB8 B;  5IJ8 E;  4PC0 A;  3SBQ A;  2HES X;  4X60 B;  5C2W B;  1FWX A;  3JAM g;  2HKM A;  3C99 A;  2IUP A;  4L9O A;  4CY5 A;  2OK4 A;  5CYK B;  2YNP A;  3RFH A;  1XKS A;  3ODT A;  3AH8 B;  2YNO A;  1QNI A;  5AFU 3;  3PSL A;  3PVW B;  5C9Z B;  3F3P A;  2AGX A;  1NEX B;  2G99 A;  5THA A;  4ZOV A;  4O3U B;  4BL0 A;  3OKY A;  1OLZ A;  3NVX A;  4J86 A;  1K32 A;  4A0A B;  1JJU B;  5FQD A;  3CFV A;  4GGD A;  2H9N A;  2UZY B;  2H3X A;  5IC7 A;  1PBY B;  4QRJ A;  3RFG A;  4R7A B;  1XIP A;  2O9K A;  3K26 A;  4E5Z B;  5GMK n;  3SN6 B;  3SCY A;  2IAA A;  4FWW A;  5EAR A;  2B5L A;  5IT9 g;  2BCJ B;  3SFZ A;  4KFM B;  3FGB A;  2H9L A;  1YFQ A;  2CO0 C;  2AGL A;  3MKQ A;  3UR4 A;  2B4E A;  2XYI A;  5H17 A;  2H13 A;  3EI2 B;  5FKR A;  1SQJ A;  3J81 g;  3JZH A;  4E54 B;  1NR0 A;  2H9M A;  4H5I A;  2CNX A;  2IUV A;  4A0B B;  2P9U C;  1TYQ C;  2J55 H;  3NVN A;  3I2N A;  2EBS A;  4Y7R A;  4J73 A;  3DXM C;  5HE2 B;  3FRX A;  4JT5 C;  4YVD A;  3SVW D;  3SBP A;  1XHM A;  1JMZ B;  3EI1 A;  2HJ4 A;  4L1Q D;  5CXB A;  5TEE A;  4CZX A;  2GC4 A;  4ZOZ A;  1JOF A;  4LG8 A;  2J56 H;  4J8G A;  3SWS D;  4OZU A;  4FA4 D;  2P9N C;  2YMU A;  3OL2 A;  1PEV A;  3JRO A;  3EWE A;  5TDH B;  3DXK C;  3VH0 A;  3MZK A;  4J8B A;  1PGU A;  3DM0 A;  3SMR A;  1JMX B;  3IKO A;  3SXT D;  4K3J B;  3RLM D;  5EMJ B;  4X63 B;  5HQG A;  3EU7 A;  3EMH A;  3IJC A;  2YBA A;  2IWF A;  3PSC B;  4JSV C;  5FKS A;  4PBY A;  4GQB B;  4J87 A;  4G56 B;  4AEZ A;  4FAV D;  2PM9 A;  2UZX B;  4ZOY A;  3W15 A;  1OMW B;  3I8E A;  4GM3 A;  5EAM A;  3ULE C;  3K27 A;  1GOT B;  4PBZ A;  4XYH A;  5FXY A;  2OK6 A;  4X3E A;  5CXC B;  1N6D A;  3JZG A;  4HDJ A;  2Z2O A;  4ERY A;  4LGN A;  4NSX A;  3PVU B;  3I7K A;  5TF2 A;  5CYK A;  4PSX B;  2XU7 A;  5EML B;  5EM2 B;  3E0C A;  2P9S C;  2Z2N A;  4N14 A;  4FA9 D;  5K19 A;  1MG2 A;  3PXT D;  3BG1 A;  4XYI A;  3I7H A;  4Z8L A;  3AL8 B;  3RSE C;  4L3H D;  3U4Y A;  4GMB A;  5SXM A;  3UVL A;  5EM2 A;  2J57 G;  1MG3 A;  4PXW A;  2XL2 A;  4A09 B;  3EI3 B;  3PXS D;  4CY2 A;  3EI4 B;  3GRE A;  2H6N A;  4A0A A;  4GGA A;  4J77 A;  2H9P A;  3I89 A;  3MMY A;  4ES0 A;  4O1Q D;  3CFS B;  2IWK A;  4JSN C;  4TZ4 A;  5EAP A;  5IGO A;  1R5M A;  3OW8 A;  4E5Z A;  3N0D A;  5AJA A;  2I3T A;  5I5I A;  2XL3 A;  3OTT A;  4A11 B;  3UKR C;  4D0K A;  2CE8 A;  3V9F A;  5FLX g;  1RI6 A;  3SLE D;  4ERZ A;  3C9C A;  5GXH A;  2I0S A;  4XEI C;  5H1M A;  4GQ1 A;  2P9L C;  4JT6 C;  4A11 A;  3EI2 A;  4J79 A;  4E54 A;  2GNQ A;  4A0B A;  3IJ0 A;  3IJ1 A;  4GZ8 A;  4PSW B;  5K1C C;  3FM0 A;  2CE9 A;  3NVQ A;  4BUJ C;  1B9Y A;  2TRC B;  4ESG A;  2MTA H;  4J84 A;  2I3S A;  3I7O A;  2HJB A;  5FKQ A;  3RRM C;  5IGQ A;  4L3G D;  1SQ9 A;  4QQE A;  4CZV A;  4FAN D;  2AQ5 A;  5KDO B;  4IMM A;  3RN1 D;  3UVM A;  3L4M D;  3RN0 D;  2CN2 A;  1TBG A;  3SHF A;  5A2Q g;  2W18 A;  3GFC A;  1PI6 A;  3ORV D;  3I8C A;  4OWR A;  5EAL A;  3IIY A;  2QC5 A;  3UVN A;  3PXW D;  3OKW A;  2OVR B;  5C2V B;  4CI1 A;  3UVK A;  4O9D A;  4K3I D;  4MK0 B;  2H6Q A;  3I7P A;  1Q47 A;  1A0R B;  5AMS A;  2B5N A;  4FB1 D;  2OVP B;  4Y5R D;  5HYN B;  3BG0 A;  2PM7 B;  3F3F A;  3L4O D;  1L0Q A;  2Z2P A;  4JSP C;  2IUQ A;  2IUR A;  1B9X A;  3N0E A;  3KRW B;  4GQ2 P;  3MXX A;  5HE0 B;  2AGZ A;  5I5J A;  4J82 A;  4QL1 A;  4FHL A;  4H5J A;  2H6K A;  3V7D B;  4CI8 A;  3AFC A;  3JB9 L;  5B4W A;  3KRX B;  1N6E A;  4JXM A;  3JPX A;  5CXC A;  2I0T A;  3A0F A;  3CIK B;  4CI2 A;  3OKY B;  4LG9 A;  4J81 A;  2PBI B;  2QXV A;  4CY1 A;  2CN3 A;  4ZN4 A;  3BWS A;  2HXC A;  1U4C A;  2AH1 A;  3DWL C;  4CZY A;  4J0W A;  5I5M A;  2BBK H;  5GSA A;  1K8K C;  3SJL D;  3V5W B;  2H14 A;  3MKS B;  4GGC A;  3AL8 A;  4AOW A;  4A2M A;  4ZOX A;  3C5M A;  4A09 A;  5EMM B;  3EI3 A;  5HE3 B;  3EI4 A;  3C75 H;  3VA6 A;  1ERJ A;  3MZL A;  5FA5 B;  4U1E I;  3UVO A;  2OIZ A;  4O45 A;  4EWR A;  2OJY A;  2H47 A;  2AH0 A;  2P9P C;  2H68 A;  1GXR A;  1S4U X;  3DSM A;  4CY3 A;  4U7A A;  5H14 A;  4ERQ A;  3RMZ D;  4A2L A;  4J78 A;  1U2V C;  5EMK B;  3SBR A;  2HYE A;  5FKT A;  4J0X A;  1VYH C;  4QT8 A;  4CC9 A;  4FA5 D;  3F3G A;  3EI1 B;  4I79 A;  3JZN A;  5CXB B;  3PE7 A;  2OVQ B;  3JRP A;  2AGW A;  2P9I C;  1GP2 B;  4GM8 A;  2CO0 A;  3J80 g;  2HKR A;  3I7L A;  3OKT A;  3IIW A;  4FA1 D;  5GXI A;  2P9K C;  3UKU C;  5TEF A;  2Q7Q A;  4O3T B;  2G9A A;  5JWZ A;  3OL2 B;  4JSX C;  4A08 B;  1N6F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...