4J87A

Crystal structure of alpha-cop
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
327
structure length
316
Chain Sequence
MAMLTKFESRSSRAKGVAFHPTQPWILTSLHNGRIQLWDYRMGTLLDRFDGHDGPVRGIAFHPTQPIFVSGGDDYKVNVWNYKSRKLLFSLCGHMDYVRVCTFHHEYPWILSCSDDQTIRIWNWQSRNCIAILTGHSHYVMCAAFHPSEDLIVSASLDQTVRVWDISGLRMKNAAPVSMSKEDQKAQAADAIVKFVLEGHDRGVNWCAFHPTLPLILSAGDDRLVKLWRMTASKAWEVDTCRGHFNNVSCCLFHPHQELILSASEDKTIRVWDLNRRTAVQTFRRANDRFWFITVHPKLNLFAAAHDSGVMVFKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords coatomer subunit alpha
publication title Rules for the recognition of dilysine retrieval motifs by coatomer.
pubmed doi rcsb
molecule tags Protein transport
total genus 79
structure length 316
sequence length 327
ec nomenclature
pdb deposition date 2013-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4j87A00
1TBGA 3OKTA 2CE9A 4GM9A 2I0TA 3I7OA 2AGLA 5EMJB 2PBIB 5AFU3 4PNKB 2P9SC 3KRXB 1XKSA 4R7AB 3OKYB 3AL8A 4GM8A 2I3SA 4ZOXA 4A11B 3SBPA 3ODTA 5H1MA 2H9PA 4CY1A 5EM2A 4JSXC 3VA6A 4CC9A 4J77A 3RFGA 3BWSA 1GG2B 5EMKB 3V7DB 5EAMA 1OMWB 4FAND 4A2MA 3JROA 3SFZA 3C5MA 3EI1B 3SXTD 3V5WB 4ZOYA 3OKWA 2H6KA 1ERJA 2IURA 4CI8A 3N0DA 2CN2A 2OVQB 5C2VB 4J8BA 2IUVA 4AOWA 1JMZB 1PI6A 3I7LA 3W15A 3UKRC 4ES0A 3IJCA 2XL3A 3MZLA 4ESGA 3AH8B 3DXMC 2AGZA 2UZXB 3C99A 2YB8B 4L3HD 2BBKH 4PSWB 4H5IA 1GP2B 1SHYB 3I7HA 2YNOA 3OL2B 1QNIA 5I5IA 4ERZA 4U1EI 2Z2NA 4E54A 1MG2A 5FA5B 4K3ID 3EI1A 1JOFA 5EARA 3P4FA 4A08B 2W18A 4X61B 3UVLA 2HKMA 4J79A 2J57G 5THAA 4CI1A 2YMUA 3DXKC 2GNQA 3ZWLB 2H3XA 2H68A 4A0AA 2AH0A 3C9CA 3UR4A 5TEEA 3NVNA 2AGWA 2AQ5A 3EI4A 4ERQA 2XYIA 4D6VA 4QRJA 3K27A 5FKTA 1VYHC 3FRXA 5JWZA 2OVRB 2H9LA 3EI2B 1MDAH 5EM2B 4ZN4A 1B9YA 3U4YA 5EMLB 3OW8A 3FGBA 1L0QA 3OL2A 5K1CC 3SMRA 2AH1A 4QL1A 3J80g 2HKRA 3UVNA 5GXHA 1A0RB 3BG1A 3SN6B 1MG3A 2HESX 2H9NA 4A08A 5HE1B 4O3TB 5EAPA 3UVMA 1XHMA 1GXRA 4BUJC 2PM6B 4L3GD 2GC4A 2P9LC 4KFMB 4CZVA 3F3FA 1JJUB 3DSMA 1P22A 2HJ4A 5HQGA 3IKOA 2OK4A 5FKQA 4O3UB 5IJ8E 1PBYB 2AGXA 4JSVC 1OLZA 2IWFA 4BL0A 3RFHA 4GQ2P 3I8EA 4JSNC 3EI2A 4CZYA 3UVKA 3ULEC 4CI3A 5FKRA 4GMBA 4J0WA 3N0EA 1U2VC 2B4EA 4A2LA 4E54B 2OIZA 4J8GA 4HDJA 4OZUA 4A7JA 4J81A 3EG6A 5I5MA 2EBSA 4JT5C 3MKQA 4Y5RD 3RLMD 4J84A 4CI2A 4A0AB 4JSPC 5TDHB 3L4MD 2TRCB 3MKSB 3EI4B 2HYEA 4H5JA 4LG9A 2GC7A 4J73A 4XYHA 3SHFA 2Z2OA 2B5MA 4J82A 4E5ZB 2MTAH 4J78A 2P9IC 4U7AA 5SXMA 3PSLA 3A0FA 5H17A 4EWRA 4J87A 4PC0A 2QC5A 3B7FA 5AMSA 1N6EA 4LGNA 2OK6A 4ZOVA 4O45A 4PXWA 4J86A 3PVWB 5CYKB 3PXTD 4O9DA 3NVQA 3I7KA 2HXCA 2IUQA 3PE7A 4I79A 3OTTA 3EI3B 3CFSB 4XEIC 3EWEA 3SJLD 5CXCA 4AEZA 3C75H 3PSCB 4UI9R 5HE0B 3JZHA 1B9XA 5K19A 2YNNA 1N6DA 2XU7A 3JAMg 3HFQA 3K26A 3VH0A 4E5ZA 3JZGA 4L1QD 2H14A 4FB1D 2H47A 4FA9D 3MZKA 4FAVD 3MMYA 3UKUC 3EU7A 3AFCA 4JD2C 3RN1D 3DWLC 5HYNB 2OJYA 4CY5A 3FM0A 4BH6A 3VGZA 4JXMA 5GMKn 3JPXA 2I3TA 5KDOB 2BCJB 5CYKA 2AGYA 3PXWD 3NVXA 1JMXB 4X3EA 4A0BA 2H6QA 1N6FA 4TZ4A 3EI3A 4IA9A 1NEXB 4CY3A 3RRMC 5FXYA 3L4OD 3KRWB 4GM3A 3IJ0A 3RSEC 3UVOA 5IGQA 4CZXA 1GOTB 2I0SA 5C2WB 2CNXA 1FWXA 3JRPA 4X63B 2PM7B 3PVUB 1NR0A 3JZNA 3ORVD 4FHLA 5EMMB 3EMHA 4LG8A 2PM9B 1R5MA 1TYQC 2B5LA 5TF2A 4GQ1A 3RN0D 2CN3A 5HE3B 5IC7A 2QXVA 4G56B 2H9MA 1YFQA 4GGCA 2UZYB 5CXCB 1XIPA 4GGDA 2H13A 5CXBB 1SQJA 2J55H 4N14A 4FWWA 5AJAA 3SLED 3SWSD 3SVWD 5IT9g 3BG0A 4L9OA 4FA4D 4A09B 1RI6A 4YVDA 4IMMA 4Z8LA 4QQEA 3I7PA 2XL2A 4GZ8A 3JB9L 2P9PC 4OWRA 5FKSA 4O1QD 4NSXA 3I89A 3RMZD 5GXIA 2CE8A 3GREA 4Y7RA 4JT6C 2CO0C 3OKYA 2PM9A 4J0XA 3DM0A 2P9UC 3F3PA 4A0BB 3GFCA 4GGAA 5B4WA 2HJBA 4A11A 2Q7QA 4FA1D 3F3GA 4K3JB 5C9ZB 3SCYA 5CXBA 2J56H 2B5NA 4MK0B 5HE2B 5IJ7E 3PXSD 1Q47A 3I2NA 4A09A 5I5JA 4ERYA 1U4CA 2P9NC 4PBZA 5H14A 1PEVA 1S4UX 4CY2A 3SBRA 4X60B 2O9KA 1K32A 2Z2PA 3AL8B 3IIYA 3SBQA 4GQBB 4FA5D 4QT8A 5GSAA 2YNPA 5EALA 4ZOZA 4PSXB 1PGUA 1SQ9A 2IAAA 3V9FA 3E0CA 4PBYA 2I0RA 3CIKB 1K8KC 3IJ1A 2G99A 5A2Qg 3I7NA 5FLXg 2YBAA 2IUPA 5FQDA 2IWKA 3IIWA 3MXXA 5IGOA 3AL9A 2G9AA 5TEFA 2CO0A 4D0KA 2H6NA 2OVPB 3J81g 2P9KC 4XYIA 3I8CA 3CFVA
chains in the Genus database with same CATH superfamily
1TBGA 3OKTA 2CE9A 4GM9A 1L5GA 2I0TA 1U8CA 3I7OA 1TYEA 2AGLA 5EMJB 2PBIB 5AFU3 4PNKB 2P9SC 3KRXB 1XKSA 4R7AB 3OKYB 3IVMA 3ZE2A 3AL8A 4NAAA 3OF7A 1QFSA 4GM8A 2I3SA 3IUQA 4ZOXA 4A11B 5HDBA 3SBPA 3ODTA 5H1MA 2H9PA 4CY1A 4JHPC 5EM2A 4JSXC 3VA6A 4CC9A 4J77A 3RFGA 3BWSA 4Z7NA 1GG2B 5EMKB 3V7DB 5EAMA 1OMWB 4FAND 4A2MA 3JROA 3SFZA 3C5MA 3EI1B 3SXTD 3V5WB 4ZOYA 3OKWA 2H6KA 5M5VA 1ERJA 2IURA 4CI8A 3ZDYA 3N0DA 1H2ZA 2CN2A 2OVQB 5C2VB 4J8BA 2IUVA 4AOWA 1JMZB 4AN1A 1PI6A 3I7LA 3DDUA 1C9IA 4NENA 3W15A 3UKRC 4ES0A 3IJCA 2XL3A 3MZLA 4ESGA 3AH8B 3DXMC 2AGZA 2UZXB 3C99A 3EQ8A 2YB8B 4L3HD 1UOQA 1E5TA 2BBKH 4PSWB 4H5IA 1GP2B 1SHYB 3I7HA 2YNOA 3OL2B 1QNIA 1H2WA 1H2XA 5I5IA 4O02A 4ERZA 4U1EI 2Z2NA 3T3PA 2VDLA 4E54A 1MG2A 5FA5B 4AMYA 4K3ID 3EI1A 1JOFA 5EARA 3EQ7A 3P4FA 4A08B 2W18A 4G1MA 4X61B 3UVLA 4DNVA 2HKMA 4G1EA 4J79A 2J57G 4L1MA 5THAA 4CI1A 2YMUA 3DXKC 2GNQA 3ZWLB 4G55A 2H3XA 2H68A 3NIFA 4A0AA 2AH0A 3C9CA 3UR4A 5TEEA 3NVNA 2AGWA 2AQ5A 3EI4A 4O2WA 4ERQA 2XYIA 4D6VA 4QRJA 3K27A 5FKTA 1VYHC 3FRXA 5JWZA 4NBMA 4MMYA 2OVRB 3O4JA 2H9LA 3EI2B 1MDAH 5EM2B 4ZN4A 1B9YA 3U4YA 3ZDZA 5EMLB 3OW8A 3FGBA 5E6SA 1L0QA 3MVDK 3OL2A 5K1CC 3SMRA 2AH1A 4MMXA 4UM8A 4QL1A 4DNUA 3J80g 2HKRA 3UVNA 5GXHA 1A0RB 3BG1A 3SN6B 4Z7OA 3MUOA 1MG3A 2HESX 2H9NA 4A08A 5HE1B 5M61A 4O3TB 5EAPA 3UVMA 1XHMA 1GXRA 4BUJC 2PM6B 4L3GD 2EIBA 1M1XA 2GC4A 2P9LC 4KFMB 4CZVA 1VZ3A 1JJUB 3DSMA 3F3FA 1P22A 2HJ4A 5HQGA 4AX4A 3IKOA 2OK4A 5FKQA 2VDQA 4O3UB 5IJ8E 4D9SA 4Z7QA 1PBYB 2AGXA 4JSVC 1OLZA 2IWFA 4BL0A 3RFHA 2WQ8A 4GQ2P 1H2YA 3I8EA 1VE6A 4JSNC 3EI2A 4CZYA 5M5SA 3UVKA 3ULEC 4CI3A 1C9LA 5FKRA 4GMBA 4J0WA 3N0EA 2VZ3A 1U2VC 2B4EA 4A2LA 4E54B 3ZDXA 2OIZA 3T3MA 4J8GA 3O4GA 4HDJA 4OZUA 4A7JA 4J81A 3EG6A 1UTCA 3QI0A 5I5MA 2EBSA 4JT5C 3V4PA 3MKQA 4Y5RD 1BPOA 3RLMD 4J84A 4CI2A 4A0AB 4JSPC 5TDHB 2QR5A 3L4MD 2TRCB 4RE5A 3MKSB 3EI4B 2HYEA 4H5JA 4LG9A 2GC7A 3IJEA 4J73A 3IUNA 4XYHA 3K72A 3SHFA 3O4IA 2Z2OA 2B5MA 4J82A 4E5ZB 2MTAH 4J78A 2P9IC 4U7AA 2HU7A 5SXMA 1JV2A 2BKLA 2XDWA 3PSLA 3A0FA 5H17A 4EWRA 4J87A 4PC0A 3K71A 2QC5A 2QZPA 1GOFA 3B7FA 5AMSA 2VDRA 1N6EA 4LGNA 2OK6A 4ZOVA 4O45A 4PXWA 4J86A 3PVWB 5CYKB 3PXTD 4O9DA 3NVQA 3I7KA 2HXCA 2EICA 2IUQA 3PE7A 4I79A 3GC3B 3OTTA 3EI3B 3CFSB 4XEIC 2VDNA 3EWEA 3SJLD 1T2XA 5CXCA 4AEZA 3C75H 3PSCB 4UI9R 5HE0B 3JZHA 1B9XA 5K19A 2YNNA 1E8NA 1N6DA 2XU7A 3JAMg 3HFQA 3K26A 3VH0A 3FCUA 4E5ZA 3VI3A 3IUMA 2VDOA 3JZGA 4L1QD 2H14A 4FB1D 2H47A 4FA9D 3MZKA 4FAVD 3MMYA 3UKUC 3EU7A 5E6RA 3AFCA 4JD2C 3VI4A 3RN1D 3DWLC 5HYNB 2OJYA 4CY5A 5FFGA 3FM0A 3ZE0A 4BH6A 5M5UA 5C92A 3VGZA 4AMZA 4JXMA 5GMKn 3JPXA 2I3TA 5KDOB 2BCJB 3MUNA 5CYKA 2AGYA 3PXWD 5FFOA 3NVXA 3FCSA 1JMXB 4X3EA 1I2MB 4A0BA 2H6QA 1N6FA 4WJKA 4TZ4A 3EI3A 4IA9A 1NEXB 4CY3A 3RRMC 5FXYA 2XZGA 3L4OD 1GOHA 3KRWB 4BCBA 4GM3A 3IJ0A 1A12A 3RSEC 3UVOA 5IGQA 3EQ9A 4CZXA 1GOTB 2I0SA 3ZE1A 5C2WB 4RE6A 2VDMA 1VZ2A 3QHYB 2VDKA 2CNXA 1FWXA 3JRPA 4X63B 2PM7B 3PVUB 1NR0A 3JZNA 3ORVD 4FHLA 3IULA 5EMMB 3EMHA 4LG8A 2PM9B 3O4HA 1R5MA 1TYQC 2B5LA 5TF2A 4GQ1A 3RN0D 2CN3A 5HE3B 5IC7A 2QXVA 1GOGA 4G56B 2H9MA 1YFQA 4GGCA 2UZYB 4WK0A 5M5TA 5CXCB 1XIPA 4GGDA 2H13A 5CXBB 1SQJA 2J55H 4BP9A 4N14A 4FWWA 5AJAA 4BP8A 3V4VA 3SLED 3SWSD 3SVWD 5IT9g 3BG0A 4L9OA 4FA4D 4A09B 4BCDA 1RI6A 4YVDA 4IMMA 4Z8LA 4QQEA 3I7PA 2XL2A 4GZ8A 3JB9L 3NIDA 2P9PC 4OWRA 5FKSA 4O1QD 4NSXA 3I89A 4MMZA 3IUJA 1YR2A 3RMZD 5GXIA 2CE8A 4IRZA 3GREA 4Y7RA 4JT6C 2CO0C 3OKYA 2PM9A 4J0XA 1QFMA 3NIGA 3DM0A 5M5RA 2P9UC 3K6SA 3F3PA 4A0BB 3GFCA 4GGAA 5B4WA 2HJBA 1VE7A 2VC2A 4A11A 2Q7QA 4FA1D 3F3GA 5E6UA 2HU5A 4K3JB 5C9ZB 3SCYA 5CXBA 2EIDA 2VDPA 2J56H 3GD1I 1UOPA 4QAMA 2B5NA 4MK0B 5HE2B 5IJ7E 4JHNA 2VZ1A 4AN0A 2XE4A 3PXSD 2EIEA 1Q47A 3I2NA 4A09A 5I5JA 4ERYA 1U4CA 2P9NC 4PBZA 5H14A 1PEVA 1S4UX 4CY2A 3SBRA 4X60B 2O9KA 1K32A 2Z2PA 3IURA 3AL8B 3IIYA 3SBQA 4GQBB 4DNWA 4QT8A 4FA5D 5GSAA 1UOOA 2YNPA 5EALA 4ZOZA 4PSXB 1PGUA 1SQ9A 2IAAA 3V9FA 3E0CA 4PBYA 2I0RA 4WK2A 1JTDB 3CIKB 1K8KC 4WK4A 3IJ1A 2G99A 1O6FA 1O6GA 4BCCA 5A2Qg 2HU8A 4NC4A 3I7NA 5FLXg 2YBAA 2IUPA 5C86A 5FQDA 3KCIA 2IWKA 3IIWA 4UM9A 1K3IA 3MXXA 5IGOA 3AL9A 2G9AA 5TEFA 2CO0A 4D0KA 2JKXA 2H6NA 2OVPB 3J81g 2P9KC 4XYIA 1E8MA 3I8CA 3CFVA
chains in the Genus database with same CATH topology
1TBGA 3OKTA 2CE9A 4GM9A 2I0TA 3I7OA 2AGLA 5EMJB 2PBIB 5AFU3 4PNKB 2P9SC 3KRXB 1XKSA 4R7AB 3OKYB 3AL8A 4GM8A 2I3SA 4ZOXA 4A11B 3SBPA 3ODTA 5H1MA 2H9PA 4CY1A 5EM2A 4JSXC 3VA6A 4CC9A 4J77A 3RFGA 3BWSA 1GG2B 5EMKB 3V7DB 5EAMA 1OMWB 4FAND 4A2MA 3JROA 3SFZA 3C5MA 3EI1B 3SXTD 3V5WB 4ZOYA 3OKWA 2H6KA 1ERJA 2IURA 4CI8A 3N0DA 2CN2A 2OVQB 5C2VB 4J8BA 2IUVA 4AOWA 1JMZB 1PI6A 3I7LA 3W15A 3UKRC 4ES0A 3IJCA 2XL3A 3MZLA 4ESGA 3AH8B 3DXMC 2AGZA 2UZXB 3C99A 2YB8B 4L3HD 2BBKH 4PSWB 4H5IA 1GP2B 1SHYB 3I7HA 2YNOA 3OL2B 1QNIA 5I5IA 4ERZA 4U1EI 2Z2NA 4E54A 1MG2A 5FA5B 4K3ID 3EI1A 1JOFA 5EARA 3P4FA 4A08B 2W18A 4X61B 3UVLA 2HKMA 4J79A 2J57G 5THAA 4CI1A 2YMUA 3DXKC 2GNQA 3ZWLB 2H3XA 2H68A 4A0AA 2AH0A 3C9CA 3UR4A 5TEEA 3NVNA 2AGWA 2AQ5A 3EI4A 4ERQA 2XYIA 4D6VA 4QRJA 3K27A 5FKTA 1VYHC 3FRXA 5JWZA 2OVRB 2H9LA 3EI2B 1MDAH 5EM2B 4ZN4A 1B9YA 3U4YA 5EMLB 3OW8A 3FGBA 1L0QA 3OL2A 5K1CC 3SMRA 2AH1A 4QL1A 3J80g 2HKRA 3UVNA 5GXHA 1A0RB 3BG1A 3SN6B 1MG3A 2HESX 2H9NA 4A08A 5HE1B 4O3TB 5EAPA 3UVMA 1XHMA 1GXRA 4BUJC 2PM6B 4L3GD 2GC4A 2P9LC 4KFMB 4CZVA 3F3FA 1JJUB 3DSMA 1P22A 2HJ4A 5HQGA 3IKOA 2OK4A 5FKQA 4O3UB 5IJ8E 1PBYB 2AGXA 4JSVC 1OLZA 2IWFA 4BL0A 3RFHA 4GQ2P 3I8EA 4JSNC 3EI2A 4CZYA 3UVKA 3ULEC 4CI3A 5FKRA 4GMBA 4J0WA 3N0EA 1U2VC 2B4EA 4A2LA 4E54B 2OIZA 4J8GA 4HDJA 4OZUA 4A7JA 4J81A 3EG6A 5I5MA 2EBSA 4JT5C 3MKQA 4Y5RD 3RLMD 4J84A 4CI2A 4A0AB 4JSPC 5TDHB 3L4MD 2TRCB 3MKSB 3EI4B 2HYEA 4H5JA 4LG9A 2GC7A 4J73A 4XYHA 3SHFA 2Z2OA 2B5MA 4J82A 4E5ZB 2MTAH 4J78A 2P9IC 4U7AA 5SXMA 3PSLA 3A0FA 5H17A 4EWRA 4J87A 4PC0A 2QC5A 3B7FA 5AMSA 1N6EA 4LGNA 2OK6A 4ZOVA 4O45A 4PXWA 4J86A 3PVWB 5CYKB 3PXTD 4O9DA 3NVQA 3I7KA 2HXCA 2IUQA 3PE7A 4I79A 3OTTA 3EI3B 3CFSB 4XEIC 3EWEA 3SJLD 5CXCA 4AEZA 3C75H 3PSCB 4UI9R 5HE0B 3JZHA 1B9XA 5K19A 2YNNA 1N6DA 2XU7A 3JAMg 3HFQA 3K26A 3VH0A 4E5ZA 3JZGA 4L1QD 2H14A 4FB1D 2H47A 4FA9D 3MZKA 4FAVD 3MMYA 3UKUC 3EU7A 3AFCA 4JD2C 3RN1D 3DWLC 5HYNB 2OJYA 4CY5A 3FM0A 4BH6A 3VGZA 4JXMA 5GMKn 3JPXA 2I3TA 5KDOB 2BCJB 5CYKA 2AGYA 3PXWD 3NVXA 1JMXB 4X3EA 4A0BA 2H6QA 1N6FA 4TZ4A 3EI3A 4IA9A 1NEXB 4CY3A 3RRMC 5FXYA 3L4OD 3KRWB 4GM3A 3IJ0A 3RSEC 3UVOA 5IGQA 4CZXA 1GOTB 2I0SA 5C2WB 2CNXA 1FWXA 3JRPA 4X63B 2PM7B 3PVUB 1NR0A 3JZNA 3ORVD 4FHLA 5EMMB 3EMHA 4LG8A 2PM9B 1R5MA 1TYQC 2B5LA 5TF2A 4GQ1A 3RN0D 2CN3A 5HE3B 5IC7A 2QXVA 4G56B 2H9MA 1YFQA 4GGCA 2UZYB 5CXCB 1XIPA 4GGDA 2H13A 5CXBB 1SQJA 2J55H 4N14A 4FWWA 5AJAA 3SLED 3SWSD 3SVWD 5IT9g 3BG0A 4L9OA 4FA4D 4A09B 1RI6A 4YVDA 4IMMA 4Z8LA 4QQEA 3I7PA 2XL2A 4GZ8A 3JB9L 2P9PC 4OWRA 5FKSA 4O1QD 4NSXA 3I89A 3RMZD 5GXIA 2CE8A 3GREA 4Y7RA 4JT6C 2CO0C 3OKYA 2PM9A 4J0XA 3DM0A 2P9UC 3F3PA 4A0BB 3GFCA 4GGAA 5B4WA 2HJBA 4A11A 2Q7QA 4FA1D 3F3GA 4K3JB 5C9ZB 3SCYA 5CXBA 2J56H 2B5NA 4MK0B 5HE2B 5IJ7E 3PXSD 1Q47A 3I2NA 4A09A 5I5JA 4ERYA 1U4CA 2P9NC 4PBZA 5H14A 1PEVA 1S4UX 4CY2A 3SBRA 4X60B 2O9KA 1K32A 2Z2PA 3AL8B 3IIYA 3SBQA 4GQBB 4FA5D 4QT8A 5GSAA 2YNPA 5EALA 4ZOZA 4PSXB 1PGUA 1SQ9A 2IAAA 3V9FA 3E0CA 4PBYA 2I0RA 3CIKB 1K8KC 3IJ1A 2G99A 5A2Qg 3I7NA 5FLXg 2YBAA 2IUPA 5FQDA 2IWKA 3IIWA 3MXXA 5IGOA 3AL9A 2G9AA 5TEFA 2CO0A 4D0KA 2H6NA 2OVPB 3J81g 2P9KC 4XYIA 3I8CA 3CFVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TBG A;  3OKT A;  2CE9 A;  4GM9 A;  2I0T A;  3I7O A;  2AGL A;  5EMJ B;  2PBI B;  5AFU 3;  4PNK B;  2P9S C;  3KRX B;  1XKS A;  4R7A B;  3OKY B;  3AL8 A;  4GM8 A;  2I3S A;  4ZOX A;  4A11 B;  3SBP A;  3ODT A;  5H1M A;  2H9P A;  4CY1 A;  5EM2 A;  4JSX C;  3VA6 A;  4CC9 A;  4J77 A;  3RFG A;  3BWS A;  1GG2 B;  5EMK B;  3V7D B;  5EAM A;  1OMW B;  4FAN D;  4A2M A;  3JRO A;  3SFZ A;  3C5M A;  3EI1 B;  3SXT D;  3V5W B;  4ZOY A;  3OKW A;  2H6K A;  1ERJ A;  2IUR A;  4CI8 A;  3N0D A;  2CN2 A;  2OVQ B;  5C2V B;  4J8B A;  2IUV A;  4AOW A;  1JMZ B;  1PI6 A;  3I7L A;  3W15 A;  3UKR C;  4ES0 A;  3IJC A;  2XL3 A;  3MZL A;  4ESG A;  3AH8 B;  3DXM C;  2AGZ A;  2UZX B;  3C99 A;  2YB8 B;  4L3H D;  2BBK H;  4PSW B;  4H5I A;  1GP2 B;  1SHY B;  3I7H A;  2YNO A;  3OL2 B;  1QNI A;  5I5I A;  4ERZ A;  4U1E I;  2Z2N A;  4E54 A;  1MG2 A;  5FA5 B;  4K3I D;  3EI1 A;  1JOF A;  5EAR A;  3P4F A;  4A08 B;  2W18 A;  4X61 B;  3UVL A;  2HKM A;  4J79 A;  2J57 G;  5THA A;  4CI1 A;  2YMU A;  3DXK C;  2GNQ A;  3ZWL B;  2H3X A;  2H68 A;  4A0A A;  2AH0 A;  3C9C A;  3UR4 A;  5TEE A;  3NVN A;  2AGW A;  2AQ5 A;  3EI4 A;  4ERQ A;  2XYI A;  4D6V A;  4QRJ A;  3K27 A;  5FKT A;  1VYH C;  3FRX A;  5JWZ A;  2OVR B;  2H9L A;  3EI2 B;  1MDA H;  5EM2 B;  4ZN4 A;  1B9Y A;  3U4Y A;  5EML B;  3OW8 A;  3FGB A;  1L0Q A;  3OL2 A;  5K1C C;  3SMR A;  2AH1 A;  4QL1 A;  3J80 g;  2HKR A;  3UVN A;  5GXH A;  1A0R B;  3BG1 A;  3SN6 B;  1MG3 A;  2HES X;  2H9N A;  4A08 A;  5HE1 B;  4O3T B;  5EAP A;  3UVM A;  1XHM A;  1GXR A;  4BUJ C;  2PM6 B;  4L3G D;  2GC4 A;  2P9L C;  4KFM B;  4CZV A;  3F3F A;  1JJU B;  3DSM A;  1P22 A;  2HJ4 A;  5HQG A;  3IKO A;  2OK4 A;  5FKQ A;  4O3U B;  5IJ8 E;  1PBY B;  2AGX A;  4JSV C;  1OLZ A;  2IWF A;  4BL0 A;  3RFH A;  4GQ2 P;  3I8E A;  4JSN C;  3EI2 A;  4CZY A;  3UVK A;  3ULE C;  4CI3 A;  5FKR A;  4GMB A;  4J0W A;  3N0E A;  1U2V C;  2B4E A;  4A2L A;  4E54 B;  2OIZ A;  4J8G A;  4HDJ A;  4OZU A;  4A7J A;  4J81 A;  3EG6 A;  5I5M A;  2EBS A;  4JT5 C;  3MKQ A;  4Y5R D;  3RLM D;  4J84 A;  4CI2 A;  4A0A B;  4JSP C;  5TDH B;  3L4M D;  2TRC B;  3MKS B;  3EI4 B;  2HYE A;  4H5J A;  4LG9 A;  2GC7 A;  4J73 A;  4XYH A;  3SHF A;  2Z2O A;  2B5M A;  4J82 A;  4E5Z B;  2MTA H;  4J78 A;  2P9I C;  4U7A A;  5SXM A;  3PSL A;  3A0F A;  5H17 A;  4EWR A;  4J87 A;  4PC0 A;  2QC5 A;  3B7F A;  5AMS A;  1N6E A;  4LGN A;  2OK6 A;  4ZOV A;  4O45 A;  4PXW A;  4J86 A;  3PVW B;  5CYK B;  3PXT D;  4O9D A;  3NVQ A;  3I7K A;  2HXC A;  2IUQ A;  3PE7 A;  4I79 A;  3OTT A;  3EI3 B;  3CFS B;  4XEI C;  3EWE A;  3SJL D;  5CXC A;  4AEZ A;  3C75 H;  3PSC B;  4UI9 R;  5HE0 B;  3JZH A;  1B9X A;  5K19 A;  2YNN A;  1N6D A;  2XU7 A;  3JAM g;  3HFQ A;  3K26 A;  3VH0 A;  4E5Z A;  3JZG A;  4L1Q D;  2H14 A;  4FB1 D;  2H47 A;  4FA9 D;  3MZK A;  4FAV D;  3MMY A;  3UKU C;  3EU7 A;  3AFC A;  4JD2 C;  3RN1 D;  3DWL C;  5HYN B;  2OJY A;  4CY5 A;  3FM0 A;  4BH6 A;  3VGZ A;  4JXM A;  5GMK n;  3JPX A;  2I3T A;  5KDO B;  2BCJ B;  5CYK A;  2AGY A;  3PXW D;  3NVX A;  1JMX B;  4X3E A;  4A0B A;  2H6Q A;  1N6F A;  4TZ4 A;  3EI3 A;  4IA9 A;  1NEX B;  4CY3 A;  3RRM C;  5FXY A;  3L4O D;  3KRW B;  4GM3 A;  3IJ0 A;  3RSE C;  3UVO A;  5IGQ A;  4CZX A;  1GOT B;  2I0S A;  5C2W B;  2CNX A;  1FWX A;  3JRP A;  4X63 B;  2PM7 B;  3PVU B;  1NR0 A;  3JZN A;  3ORV D;  4FHL A;  5EMM B;  3EMH A;  4LG8 A;  2PM9 B;  1R5M A;  1TYQ C;  2B5L A;  5TF2 A;  4GQ1 A;  3RN0 D;  2CN3 A;  5HE3 B;  5IC7 A;  2QXV A;  4G56 B;  2H9M A;  1YFQ A;  4GGC A;  2UZY B;  5CXC B;  1XIP A;  4GGD A;  2H13 A;  5CXB B;  1SQJ A;  2J55 H;  4N14 A;  4FWW A;  5AJA A;  3SLE D;  3SWS D;  3SVW D;  5IT9 g;  3BG0 A;  4L9O A;  4FA4 D;  4A09 B;  1RI6 A;  4YVD A;  4IMM A;  4Z8L A;  4QQE A;  3I7P A;  2XL2 A;  4GZ8 A;  3JB9 L;  2P9P C;  4OWR A;  5FKS A;  4O1Q D;  4NSX A;  3I89 A;  3RMZ D;  5GXI A;  2CE8 A;  3GRE A;  4Y7R A;  4JT6 C;  2CO0 C;  3OKY A;  2PM9 A;  4J0X A;  3DM0 A;  2P9U C;  3F3P A;  4A0B B;  3GFC A;  4GGA A;  5B4W A;  2HJB A;  4A11 A;  2Q7Q A;  4FA1 D;  3F3G A;  4K3J B;  5C9Z B;  3SCY A;  5CXB A;  2J56 H;  2B5N A;  4MK0 B;  5HE2 B;  5IJ7 E;  3PXS D;  1Q47 A;  3I2N A;  4A09 A;  5I5J A;  4ERY A;  1U4C A;  2P9N C;  4PBZ A;  5H14 A;  1PEV A;  1S4U X;  4CY2 A;  3SBR A;  4X60 B;  2O9K A;  1K32 A;  2Z2P A;  3AL8 B;  3IIY A;  3SBQ A;  4GQB B;  4FA5 D;  4QT8 A;  5GSA A;  2YNP A;  5EAL A;  4ZOZ A;  4PSX B;  1PGU A;  1SQ9 A;  2IAA A;  3V9F A;  3E0C A;  4PBY A;  2I0R A;  3CIK B;  1K8K C;  3IJ1 A;  2G99 A;  5A2Q g;  3I7N A;  5FLX g;  2YBA A;  2IUP A;  5FQD A;  2IWK A;  3IIW A;  3MXX A;  5IGO A;  3AL9 A;  2G9A A;  5TEF A;  2CO0 A;  4D0K A;  2H6N A;  2OVP B;  3J81 g;  2P9K C;  4XYI A;  3I8C A;  3CFV A; 
#chains in the Genus database with same CATH topology
 1TBG A;  3OKT A;  2CE9 A;  4GM9 A;  1L5G A;  2I0T A;  1U8C A;  3I7O A;  1TYE A;  2AGL A;  5EMJ B;  2PBI B;  5AFU 3;  4PNK B;  2P9S C;  3KRX B;  1XKS A;  4R7A B;  3OKY B;  3IVM A;  3ZE2 A;  3AL8 A;  4NAA A;  3OF7 A;  1QFS A;  4GM8 A;  2I3S A;  3IUQ A;  4ZOX A;  4A11 B;  5HDB A;  3SBP A;  3ODT A;  5H1M A;  2H9P A;  4CY1 A;  4JHP C;  5EM2 A;  4JSX C;  3VA6 A;  4CC9 A;  4J77 A;  3RFG A;  3BWS A;  4Z7N A;  1GG2 B;  5EMK B;  3V7D B;  5EAM A;  1OMW B;  4FAN D;  4A2M A;  3JRO A;  3SFZ A;  3C5M A;  3EI1 B;  3SXT D;  3V5W B;  4ZOY A;  3OKW A;  2H6K A;  5M5V A;  1ERJ A;  2IUR A;  4CI8 A;  3ZDY A;  3N0D A;  1H2Z A;  2CN2 A;  2OVQ B;  5C2V B;  4J8B A;  2IUV A;  4AOW A;  1JMZ B;  4AN1 A;  1PI6 A;  3I7L A;  3DDU A;  1C9I A;  4NEN A;  3W15 A;  3UKR C;  4ES0 A;  3IJC A;  2XL3 A;  3MZL A;  4ESG A;  3AH8 B;  3DXM C;  2AGZ A;  2UZX B;  3C99 A;  3EQ8 A;  2YB8 B;  4L3H D;  1UOQ A;  1E5T A;  2BBK H;  4PSW B;  4H5I A;  1GP2 B;  1SHY B;  3I7H A;  2YNO A;  3OL2 B;  1QNI A;  1H2W A;  1H2X A;  5I5I A;  4O02 A;  4ERZ A;  4U1E I;  2Z2N A;  3T3P A;  2VDL A;  4E54 A;  1MG2 A;  5FA5 B;  4AMY A;  4K3I D;  3EI1 A;  1JOF A;  5EAR A;  3EQ7 A;  3P4F A;  4A08 B;  2W18 A;  4G1M A;  4X61 B;  3UVL A;  4DNV A;  2HKM A;  4G1E A;  4J79 A;  2J57 G;  4L1M A;  5THA A;  4CI1 A;  2YMU A;  3DXK C;  2GNQ A;  3ZWL B;  4G55 A;  2H3X A;  2H68 A;  3NIF A;  4A0A A;  2AH0 A;  3C9C A;  3UR4 A;  5TEE A;  3NVN A;  2AGW A;  2AQ5 A;  3EI4 A;  4O2W A;  4ERQ A;  2XYI A;  4D6V A;  4QRJ A;  3K27 A;  5FKT A;  1VYH C;  3FRX A;  5JWZ A;  4NBM A;  4MMY A;  2OVR B;  3O4J A;  2H9L A;  3EI2 B;  1MDA H;  5EM2 B;  4ZN4 A;  1B9Y A;  3U4Y A;  3ZDZ A;  5EML B;  3OW8 A;  3FGB A;  5E6S A;  1L0Q A;  3MVD K;  3OL2 A;  5K1C C;  3SMR A;  2AH1 A;  4MMX A;  4UM8 A;  4QL1 A;  4DNU A;  3J80 g;  2HKR A;  3UVN A;  5GXH A;  1A0R B;  3BG1 A;  3SN6 B;  4Z7O A;  3MUO A;  1MG3 A;  2HES X;  2H9N A;  4A08 A;  5HE1 B;  5M61 A;  4O3T B;  5EAP A;  3UVM A;  1XHM A;  1GXR A;  4BUJ C;  2PM6 B;  4L3G D;  2EIB A;  1M1X A;  2GC4 A;  2P9L C;  4KFM B;  4CZV A;  1VZ3 A;  1JJU B;  3DSM A;  3F3F A;  1P22 A;  2HJ4 A;  5HQG A;  4AX4 A;  3IKO A;  2OK4 A;  5FKQ A;  2VDQ A;  4O3U B;  5IJ8 E;  4D9S A;  4Z7Q A;  1PBY B;  2AGX A;  4JSV C;  1OLZ A;  2IWF A;  4BL0 A;  3RFH A;  2WQ8 A;  4GQ2 P;  1H2Y A;  3I8E A;  1VE6 A;  4JSN C;  3EI2 A;  4CZY A;  5M5S A;  3UVK A;  3ULE C;  4CI3 A;  1C9L A;  5FKR A;  4GMB A;  4J0W A;  3N0E A;  2VZ3 A;  1U2V C;  2B4E A;  4A2L A;  4E54 B;  3ZDX A;  2OIZ A;  3T3M A;  4J8G A;  3O4G A;  4HDJ A;  4OZU A;  4A7J A;  4J81 A;  3EG6 A;  1UTC A;  3QI0 A;  5I5M A;  2EBS A;  4JT5 C;  3V4P A;  3MKQ A;  4Y5R D;  1BPO A;  3RLM D;  4J84 A;  4CI2 A;  4A0A B;  4JSP C;  5TDH B;  2QR5 A;  3L4M D;  2TRC B;  4RE5 A;  3MKS B;  3EI4 B;  2HYE A;  4H5J A;  4LG9 A;  2GC7 A;  3IJE A;  4J73 A;  3IUN A;  4XYH A;  3K72 A;  3SHF A;  3O4I A;  2Z2O A;  2B5M A;  4J82 A;  4E5Z B;  2MTA H;  4J78 A;  2P9I C;  4U7A A;  2HU7 A;  5SXM A;  1JV2 A;  2BKL A;  2XDW A;  3PSL A;  3A0F A;  5H17 A;  4EWR A;  4J87 A;  4PC0 A;  3K71 A;  2QC5 A;  2QZP A;  1GOF A;  3B7F A;  5AMS A;  2VDR A;  1N6E A;  4LGN A;  2OK6 A;  4ZOV A;  4O45 A;  4PXW A;  4J86 A;  3PVW B;  5CYK B;  3PXT D;  4O9D A;  3NVQ A;  3I7K A;  2HXC A;  2EIC A;  2IUQ A;  3PE7 A;  4I79 A;  3GC3 B;  3OTT A;  3EI3 B;  3CFS B;  4XEI C;  2VDN A;  3EWE A;  3SJL D;  1T2X A;  5CXC A;  4AEZ A;  3C75 H;  3PSC B;  4UI9 R;  5HE0 B;  3JZH A;  1B9X A;  5K19 A;  2YNN A;  1E8N A;  1N6D A;  2XU7 A;  3JAM g;  3HFQ A;  3K26 A;  3VH0 A;  3FCU A;  4E5Z A;  3VI3 A;  3IUM A;  2VDO A;  3JZG A;  4L1Q D;  2H14 A;  4FB1 D;  2H47 A;  4FA9 D;  3MZK A;  4FAV D;  3MMY A;  3UKU C;  3EU7 A;  5E6R A;  3AFC A;  4JD2 C;  3VI4 A;  3RN1 D;  3DWL C;  5HYN B;  2OJY A;  4CY5 A;  5FFG A;  3FM0 A;  3ZE0 A;  4BH6 A;  5M5U A;  5C92 A;  3VGZ A;  4AMZ A;  4JXM A;  5GMK n;  3JPX A;  2I3T A;  5KDO B;  2BCJ B;  3MUN A;  5CYK A;  2AGY A;  3PXW D;  5FFO A;  3NVX A;  3FCS A;  1JMX B;  4X3E A;  1I2M B;  4A0B A;  2H6Q A;  1N6F A;  4WJK A;  4TZ4 A;  3EI3 A;  4IA9 A;  1NEX B;  4CY3 A;  3RRM C;  5FXY A;  2XZG A;  3L4O D;  1GOH A;  3KRW B;  4BCB A;  4GM3 A;  3IJ0 A;  1A12 A;  3RSE C;  3UVO A;  5IGQ A;  3EQ9 A;  4CZX A;  1GOT B;  2I0S A;  3ZE1 A;  5C2W B;  4RE6 A;  2VDM A;  1VZ2 A;  3QHY B;  2VDK A;  2CNX A;  1FWX A;  3JRP A;  4X63 B;  2PM7 B;  3PVU B;  1NR0 A;  3JZN A;  3ORV D;  4FHL A;  3IUL A;  5EMM B;  3EMH A;  4LG8 A;  2PM9 B;  3O4H A;  1R5M A;  1TYQ C;  2B5L A;  5TF2 A;  4GQ1 A;  3RN0 D;  2CN3 A;  5HE3 B;  5IC7 A;  2QXV A;  1GOG A;  4G56 B;  2H9M A;  1YFQ A;  4GGC A;  2UZY B;  4WK0 A;  5M5T A;  5CXC B;  1XIP A;  4GGD A;  2H13 A;  5CXB B;  1SQJ A;  2J55 H;  4BP9 A;  4N14 A;  4FWW A;  5AJA A;  4BP8 A;  3V4V A;  3SLE D;  3SWS D;  3SVW D;  5IT9 g;  3BG0 A;  4L9O A;  4FA4 D;  4A09 B;  4BCD A;  1RI6 A;  4YVD A;  4IMM A;  4Z8L A;  4QQE A;  3I7P A;  2XL2 A;  4GZ8 A;  3JB9 L;  3NID A;  2P9P C;  4OWR A;  5FKS A;  4O1Q D;  4NSX A;  3I89 A;  4MMZ A;  3IUJ A;  1YR2 A;  3RMZ D;  5GXI A;  2CE8 A;  4IRZ A;  3GRE A;  4Y7R A;  4JT6 C;  2CO0 C;  3OKY A;  2PM9 A;  4J0X A;  1QFM A;  3NIG A;  3DM0 A;  5M5R A;  2P9U C;  3K6S A;  3F3P A;  4A0B B;  3GFC A;  4GGA A;  5B4W A;  2HJB A;  1VE7 A;  2VC2 A;  4A11 A;  2Q7Q A;  4FA1 D;  3F3G A;  5E6U A;  2HU5 A;  4K3J B;  5C9Z B;  3SCY A;  5CXB A;  2EID A;  2VDP A;  2J56 H;  3GD1 I;  1UOP A;  4QAM A;  2B5N A;  4MK0 B;  5HE2 B;  5IJ7 E;  4JHN A;  2VZ1 A;  4AN0 A;  2XE4 A;  3PXS D;  2EIE A;  1Q47 A;  3I2N A;  4A09 A;  5I5J A;  4ERY A;  1U4C A;  2P9N C;  4PBZ A;  5H14 A;  1PEV A;  1S4U X;  4CY2 A;  3SBR A;  4X60 B;  2O9K A;  1K32 A;  2Z2P A;  3IUR A;  3AL8 B;  3IIY A;  3SBQ A;  4GQB B;  4DNW A;  4QT8 A;  4FA5 D;  5GSA A;  1UOO A;  2YNP A;  5EAL A;  4ZOZ A;  4PSX B;  1PGU A;  1SQ9 A;  2IAA A;  3V9F A;  3E0C A;  4PBY A;  2I0R A;  4WK2 A;  1JTD B;  3CIK B;  1K8K C;  4WK4 A;  3IJ1 A;  2G99 A;  1O6F A;  1O6G A;  4BCC A;  5A2Q g;  2HU8 A;  4NC4 A;  3I7N A;  5FLX g;  2YBA A;  2IUP A;  5C86 A;  5FQD A;  3KCI A;  2IWK A;  3IIW A;  4UM9 A;  1K3I A;  3MXX A;  5IGO A;  3AL9 A;  2G9A A;  5TEF A;  2CO0 A;  4D0K A;  2JKX A;  2H6N A;  2OVP B;  3J81 g;  2P9K C;  4XYI A;  1E8M A;  3I8C A;  3CFV A; 
#chains in the Genus database with same CATH homology
 1TBG A;  3OKT A;  2CE9 A;  4GM9 A;  2I0T A;  3I7O A;  2AGL A;  5EMJ B;  2PBI B;  5AFU 3;  4PNK B;  2P9S C;  3KRX B;  1XKS A;  4R7A B;  3OKY B;  3AL8 A;  4GM8 A;  2I3S A;  4ZOX A;  4A11 B;  3SBP A;  3ODT A;  5H1M A;  2H9P A;  4CY1 A;  5EM2 A;  4JSX C;  3VA6 A;  4CC9 A;  4J77 A;  3RFG A;  3BWS A;  1GG2 B;  5EMK B;  3V7D B;  5EAM A;  1OMW B;  4FAN D;  4A2M A;  3JRO A;  3SFZ A;  3C5M A;  3EI1 B;  3SXT D;  3V5W B;  4ZOY A;  3OKW A;  2H6K A;  1ERJ A;  2IUR A;  4CI8 A;  3N0D A;  2CN2 A;  2OVQ B;  5C2V B;  4J8B A;  2IUV A;  4AOW A;  1JMZ B;  1PI6 A;  3I7L A;  3W15 A;  3UKR C;  4ES0 A;  3IJC A;  2XL3 A;  3MZL A;  4ESG A;  3AH8 B;  3DXM C;  2AGZ A;  2UZX B;  3C99 A;  2YB8 B;  4L3H D;  2BBK H;  4PSW B;  4H5I A;  1GP2 B;  1SHY B;  3I7H A;  2YNO A;  3OL2 B;  1QNI A;  5I5I A;  4ERZ A;  4U1E I;  2Z2N A;  4E54 A;  1MG2 A;  5FA5 B;  4K3I D;  3EI1 A;  1JOF A;  5EAR A;  3P4F A;  4A08 B;  2W18 A;  4X61 B;  3UVL A;  2HKM A;  4J79 A;  2J57 G;  5THA A;  4CI1 A;  2YMU A;  3DXK C;  2GNQ A;  3ZWL B;  2H3X A;  2H68 A;  4A0A A;  2AH0 A;  3C9C A;  3UR4 A;  5TEE A;  3NVN A;  2AGW A;  2AQ5 A;  3EI4 A;  4ERQ A;  2XYI A;  4D6V A;  4QRJ A;  3K27 A;  5FKT A;  1VYH C;  3FRX A;  5JWZ A;  2OVR B;  2H9L A;  3EI2 B;  1MDA H;  5EM2 B;  4ZN4 A;  1B9Y A;  3U4Y A;  5EML B;  3OW8 A;  3FGB A;  1L0Q A;  3OL2 A;  5K1C C;  3SMR A;  2AH1 A;  4QL1 A;  3J80 g;  2HKR A;  3UVN A;  5GXH A;  1A0R B;  3BG1 A;  3SN6 B;  1MG3 A;  2HES X;  2H9N A;  4A08 A;  5HE1 B;  4O3T B;  5EAP A;  3UVM A;  1XHM A;  1GXR A;  4BUJ C;  2PM6 B;  4L3G D;  2GC4 A;  2P9L C;  4KFM B;  4CZV A;  3F3F A;  1JJU B;  3DSM A;  1P22 A;  2HJ4 A;  5HQG A;  3IKO A;  2OK4 A;  5FKQ A;  4O3U B;  5IJ8 E;  1PBY B;  2AGX A;  4JSV C;  1OLZ A;  2IWF A;  4BL0 A;  3RFH A;  4GQ2 P;  3I8E A;  4JSN C;  3EI2 A;  4CZY A;  3UVK A;  3ULE C;  4CI3 A;  5FKR A;  4GMB A;  4J0W A;  3N0E A;  1U2V C;  2B4E A;  4A2L A;  4E54 B;  2OIZ A;  4J8G A;  4HDJ A;  4OZU A;  4A7J A;  4J81 A;  3EG6 A;  5I5M A;  2EBS A;  4JT5 C;  3MKQ A;  4Y5R D;  3RLM D;  4J84 A;  4CI2 A;  4A0A B;  4JSP C;  5TDH B;  3L4M D;  2TRC B;  3MKS B;  3EI4 B;  2HYE A;  4H5J A;  4LG9 A;  2GC7 A;  4J73 A;  4XYH A;  3SHF A;  2Z2O A;  2B5M A;  4J82 A;  4E5Z B;  2MTA H;  4J78 A;  2P9I C;  4U7A A;  5SXM A;  3PSL A;  3A0F A;  5H17 A;  4EWR A;  4J87 A;  4PC0 A;  2QC5 A;  3B7F A;  5AMS A;  1N6E A;  4LGN A;  2OK6 A;  4ZOV A;  4O45 A;  4PXW A;  4J86 A;  3PVW B;  5CYK B;  3PXT D;  4O9D A;  3NVQ A;  3I7K A;  2HXC A;  2IUQ A;  3PE7 A;  4I79 A;  3OTT A;  3EI3 B;  3CFS B;  4XEI C;  3EWE A;  3SJL D;  5CXC A;  4AEZ A;  3C75 H;  3PSC B;  4UI9 R;  5HE0 B;  3JZH A;  1B9X A;  5K19 A;  2YNN A;  1N6D A;  2XU7 A;  3JAM g;  3HFQ A;  3K26 A;  3VH0 A;  4E5Z A;  3JZG A;  4L1Q D;  2H14 A;  4FB1 D;  2H47 A;  4FA9 D;  3MZK A;  4FAV D;  3MMY A;  3UKU C;  3EU7 A;  3AFC A;  4JD2 C;  3RN1 D;  3DWL C;  5HYN B;  2OJY A;  4CY5 A;  3FM0 A;  4BH6 A;  3VGZ A;  4JXM A;  5GMK n;  3JPX A;  2I3T A;  5KDO B;  2BCJ B;  5CYK A;  2AGY A;  3PXW D;  3NVX A;  1JMX B;  4X3E A;  4A0B A;  2H6Q A;  1N6F A;  4TZ4 A;  3EI3 A;  4IA9 A;  1NEX B;  4CY3 A;  3RRM C;  5FXY A;  3L4O D;  3KRW B;  4GM3 A;  3IJ0 A;  3RSE C;  3UVO A;  5IGQ A;  4CZX A;  1GOT B;  2I0S A;  5C2W B;  2CNX A;  1FWX A;  3JRP A;  4X63 B;  2PM7 B;  3PVU B;  1NR0 A;  3JZN A;  3ORV D;  4FHL A;  5EMM B;  3EMH A;  4LG8 A;  2PM9 B;  1R5M A;  1TYQ C;  2B5L A;  5TF2 A;  4GQ1 A;  3RN0 D;  2CN3 A;  5HE3 B;  5IC7 A;  2QXV A;  4G56 B;  2H9M A;  1YFQ A;  4GGC A;  2UZY B;  5CXC B;  1XIP A;  4GGD A;  2H13 A;  5CXB B;  1SQJ A;  2J55 H;  4N14 A;  4FWW A;  5AJA A;  3SLE D;  3SWS D;  3SVW D;  5IT9 g;  3BG0 A;  4L9O A;  4FA4 D;  4A09 B;  1RI6 A;  4YVD A;  4IMM A;  4Z8L A;  4QQE A;  3I7P A;  2XL2 A;  4GZ8 A;  3JB9 L;  2P9P C;  4OWR A;  5FKS A;  4O1Q D;  4NSX A;  3I89 A;  3RMZ D;  5GXI A;  2CE8 A;  3GRE A;  4Y7R A;  4JT6 C;  2CO0 C;  3OKY A;  2PM9 A;  4J0X A;  3DM0 A;  2P9U C;  3F3P A;  4A0B B;  3GFC A;  4GGA A;  5B4W A;  2HJB A;  4A11 A;  2Q7Q A;  4FA1 D;  3F3G A;  4K3J B;  5C9Z B;  3SCY A;  5CXB A;  2J56 H;  2B5N A;  4MK0 B;  5HE2 B;  5IJ7 E;  3PXS D;  1Q47 A;  3I2N A;  4A09 A;  5I5J A;  4ERY A;  1U4C A;  2P9N C;  4PBZ A;  5H14 A;  1PEV A;  1S4U X;  4CY2 A;  3SBR A;  4X60 B;  2O9K A;  1K32 A;  2Z2P A;  3AL8 B;  3IIY A;  3SBQ A;  4GQB B;  4FA5 D;  4QT8 A;  5GSA A;  2YNP A;  5EAL A;  4ZOZ A;  4PSX B;  1PGU A;  1SQ9 A;  2IAA A;  3V9F A;  3E0C A;  4PBY A;  2I0R A;  3CIK B;  1K8K C;  3IJ1 A;  2G99 A;  5A2Q g;  3I7N A;  5FLX g;  2YBA A;  2IUP A;  5FQD A;  2IWK A;  3IIW A;  3MXX A;  5IGO A;  3AL9 A;  2G9A A;  5TEF A;  2CO0 A;  4D0K A;  2H6N A;  2OVP B;  3J81 g;  2P9K C;  4XYI A;  3I8C A;  3CFV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...