4J87A

Crystal structure of alpha-cop
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
327
structure length
316
Chain Sequence
b'MAMLTKFESRSSRAKGVAFHPTQPWILTSLHNGRIQLWDYRMGTLLDRFDGHDGPVRGIAFHPTQPIFVSGGDDYKVNVWNYKSRKLLFSLCGHMDYVRVCTFHHEYPWILSCSDDQTIRIWNWQSRNCIAILTGHSHYVMCAAFHPSEDLIVSASLDQTVRVWDISGLRMKNAAPVSMSKEDQKAQAADAIVKFVLEGHDRGVNWCAFHPTLPLILSAGDDRLVKLWRMTASKAWEVDTCRGHFNNVSCCLFHPHQELILSASEDKTIRVWDLNRRTAVQTFRRANDRFWFITVHPKLNLFAAAHDSGVMVFKLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords coatomer subunit alpha
molecule tags Protein transport
publication title Rules for the recognition of dilysine retrieval motifs by coatomer.
pubmed doi rcsb
total genus 79
structure length 316
sequence length 327
ec nomenclature
pdb deposition date 2013-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4j87A00
2B5LA 1XKSA 2Q7QA 4J77A 4FAVD 4A0AA 4O3TB 4I79A 2HYEA 4GM8A 5FA5B 4CI1A 3DXMC 4CY3A 4CY2A 4GQBB 5H17A 1JMXB 1P22A 4GZ8A 3C5MA 3JROA 3RRMC 3IJ1A 2YNOA 4AOWA 2H6QA 5HE0B 2CO0C 4CY5A 3I7OA 3DWLC 1GXRA 4J79A 3OKYB 5EMLB 1TYQC 3MMYA 1K32A 5TEEA 2CN3A 3OW8A 3IIWA 4QRJA 3I7NA 4H5IA 1R5MA 4QL1A 4AEZA 2PM9B 5C9ZB 2YB8B 5FKRA 3L4OD 2TRCB 4JT6C 4JXMA 3EI2B 1TBGA 5AMSA 4K3ID 2QC5A 5EMKB 5IGQA 2AGZA 2IWFA 3PVUB 2HESX 5I5JA 2IURA 3L4MD 4J0WA 4QQEA 5EARA 5TEFA 1A0RB 4JSPC 3CFSB 4J0XA 3CFVA 2H6NA 5FKSA 2PBIB 3AL8B 3EI3B 4CZVA 3EU7A 3HFQA 2HXCA 3MKQA 3SBPA 2P9UC 3W15A 2GC7A 2P9IC 3SBRA 3EI3A 2AGLA 3FGBA 4J78A 4ZOYA 3GFCA 4J86A 4O45A 2OJYA 3I7PA 4PC0A 4PNKB 5CXCB 1SQJA 3BG0A 5EM2B 3MKSB 4E54B 4EWRA 2UZXB 3ODTA 5GXHA 1N6EA 3ULEC 3PXSD 3DXKC 4GM9A 5CXCA 2YNPA 5AJAA 4GMBA 5HQGA 4FA9D 3JB9L 2G9AA 3JAMg 3DM0A 5FXYA 3OL2B 4ES0A 3PVWB 1U4CA 5IC7A 3I8EA 5B4WA 1SQ9A 2J57G 2HJBA 4CY1A 4D0KA 4XEIC 3RN1D 3FRXA 4XYHA 5EAPA 4FB1D 4A7JA 4ERZA 2H47A 2PM9A 2W18A 2HKMA 2OVPB 2HJ4A 3K27A 3EI2A 2I3TA 2CO0A 1PI6A 4CC9A 1MG2A 5I5IA 3UVLA 5IJ8E 3PXWD 4A2LA 1NR0A 4ERQA 3C9CA 3EI4B 3SBQA 3PE7A 1FWXA 2PM7B 2IUVA 5CXBB 2QXVA 4QT8A 1U2VC 5TDHB 4J82A 4ZOVA 2OK6A 2H9PA 3KRXB 2OVRB 1PBYB 4X3EA 4X61B 1K8KC 4OWRA 4FWWA 3P4FA 3JZNA 3OTTA 3B7FA 2Z2OA 4BUJC 3ZWLB 4LG8A 3SN6B 3NVQA 3IIYA 4JD2C 3E0CA 3AL9A 3F3PA 3PSLA 3VA6A 3K26A 3JZGA 1XHMA 3JPXA 3EI1A 4O9DA 4A2MA 3A0FA 3SVWD 5AFU3 3VH0A 3N0EA 3OKYA 2XL3A 4CI3A 2IAAA 3SLED 5TF2A 3RFGA 4G56B 3MXXA 4L9OA 3EI1B 3AH8B 4J84A 2Z2PA 3OKTA 4PBZA 5CYKA 4TZ4A 2H9MA 1GG2B 3N0DA 5FQDA 3SHFA 5C2WB 4CZXA 1OLZA 3UKRC 4A09B 3JZHA 1MG3A 4FA5D 1RI6A 5GSAA 4A0BA 2BCJB 2I3SA 3KRWB 5EALA 4GGAA 4PSXB 3RSEC 1PGUA 3PSCB 2GNQA 5IJ7E 3F3FA 5FLXg 4JSXC 5K1CC 4J8BA 5SXMA 4BH6A 3SFZA 4NSXA 1SHYB 3I2NA 5KDOB 4J8GA 2XL2A 2B5MA 2AGYA 3I7HA 2CE8A 4U1EI 4OZUA 2IWKA 2AGXA 2OVQB 2P9PC 4X63B 1JJUB 5HE3B 3J80g 2HKRA 1NEXB 2AH1A 3RMZD 2P9SC 2G99A 3UVKA 4E54A 3NVXA 2B5NA 2UZYB 2I0RA 3I89A 2YNNA 4H5JA 4K3JB 4GQ1A 2XU7A 5EMMB 2GC4A 3UVNA 5H1MA 4L1QD 4JSVC 2MTAH 3OKWA 1GP2B 2H68A 3OL2A 4J87A 3EWEA 1B9YA 3CIKB 5K19A 3IJ0A 2H13A 4ESGA 2EBSA 3UVOA 1ERJA 4GQ2P 3I7LA 4ZOZA 2I0SA 3RN0D 3ORVD 5CYKB 2YBAA 4O3UB 1YFQA 1GOTB 2B4EA 3NVNA 3V7DB 3I8CA 3C75H 4HDJA 3BG1A 4A09A 4PSWB 4LGNA 4O1QD 5FKQA 3PXTD 5C2VB 1N6DA 2H9LA 2I0TA 4ZOXA 4A08A 3AFCA 2P9NC 5EMJB 4A11A 3AL8A 3EI4A 3JRPA 3SMRA 1B9XA 4U7AA 4L3HD 5CXBA 1L0QA 5H14A 4UI9R 4A08B 2CNXA 3EMHA 4X60B 4Y7RA 2OIZA 4CI2A 2AGWA 4E5ZA 4PXWA 2P9LC 5HE2B 5THAA 2AH0A 3VGZA 3IKOA 4A0AB 5EM2A 2AQ5A 4PBYA 4E5ZB 4FHLA 5I5MA 1S4UX 4JSNC 2XYIA 5EAMA 3UKUC 3UR4A 4GGCA 3MZLA 5FKTA 3C99A 2IUPA 1VYHC 1JMZB 2YMUA 4FA1D 5IT9g 3IJCA 2CE9A 5IGOA 4GM3A 4Y5RD 4FAND 4FA4D 4CZYA 3RFHA 3SWSD 1MDAH 3EG6A 2H9NA 4J73A 4ERYA 2PM6B 4LG9A 4KFMB 3FM0A 2H14A 3RLMD 2H3XA 2Z2NA 5GMKn 3GREA 3UVMA 4ZN4A 2OK4A 4CI8A 3SJLD 4L3GD 3BWSA 4J81A 1PEVA 4Z8LA 3SXTD 1QNIA 3U4YA 4IA9A 4MK0B 1JOFA 2IUQA 2J56H 5HE1B 2P9KC 3V5WB 1OMWB 3J81g 2BBKH 4A0BB 1XIPA 5GXIA 3V9FA 3DSMA 4YVDA 4JT5C 3F3GA 3SCYA 4A11B 2H6KA 2J55H 3MZKA 2O9KA 4IMMA 5A2Qg 3I7KA 4GGDA 4XYIA 4BL0A 4N14A 4D6VA 1N6FA 5JWZA 2CN2A 1Q47A 4R7AB 5HYNB
chains in the Genus database with same CATH superfamily
2B5LA 2EIEA 1XKSA 2VDQA 2Q7QA 4J77A 4FAVD 4A0AA 4O3TB 4I79A 1H2WA 4GM8A 5FA5B 2HYEA 2VDRA 4CI1A 3ZE2A 3DXMC 4CY3A 4CY2A 4GQBB 5H17A 5M5SA 1JMXB 1P22A 4GZ8A 3C5MA 4DNUA 3JROA 3RRMC 3O4HA 3IJ1A 2VZ3A 2YNOA 2HU8A 4AOWA 2H6QA 5HE0B 2CO0C 4CY5A 3I7OA 3DWLC 1GXRA 4J79A 3OKYB 5EMLB 1TYQC 3MMYA 1K32A 1JV2A 5TEEA 2CN3A 3OW8A 3IIWA 4QRJA 3V4PA 3I7NA 4H5IA 5M5VA 1R5MA 4QL1A 4AEZA 2PM9B 5C9ZB 2YB8B 1L5GA 5FKRA 3L4OD 2TRCB 4JT6C 4JXMA 3EI2B 1TBGA 5AMSA 4K3ID 2QC5A 4WK0A 3ZDXA 4RE5A 5EMKB 5IGQA 2AGZA 1GOFA 2IWFA 3PVUB 2HESX 5I5JA 4DNVA 4BCDA 2IURA 3L4MD 3T3MA 4J0WA 4O02A 4QQEA 1UOPA 5EARA 5TEFA 1A0RB 4JSPC 3MUNA 3FCUA 3CFSB 4J0XA 3CFVA 2H6NA 5FKSA 2PBIB 3AL8B 3EI3B 4CZVA 3EU7A 3HFQA 2HXCA 3MKQA 5C92A 3SBPA 4NC4A 2P9UC 3W15A 2GC7A 2HU5A 2P9IC 3SBRA 3EI3A 2AGLA 3FGBA 4J78A 4ZOYA 3GFCA 4J86A 4NBMA 4L1MA 4O45A 2OJYA 3I7PA 4PC0A 4PNKB 5CXCB 1SQJA 4BP8A 3BG0A 5EM2B 2VZ1A 3MKSB 4E54B 4EWRA 2UZXB 3O4JA 1E5TA 3ODTA 1QFSA 4NAAA 5GXHA 1N6EA 1C9LA 3ULEC 3PXSD 3DXKC 4GM9A 5CXCA 3K6SA 4AN0A 5M5UA 2YNPA 5AJAA 4GMBA 5HQGA 4FA9D 3JB9L 2G9AA 2BKLA 2XZGA 3JAMg 3DM0A 5FXYA 1H2XA 3OL2B 4ES0A 3PVWB 1U4CA 1M1XA 5M5TA 5IC7A 3I8EA 5B4WA 1SQ9A 4MMYA 2VDKA 2J57G 2HJBA 4CY1A 4D0KA 2QZPA 2HU7A 4XEIC 3RN1D 1QFMA 3FRXA 4XYHA 1VZ2A 5EAPA 4QAMA 4FB1D 4A7JA 4ERZA 1VE6A 3EQ7A 2H47A 2PM9A 2W18A 2HKMA 2OVPB 2HJ4A 3K27A 3EI2A 2I3TA 2CO0A 1H2ZA 1PI6A 3NIGA 4CC9A 1MG2A 5I5IA 3UVLA 5IJ8E 3PXWD 3V4VA 4A2LA 1NR0A 4ERQA 3C9CA 5C86A 1E8MA 3EI4B 3SBQA 3PE7A 1FWXA 2PM7B 2IUVA 1GOHA 2JKXA 5CXBB 2QXVA 4QT8A 3GC3B 1U2VC 5TDHB 2VDLA 4J82A 3VI4A 1YR2A 4ZOVA 2OK6A 2H9PA 3KRXB 2OVRB 1PBYB 4X3EA 4X61B 2VC2A 1K8KC 4OWRA 4FWWA 3P4FA 3JZNA 3OTTA 3B7FA 2Z2OA 4BUJC 3ZWLB 4LG8A 3SN6B 3NVQA 3IIYA 4JD2C 3E0CA 3AL9A 3F3PA 3PSLA 3NIFA 3VA6A 3K26A 1JTDB 4G55A 3DDUA 3JZGA 3GD1I 3IVMA 1XHMA 3JPXA 3EI1A 4O9DA 4A2MA 3A0FA 3SVWD 5AFU3 1C9IA 3VH0A 3N0EA 3OKYA 2XL3A 3ZE1A 4CI3A 3IUNA 2IAAA 3SLED 5TF2A 3RFGA 4G56B 3MXXA 4L9OA 3EI1B 3AH8B 4J84A 4BCCA 2Z2PA 3OKTA 4AMZA 4PBZA 4G1MA 4TZ4A 5CYKA 2H9MA 2WQ8A 1H2YA 1GG2B 3N0DA 4UM8A 5FQDA 3SHFA 5C2WB 1I2MB 4CZXA 1O6FA 1OLZA 3IUMA 3UKRC 4A09B 3JZHA 5FFGA 3K71A 3FCSA 1MG3A 3K72A 4FA5D 1K3IA 4JHPC 1RI6A 3T3PA 5GSAA 4A0BA 1A12A 3IURA 2BCJB 2I3SA 2VDPA 3KRWB 5EALA 3ZDYA 4GGAA 3IJEA 4BP9A 4PSXB 3RSEC 1PGUA 3PSCB 2GNQA 5IJ7E 1VZ3A 4MMXA 3F3FA 5FLXg 4JSXC 5K1CC 4J8BA 5M61A 5SXMA 4BH6A 4BCBA 3SFZA 3IUQA 4NSXA 1SHYB 3I2NA 5KDOB 4J8GA 2XL2A 2B5MA 2AGYA 2EIBA 2CE8A 3I7HA 4U1EI 4OZUA 2IWKA 2AGXA 2OVQB 2P9PC 5FFOA 4X63B 1JJUB 5HE3B 3J80g 4UM9A 2HKRA 3VI3A 1NEXB 2AH1A 3NIDA 3RMZD 2P9SC 2G99A 4WK4A 3UVKA 4E54A 3NVXA 2B5NA 2UZYB 5M5RA 2I0RA 4Z7OA 3I89A 3KCIA 2YNNA 4H5JA 1T2XA 4K3JB 4GQ1A 2XU7A 5EMMB 1BPOA 1TYEA 2GC4A 3UVNA 5H1MA 4L1QD 4JSVC 2MTAH 4RE6A 3OKWA 1GP2B 2H68A 3OL2A 4J87A 3EWEA 1B9YA 3CIKB 4WJKA 5K19A 3IJ0A 1VE7A 3OF7A 2H13A 5E6UA 2EBSA 4ESGA 3UVOA 1ERJA 4GQ2P 3I7LA 4ZOZA 2I0SA 3RN0D 2QR5A 3ORVD 5CYKB 3QI0A 2YBAA 4O3UB 1YFQA 1GOTB 2B4EA 3NVNA 3MVDK 3V7DB 3I8CA 3C75H 4HDJA 1UOOA 2VDNA 3BG1A 4A09A 4PSWB 4IRZA 4LGNA 4DNWA 4O1QD 5FKQA 5E6SA 3PXTD 5C2VB 1N6DA 2H9LA 2I0TA 4ZOXA 4A08A 3AFCA 2P9NC 5EMJB 4A11A 3AL8A 3EI4A 3JRPA 3EQ8A 3SMRA 1B9XA 2XE4A 4U7AA 4L3HD 3EQ9A 5CXBA 1L0QA 5H14A 1UOQA 4UI9R 4A08B 2CNXA 3EMHA 4X60B 4Y7RA 2OIZA 4CI2A 2AGWA 3ZDZA 4E5ZA 4PXWA 2P9LC 3IULA 5HE2B 5THAA 4Z7NA 2AH0A 3VGZA 3IKOA 4A0AB 4D9SA 4MMZA 5EM2A 1GOGA 2AQ5A 1U8CA 4PBYA 2EIDA 4E5ZB 4FHLA 4WK2A 5I5MA 1S4UX 4JSNC 2XYIA 5EAMA 3UKUC 3UR4A 4GGCA 3MZLA 5FKTA 3C99A 2IUPA 1VYHC 1JMZB 2YMUA 4Z7QA 4FA1D 5IT9g 3IJCA 2CE9A 4O2WA 5IGOA 2EICA 4GM3A 4NENA 4Y5RD 4FAND 4FA4D 4CZYA 3RFHA 3SWSD 2VDOA 1MDAH 3EG6A 2H9NA 4J73A 4ERYA 2PM6B 4JHNA 4LG9A 4KFMB 5E6RA 3FM0A 2H14A 3RLMD 3IUJA 1O6GA 5HDBA 2H3XA 2Z2NA 3MUOA 5GMKn 3GREA 3UVMA 4ZN4A 2OK4A 4CI8A 3SJLD 4L3GD 1UTCA 3BWSA 4J81A 4AN1A 1PEVA 3ZE0A 4Z8LA 4AX4A 3SXTD 4AMYA 1QNIA 3U4YA 4IA9A 4MK0B 1JOFA 2IUQA 2J56H 5HE1B 2P9KC 3V5WB 1OMWB 3J81g 2BBKH 4A0BB 2VDMA 1XIPA 4G1EA 3V9FA 5GXIA 3DSMA 3O4IA 4JT5C 4YVDA 3F3GA 3QHYB 3SCYA 3O4GA 4A11B 2H6KA 2J55H 3MZKA 2O9KA 4IMMA 5A2Qg 3I7KA 4GGDA 4XYIA 4BL0A 4N14A 4D6VA 1N6FA 2XDWA 1E8NA 5JWZA 2CN2A 1Q47A 4R7AB 5HYNB
chains in the Genus database with same CATH topology
2B5LA 1XKSA 2Q7QA 4J77A 4FAVD 4A0AA 4O3TB 4I79A 2HYEA 4GM8A 5FA5B 4CI1A 3DXMC 4CY3A 4CY2A 4GQBB 5H17A 1JMXB 1P22A 4GZ8A 3C5MA 3JROA 3RRMC 3IJ1A 2YNOA 4AOWA 2H6QA 5HE0B 2CO0C 4CY5A 3I7OA 3DWLC 1GXRA 4J79A 3OKYB 5EMLB 1TYQC 3MMYA 1K32A 5TEEA 2CN3A 3OW8A 3IIWA 4QRJA 3I7NA 4H5IA 1R5MA 4QL1A 4AEZA 2PM9B 5C9ZB 2YB8B 5FKRA 3L4OD 2TRCB 4JT6C 4JXMA 3EI2B 1TBGA 5AMSA 4K3ID 2QC5A 5EMKB 5IGQA 2AGZA 2IWFA 3PVUB 2HESX 5I5JA 2IURA 3L4MD 4J0WA 4QQEA 5EARA 5TEFA 1A0RB 4JSPC 3CFSB 4J0XA 3CFVA 2H6NA 5FKSA 2PBIB 3AL8B 3EI3B 4CZVA 3EU7A 3HFQA 2HXCA 3MKQA 3SBPA 2P9UC 3W15A 2GC7A 2P9IC 3SBRA 3EI3A 2AGLA 3FGBA 4J78A 4ZOYA 3GFCA 4J86A 4O45A 2OJYA 3I7PA 4PC0A 4PNKB 5CXCB 1SQJA 3BG0A 5EM2B 3MKSB 4E54B 4EWRA 2UZXB 3ODTA 5GXHA 1N6EA 3ULEC 3PXSD 3DXKC 4GM9A 5CXCA 2YNPA 5AJAA 4GMBA 5HQGA 4FA9D 3JB9L 2G9AA 3JAMg 3DM0A 5FXYA 3OL2B 4ES0A 3PVWB 1U4CA 5IC7A 3I8EA 5B4WA 1SQ9A 2J57G 2HJBA 4CY1A 4D0KA 4XEIC 3RN1D 3FRXA 4XYHA 5EAPA 4FB1D 4A7JA 4ERZA 2H47A 2PM9A 2W18A 2HKMA 2OVPB 2HJ4A 3K27A 3EI2A 2I3TA 2CO0A 1PI6A 4CC9A 1MG2A 5I5IA 3UVLA 5IJ8E 3PXWD 4A2LA 1NR0A 4ERQA 3C9CA 3EI4B 3SBQA 3PE7A 1FWXA 2PM7B 2IUVA 5CXBB 2QXVA 4QT8A 1U2VC 5TDHB 4J82A 4ZOVA 2OK6A 2H9PA 3KRXB 2OVRB 1PBYB 4X3EA 4X61B 1K8KC 4OWRA 4FWWA 3P4FA 3JZNA 3OTTA 3B7FA 2Z2OA 4BUJC 3ZWLB 4LG8A 3SN6B 3NVQA 3IIYA 4JD2C 3E0CA 3AL9A 3F3PA 3PSLA 3VA6A 3K26A 3JZGA 1XHMA 3JPXA 3EI1A 4O9DA 4A2MA 3A0FA 3SVWD 5AFU3 3VH0A 3N0EA 3OKYA 2XL3A 4CI3A 2IAAA 3SLED 5TF2A 3RFGA 4G56B 3MXXA 4L9OA 3EI1B 3AH8B 4J84A 2Z2PA 3OKTA 4PBZA 5CYKA 4TZ4A 2H9MA 1GG2B 3N0DA 5FQDA 3SHFA 5C2WB 4CZXA 1OLZA 3UKRC 4A09B 3JZHA 1MG3A 4FA5D 1RI6A 5GSAA 4A0BA 2BCJB 2I3SA 3KRWB 5EALA 4GGAA 4PSXB 3RSEC 1PGUA 3PSCB 2GNQA 5IJ7E 3F3FA 5FLXg 4JSXC 5K1CC 4J8BA 5SXMA 4BH6A 3SFZA 4NSXA 1SHYB 3I2NA 5KDOB 4J8GA 2XL2A 2B5MA 2AGYA 3I7HA 2CE8A 4U1EI 4OZUA 2IWKA 2AGXA 2OVQB 2P9PC 4X63B 1JJUB 5HE3B 3J80g 2HKRA 1NEXB 2AH1A 3RMZD 2P9SC 2G99A 3UVKA 4E54A 3NVXA 2B5NA 2UZYB 2I0RA 3I89A 2YNNA 4H5JA 4K3JB 4GQ1A 2XU7A 5EMMB 2GC4A 3UVNA 5H1MA 4L1QD 4JSVC 2MTAH 3OKWA 1GP2B 2H68A 3OL2A 4J87A 3EWEA 1B9YA 3CIKB 5K19A 3IJ0A 2H13A 4ESGA 2EBSA 3UVOA 1ERJA 4GQ2P 3I7LA 4ZOZA 2I0SA 3RN0D 3ORVD 5CYKB 2YBAA 4O3UB 1YFQA 1GOTB 2B4EA 3NVNA 3V7DB 3I8CA 3C75H 4HDJA 3BG1A 4A09A 4PSWB 4LGNA 4O1QD 5FKQA 3PXTD 5C2VB 1N6DA 2H9LA 2I0TA 4ZOXA 4A08A 3AFCA 2P9NC 5EMJB 4A11A 3AL8A 3EI4A 3JRPA 3SMRA 1B9XA 4U7AA 4L3HD 5CXBA 1L0QA 5H14A 4UI9R 4A08B 2CNXA 3EMHA 4X60B 4Y7RA 2OIZA 4CI2A 2AGWA 4E5ZA 4PXWA 2P9LC 5HE2B 5THAA 2AH0A 3VGZA 3IKOA 4A0AB 5EM2A 2AQ5A 4PBYA 4E5ZB 4FHLA 5I5MA 1S4UX 4JSNC 2XYIA 5EAMA 3UKUC 3UR4A 4GGCA 3MZLA 5FKTA 3C99A 2IUPA 1VYHC 1JMZB 2YMUA 4FA1D 5IT9g 3IJCA 2CE9A 5IGOA 4GM3A 4Y5RD 4FAND 4FA4D 4CZYA 3RFHA 3SWSD 1MDAH 3EG6A 2H9NA 4J73A 4ERYA 2PM6B 4LG9A 4KFMB 3FM0A 2H14A 3RLMD 2H3XA 2Z2NA 5GMKn 3GREA 3UVMA 4ZN4A 2OK4A 4CI8A 3SJLD 4L3GD 3BWSA 4J81A 1PEVA 4Z8LA 3SXTD 1QNIA 3U4YA 4IA9A 4MK0B 1JOFA 2IUQA 2J56H 5HE1B 2P9KC 3V5WB 1OMWB 3J81g 2BBKH 4A0BB 1XIPA 5GXIA 3V9FA 3DSMA 4YVDA 4JT5C 3F3GA 3SCYA 4A11B 2H6KA 2J55H 3MZKA 2O9KA 4IMMA 5A2Qg 3I7KA 4GGDA 4XYIA 4BL0A 4N14A 4D6VA 1N6FA 5JWZA 2CN2A 1Q47A 4R7AB 5HYNB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B5L A;  1XKS A;  2Q7Q A;  4J77 A;  4FAV D;  4A0A A;  4O3T B;  4I79 A;  2HYE A;  4GM8 A;  5FA5 B;  4CI1 A;  3DXM C;  4CY3 A;  4CY2 A;  4GQB B;  5H17 A;  1JMX B;  1P22 A;  4GZ8 A;  3C5M A;  3JRO A;  3RRM C;  3IJ1 A;  2YNO A;  4AOW A;  2H6Q A;  5HE0 B;  2CO0 C;  4CY5 A;  3I7O A;  3DWL C;  1GXR A;  4J79 A;  3OKY B;  5EML B;  1TYQ C;  3MMY A;  1K32 A;  5TEE A;  2CN3 A;  3OW8 A;  3IIW A;  4QRJ A;  3I7N A;  4H5I A;  1R5M A;  4QL1 A;  4AEZ A;  2PM9 B;  5C9Z B;  2YB8 B;  5FKR A;  3L4O D;  2TRC B;  4JT6 C;  4JXM A;  3EI2 B;  1TBG A;  5AMS A;  4K3I D;  2QC5 A;  5EMK B;  5IGQ A;  2AGZ A;  2IWF A;  3PVU B;  2HES X;  5I5J A;  2IUR A;  3L4M D;  4J0W A;  4QQE A;  5EAR A;  5TEF A;  1A0R B;  4JSP C;  3CFS B;  4J0X A;  3CFV A;  2H6N A;  5FKS A;  2PBI B;  3AL8 B;  3EI3 B;  4CZV A;  3EU7 A;  3HFQ A;  2HXC A;  3MKQ A;  3SBP A;  2P9U C;  3W15 A;  2GC7 A;  2P9I C;  3SBR A;  3EI3 A;  2AGL A;  3FGB A;  4J78 A;  4ZOY A;  3GFC A;  4J86 A;  4O45 A;  2OJY A;  3I7P A;  4PC0 A;  4PNK B;  5CXC B;  1SQJ A;  3BG0 A;  5EM2 B;  3MKS B;  4E54 B;  4EWR A;  2UZX B;  3ODT A;  5GXH A;  1N6E A;  3ULE C;  3PXS D;  3DXK C;  4GM9 A;  5CXC A;  2YNP A;  5AJA A;  4GMB A;  5HQG A;  4FA9 D;  3JB9 L;  2G9A A;  3JAM g;  3DM0 A;  5FXY A;  3OL2 B;  4ES0 A;  3PVW B;  1U4C A;  5IC7 A;  3I8E A;  5B4W A;  1SQ9 A;  2J57 G;  2HJB A;  4CY1 A;  4D0K A;  4XEI C;  3RN1 D;  3FRX A;  4XYH A;  5EAP A;  4FB1 D;  4A7J A;  4ERZ A;  2H47 A;  2PM9 A;  2W18 A;  2HKM A;  2OVP B;  2HJ4 A;  3K27 A;  3EI2 A;  2I3T A;  2CO0 A;  1PI6 A;  4CC9 A;  1MG2 A;  5I5I A;  3UVL A;  5IJ8 E;  3PXW D;  4A2L A;  1NR0 A;  4ERQ A;  3C9C A;  3EI4 B;  3SBQ A;  3PE7 A;  1FWX A;  2PM7 B;  2IUV A;  5CXB B;  2QXV A;  4QT8 A;  1U2V C;  5TDH B;  4J82 A;  4ZOV A;  2OK6 A;  2H9P A;  3KRX B;  2OVR B;  1PBY B;  4X3E A;  4X61 B;  1K8K C;  4OWR A;  4FWW A;  3P4F A;  3JZN A;  3OTT A;  3B7F A;  2Z2O A;  4BUJ C;  3ZWL B;  4LG8 A;  3SN6 B;  3NVQ A;  3IIY A;  4JD2 C;  3E0C A;  3AL9 A;  3F3P A;  3PSL A;  3VA6 A;  3K26 A;  3JZG A;  1XHM A;  3JPX A;  3EI1 A;  4O9D A;  4A2M A;  3A0F A;  3SVW D;  5AFU 3;  3VH0 A;  3N0E A;  3OKY A;  2XL3 A;  4CI3 A;  2IAA A;  3SLE D;  5TF2 A;  3RFG A;  4G56 B;  3MXX A;  4L9O A;  3EI1 B;  3AH8 B;  4J84 A;  2Z2P A;  3OKT A;  4PBZ A;  5CYK A;  4TZ4 A;  2H9M A;  1GG2 B;  3N0D A;  5FQD A;  3SHF A;  5C2W B;  4CZX A;  1OLZ A;  3UKR C;  4A09 B;  3JZH A;  1MG3 A;  4FA5 D;  1RI6 A;  5GSA A;  4A0B A;  2BCJ B;  2I3S A;  3KRW B;  5EAL A;  4GGA A;  4PSX B;  3RSE C;  1PGU A;  3PSC B;  2GNQ A;  5IJ7 E;  3F3F A;  5FLX g;  4JSX C;  5K1C C;  4J8B A;  5SXM A;  4BH6 A;  3SFZ A;  4NSX A;  1SHY B;  3I2N A;  5KDO B;  4J8G A;  2XL2 A;  2B5M A;  2AGY A;  3I7H A;  2CE8 A;  4U1E I;  4OZU A;  2IWK A;  2AGX A;  2OVQ B;  2P9P C;  4X63 B;  1JJU B;  5HE3 B;  3J80 g;  2HKR A;  1NEX B;  2AH1 A;  3RMZ D;  2P9S C;  2G99 A;  3UVK A;  4E54 A;  3NVX A;  2B5N A;  2UZY B;  2I0R A;  3I89 A;  2YNN A;  4H5J A;  4K3J B;  4GQ1 A;  2XU7 A;  5EMM B;  2GC4 A;  3UVN A;  5H1M A;  4L1Q D;  4JSV C;  2MTA H;  3OKW A;  1GP2 B;  2H68 A;  3OL2 A;  4J87 A;  3EWE A;  1B9Y A;  3CIK B;  5K19 A;  3IJ0 A;  2H13 A;  4ESG A;  2EBS A;  3UVO A;  1ERJ A;  4GQ2 P;  3I7L A;  4ZOZ A;  2I0S A;  3RN0 D;  3ORV D;  5CYK B;  2YBA A;  4O3U B;  1YFQ A;  1GOT B;  2B4E A;  3NVN A;  3V7D B;  3I8C A;  3C75 H;  4HDJ A;  3BG1 A;  4A09 A;  4PSW B;  4LGN A;  4O1Q D;  5FKQ A;  3PXT D;  5C2V B;  1N6D A;  2H9L A;  2I0T A;  4ZOX A;  4A08 A;  3AFC A;  2P9N C;  5EMJ B;  4A11 A;  3AL8 A;  3EI4 A;  3JRP A;  3SMR A;  1B9X A;  4U7A A;  4L3H D;  5CXB A;  1L0Q A;  5H14 A;  4UI9 R;  4A08 B;  2CNX A;  3EMH A;  4X60 B;  4Y7R A;  2OIZ A;  4CI2 A;  2AGW A;  4E5Z A;  4PXW A;  2P9L C;  5HE2 B;  5THA A;  2AH0 A;  3VGZ A;  3IKO A;  4A0A B;  5EM2 A;  2AQ5 A;  4PBY A;  4E5Z B;  4FHL A;  5I5M A;  1S4U X;  4JSN C;  2XYI A;  5EAM A;  3UKU C;  3UR4 A;  4GGC A;  3MZL A;  5FKT A;  3C99 A;  2IUP A;  1VYH C;  1JMZ B;  2YMU A;  4FA1 D;  5IT9 g;  3IJC A;  2CE9 A;  5IGO A;  4GM3 A;  4Y5R D;  4FAN D;  4FA4 D;  4CZY A;  3RFH A;  3SWS D;  1MDA H;  3EG6 A;  2H9N A;  4J73 A;  4ERY A;  2PM6 B;  4LG9 A;  4KFM B;  3FM0 A;  2H14 A;  3RLM D;  2H3X A;  2Z2N A;  5GMK n;  3GRE A;  3UVM A;  4ZN4 A;  2OK4 A;  4CI8 A;  3SJL D;  4L3G D;  3BWS A;  4J81 A;  1PEV A;  4Z8L A;  3SXT D;  1QNI A;  3U4Y A;  4IA9 A;  4MK0 B;  1JOF A;  2IUQ A;  2J56 H;  5HE1 B;  2P9K C;  3V5W B;  1OMW B;  3J81 g;  2BBK H;  4A0B B;  1XIP A;  5GXI A;  3V9F A;  3DSM A;  4YVD A;  4JT5 C;  3F3G A;  3SCY A;  4A11 B;  2H6K A;  2J55 H;  3MZK A;  2O9K A;  4IMM A;  5A2Q g;  3I7K A;  4GGD A;  4XYI A;  4BL0 A;  4N14 A;  4D6V A;  1N6F A;  5JWZ A;  2CN2 A;  1Q47 A;  4R7A B;  5HYN B; 
#chains in the Genus database with same CATH topology
 2B5L A;  2EIE A;  1XKS A;  2VDQ A;  2Q7Q A;  4J77 A;  4FAV D;  4A0A A;  4O3T B;  4I79 A;  1H2W A;  4GM8 A;  5FA5 B;  2HYE A;  2VDR A;  4CI1 A;  3ZE2 A;  3DXM C;  4CY3 A;  4CY2 A;  4GQB B;  5H17 A;  5M5S A;  1JMX B;  1P22 A;  4GZ8 A;  3C5M A;  4DNU A;  3JRO A;  3RRM C;  3O4H A;  3IJ1 A;  2VZ3 A;  2YNO A;  2HU8 A;  4AOW A;  2H6Q A;  5HE0 B;  2CO0 C;  4CY5 A;  3I7O A;  3DWL C;  1GXR A;  4J79 A;  3OKY B;  5EML B;  1TYQ C;  3MMY A;  1K32 A;  1JV2 A;  5TEE A;  2CN3 A;  3OW8 A;  3IIW A;  4QRJ A;  3V4P A;  3I7N A;  4H5I A;  5M5V A;  1R5M A;  4QL1 A;  4AEZ A;  2PM9 B;  5C9Z B;  2YB8 B;  1L5G A;  5FKR A;  3L4O D;  2TRC B;  4JT6 C;  4JXM A;  3EI2 B;  1TBG A;  5AMS A;  4K3I D;  2QC5 A;  4WK0 A;  3ZDX A;  4RE5 A;  5EMK B;  5IGQ A;  2AGZ A;  1GOF A;  2IWF A;  3PVU B;  2HES X;  5I5J A;  4DNV A;  4BCD A;  2IUR A;  3L4M D;  3T3M A;  4J0W A;  4O02 A;  4QQE A;  1UOP A;  5EAR A;  5TEF A;  1A0R B;  4JSP C;  3MUN A;  3FCU A;  3CFS B;  4J0X A;  3CFV A;  2H6N A;  5FKS A;  2PBI B;  3AL8 B;  3EI3 B;  4CZV A;  3EU7 A;  3HFQ A;  2HXC A;  3MKQ A;  5C92 A;  3SBP A;  4NC4 A;  2P9U C;  3W15 A;  2GC7 A;  2HU5 A;  2P9I C;  3SBR A;  3EI3 A;  2AGL A;  3FGB A;  4J78 A;  4ZOY A;  3GFC A;  4J86 A;  4NBM A;  4L1M A;  4O45 A;  2OJY A;  3I7P A;  4PC0 A;  4PNK B;  5CXC B;  1SQJ A;  4BP8 A;  3BG0 A;  5EM2 B;  2VZ1 A;  3MKS B;  4E54 B;  4EWR A;  2UZX B;  3O4J A;  1E5T A;  3ODT A;  1QFS A;  4NAA A;  5GXH A;  1N6E A;  1C9L A;  3ULE C;  3PXS D;  3DXK C;  4GM9 A;  5CXC A;  3K6S A;  4AN0 A;  5M5U A;  2YNP A;  5AJA A;  4GMB A;  5HQG A;  4FA9 D;  3JB9 L;  2G9A A;  2BKL A;  2XZG A;  3JAM g;  3DM0 A;  5FXY A;  1H2X A;  3OL2 B;  4ES0 A;  3PVW B;  1U4C A;  1M1X A;  5M5T A;  5IC7 A;  3I8E A;  5B4W A;  1SQ9 A;  4MMY A;  2VDK A;  2J57 G;  2HJB A;  4CY1 A;  4D0K A;  2QZP A;  2HU7 A;  4XEI C;  3RN1 D;  1QFM A;  3FRX A;  4XYH A;  1VZ2 A;  5EAP A;  4QAM A;  4FB1 D;  4A7J A;  4ERZ A;  1VE6 A;  3EQ7 A;  2H47 A;  2PM9 A;  2W18 A;  2HKM A;  2OVP B;  2HJ4 A;  3K27 A;  3EI2 A;  2I3T A;  2CO0 A;  1H2Z A;  1PI6 A;  3NIG A;  4CC9 A;  1MG2 A;  5I5I A;  3UVL A;  5IJ8 E;  3PXW D;  3V4V A;  4A2L A;  1NR0 A;  4ERQ A;  3C9C A;  5C86 A;  1E8M A;  3EI4 B;  3SBQ A;  3PE7 A;  1FWX A;  2PM7 B;  2IUV A;  1GOH A;  2JKX A;  5CXB B;  2QXV A;  4QT8 A;  3GC3 B;  1U2V C;  5TDH B;  2VDL A;  4J82 A;  3VI4 A;  1YR2 A;  4ZOV A;  2OK6 A;  2H9P A;  3KRX B;  2OVR B;  1PBY B;  4X3E A;  4X61 B;  2VC2 A;  1K8K C;  4OWR A;  4FWW A;  3P4F A;  3JZN A;  3OTT A;  3B7F A;  2Z2O A;  4BUJ C;  3ZWL B;  4LG8 A;  3SN6 B;  3NVQ A;  3IIY A;  4JD2 C;  3E0C A;  3AL9 A;  3F3P A;  3PSL A;  3NIF A;  3VA6 A;  3K26 A;  1JTD B;  4G55 A;  3DDU A;  3JZG A;  3GD1 I;  3IVM A;  1XHM A;  3JPX A;  3EI1 A;  4O9D A;  4A2M A;  3A0F A;  3SVW D;  5AFU 3;  1C9I A;  3VH0 A;  3N0E A;  3OKY A;  2XL3 A;  3ZE1 A;  4CI3 A;  3IUN A;  2IAA A;  3SLE D;  5TF2 A;  3RFG A;  4G56 B;  3MXX A;  4L9O A;  3EI1 B;  3AH8 B;  4J84 A;  4BCC A;  2Z2P A;  3OKT A;  4AMZ A;  4PBZ A;  4G1M A;  4TZ4 A;  5CYK A;  2H9M A;  2WQ8 A;  1H2Y A;  1GG2 B;  3N0D A;  4UM8 A;  5FQD A;  3SHF A;  5C2W B;  1I2M B;  4CZX A;  1O6F A;  1OLZ A;  3IUM A;  3UKR C;  4A09 B;  3JZH A;  5FFG A;  3K71 A;  3FCS A;  1MG3 A;  3K72 A;  4FA5 D;  1K3I A;  4JHP C;  1RI6 A;  3T3P A;  5GSA A;  4A0B A;  1A12 A;  3IUR A;  2BCJ B;  2I3S A;  2VDP A;  3KRW B;  5EAL A;  3ZDY A;  4GGA A;  3IJE A;  4BP9 A;  4PSX B;  3RSE C;  1PGU A;  3PSC B;  2GNQ A;  5IJ7 E;  1VZ3 A;  4MMX A;  3F3F A;  5FLX g;  4JSX C;  5K1C C;  4J8B A;  5M61 A;  5SXM A;  4BH6 A;  4BCB A;  3SFZ A;  3IUQ A;  4NSX A;  1SHY B;  3I2N A;  5KDO B;  4J8G A;  2XL2 A;  2B5M A;  2AGY A;  2EIB A;  2CE8 A;  3I7H A;  4U1E I;  4OZU A;  2IWK A;  2AGX A;  2OVQ B;  2P9P C;  5FFO A;  4X63 B;  1JJU B;  5HE3 B;  3J80 g;  4UM9 A;  2HKR A;  3VI3 A;  1NEX B;  2AH1 A;  3NID A;  3RMZ D;  2P9S C;  2G99 A;  4WK4 A;  3UVK A;  4E54 A;  3NVX A;  2B5N A;  2UZY B;  5M5R A;  2I0R A;  4Z7O A;  3I89 A;  3KCI A;  2YNN A;  4H5J A;  1T2X A;  4K3J B;  4GQ1 A;  2XU7 A;  5EMM B;  1BPO A;  1TYE A;  2GC4 A;  3UVN A;  5H1M A;  4L1Q D;  4JSV C;  2MTA H;  4RE6 A;  3OKW A;  1GP2 B;  2H68 A;  3OL2 A;  4J87 A;  3EWE A;  1B9Y A;  3CIK B;  4WJK A;  5K19 A;  3IJ0 A;  1VE7 A;  3OF7 A;  2H13 A;  5E6U A;  2EBS A;  4ESG A;  3UVO A;  1ERJ A;  4GQ2 P;  3I7L A;  4ZOZ A;  2I0S A;  3RN0 D;  2QR5 A;  3ORV D;  5CYK B;  3QI0 A;  2YBA A;  4O3U B;  1YFQ A;  1GOT B;  2B4E A;  3NVN A;  3MVD K;  3V7D B;  3I8C A;  3C75 H;  4HDJ A;  1UOO A;  2VDN A;  3BG1 A;  4A09 A;  4PSW B;  4IRZ A;  4LGN A;  4DNW A;  4O1Q D;  5FKQ A;  5E6S A;  3PXT D;  5C2V B;  1N6D A;  2H9L A;  2I0T A;  4ZOX A;  4A08 A;  3AFC A;  2P9N C;  5EMJ B;  4A11 A;  3AL8 A;  3EI4 A;  3JRP A;  3EQ8 A;  3SMR A;  1B9X A;  2XE4 A;  4U7A A;  4L3H D;  3EQ9 A;  5CXB A;  1L0Q A;  5H14 A;  1UOQ A;  4UI9 R;  4A08 B;  2CNX A;  3EMH A;  4X60 B;  4Y7R A;  2OIZ A;  4CI2 A;  2AGW A;  3ZDZ A;  4E5Z A;  4PXW A;  2P9L C;  3IUL A;  5HE2 B;  5THA A;  4Z7N A;  2AH0 A;  3VGZ A;  3IKO A;  4A0A B;  4D9S A;  4MMZ A;  5EM2 A;  1GOG A;  2AQ5 A;  1U8C A;  4PBY A;  2EID A;  4E5Z B;  4FHL A;  4WK2 A;  5I5M A;  1S4U X;  4JSN C;  2XYI A;  5EAM A;  3UKU C;  3UR4 A;  4GGC A;  3MZL A;  5FKT A;  3C99 A;  2IUP A;  1VYH C;  1JMZ B;  2YMU A;  4Z7Q A;  4FA1 D;  5IT9 g;  3IJC A;  2CE9 A;  4O2W A;  5IGO A;  2EIC A;  4GM3 A;  4NEN A;  4Y5R D;  4FAN D;  4FA4 D;  4CZY A;  3RFH A;  3SWS D;  2VDO A;  1MDA H;  3EG6 A;  2H9N A;  4J73 A;  4ERY A;  2PM6 B;  4JHN A;  4LG9 A;  4KFM B;  5E6R A;  3FM0 A;  2H14 A;  3RLM D;  3IUJ A;  1O6G A;  5HDB A;  2H3X A;  2Z2N A;  3MUO A;  5GMK n;  3GRE A;  3UVM A;  4ZN4 A;  2OK4 A;  4CI8 A;  3SJL D;  4L3G D;  1UTC A;  3BWS A;  4J81 A;  4AN1 A;  1PEV A;  3ZE0 A;  4Z8L A;  4AX4 A;  3SXT D;  4AMY A;  1QNI A;  3U4Y A;  4IA9 A;  4MK0 B;  1JOF A;  2IUQ A;  2J56 H;  5HE1 B;  2P9K C;  3V5W B;  1OMW B;  3J81 g;  2BBK H;  4A0B B;  2VDM A;  1XIP A;  4G1E A;  3V9F A;  5GXI A;  3DSM A;  3O4I A;  4JT5 C;  4YVD A;  3F3G A;  3QHY B;  3SCY A;  3O4G A;  4A11 B;  2H6K A;  2J55 H;  3MZK A;  2O9K A;  4IMM A;  5A2Q g;  3I7K A;  4GGD A;  4XYI A;  4BL0 A;  4N14 A;  4D6V A;  1N6F A;  2XDW A;  1E8N A;  5JWZ A;  2CN2 A;  1Q47 A;  4R7A B;  5HYN B; 
#chains in the Genus database with same CATH homology
 2B5L A;  1XKS A;  2Q7Q A;  4J77 A;  4FAV D;  4A0A A;  4O3T B;  4I79 A;  2HYE A;  4GM8 A;  5FA5 B;  4CI1 A;  3DXM C;  4CY3 A;  4CY2 A;  4GQB B;  5H17 A;  1JMX B;  1P22 A;  4GZ8 A;  3C5M A;  3JRO A;  3RRM C;  3IJ1 A;  2YNO A;  4AOW A;  2H6Q A;  5HE0 B;  2CO0 C;  4CY5 A;  3I7O A;  3DWL C;  1GXR A;  4J79 A;  3OKY B;  5EML B;  1TYQ C;  3MMY A;  1K32 A;  5TEE A;  2CN3 A;  3OW8 A;  3IIW A;  4QRJ A;  3I7N A;  4H5I A;  1R5M A;  4QL1 A;  4AEZ A;  2PM9 B;  5C9Z B;  2YB8 B;  5FKR A;  3L4O D;  2TRC B;  4JT6 C;  4JXM A;  3EI2 B;  1TBG A;  5AMS A;  4K3I D;  2QC5 A;  5EMK B;  5IGQ A;  2AGZ A;  2IWF A;  3PVU B;  2HES X;  5I5J A;  2IUR A;  3L4M D;  4J0W A;  4QQE A;  5EAR A;  5TEF A;  1A0R B;  4JSP C;  3CFS B;  4J0X A;  3CFV A;  2H6N A;  5FKS A;  2PBI B;  3AL8 B;  3EI3 B;  4CZV A;  3EU7 A;  3HFQ A;  2HXC A;  3MKQ A;  3SBP A;  2P9U C;  3W15 A;  2GC7 A;  2P9I C;  3SBR A;  3EI3 A;  2AGL A;  3FGB A;  4J78 A;  4ZOY A;  3GFC A;  4J86 A;  4O45 A;  2OJY A;  3I7P A;  4PC0 A;  4PNK B;  5CXC B;  1SQJ A;  3BG0 A;  5EM2 B;  3MKS B;  4E54 B;  4EWR A;  2UZX B;  3ODT A;  5GXH A;  1N6E A;  3ULE C;  3PXS D;  3DXK C;  4GM9 A;  5CXC A;  2YNP A;  5AJA A;  4GMB A;  5HQG A;  4FA9 D;  3JB9 L;  2G9A A;  3JAM g;  3DM0 A;  5FXY A;  3OL2 B;  4ES0 A;  3PVW B;  1U4C A;  5IC7 A;  3I8E A;  5B4W A;  1SQ9 A;  2J57 G;  2HJB A;  4CY1 A;  4D0K A;  4XEI C;  3RN1 D;  3FRX A;  4XYH A;  5EAP A;  4FB1 D;  4A7J A;  4ERZ A;  2H47 A;  2PM9 A;  2W18 A;  2HKM A;  2OVP B;  2HJ4 A;  3K27 A;  3EI2 A;  2I3T A;  2CO0 A;  1PI6 A;  4CC9 A;  1MG2 A;  5I5I A;  3UVL A;  5IJ8 E;  3PXW D;  4A2L A;  1NR0 A;  4ERQ A;  3C9C A;  3EI4 B;  3SBQ A;  3PE7 A;  1FWX A;  2PM7 B;  2IUV A;  5CXB B;  2QXV A;  4QT8 A;  1U2V C;  5TDH B;  4J82 A;  4ZOV A;  2OK6 A;  2H9P A;  3KRX B;  2OVR B;  1PBY B;  4X3E A;  4X61 B;  1K8K C;  4OWR A;  4FWW A;  3P4F A;  3JZN A;  3OTT A;  3B7F A;  2Z2O A;  4BUJ C;  3ZWL B;  4LG8 A;  3SN6 B;  3NVQ A;  3IIY A;  4JD2 C;  3E0C A;  3AL9 A;  3F3P A;  3PSL A;  3VA6 A;  3K26 A;  3JZG A;  1XHM A;  3JPX A;  3EI1 A;  4O9D A;  4A2M A;  3A0F A;  3SVW D;  5AFU 3;  3VH0 A;  3N0E A;  3OKY A;  2XL3 A;  4CI3 A;  2IAA A;  3SLE D;  5TF2 A;  3RFG A;  4G56 B;  3MXX A;  4L9O A;  3EI1 B;  3AH8 B;  4J84 A;  2Z2P A;  3OKT A;  4PBZ A;  5CYK A;  4TZ4 A;  2H9M A;  1GG2 B;  3N0D A;  5FQD A;  3SHF A;  5C2W B;  4CZX A;  1OLZ A;  3UKR C;  4A09 B;  3JZH A;  1MG3 A;  4FA5 D;  1RI6 A;  5GSA A;  4A0B A;  2BCJ B;  2I3S A;  3KRW B;  5EAL A;  4GGA A;  4PSX B;  3RSE C;  1PGU A;  3PSC B;  2GNQ A;  5IJ7 E;  3F3F A;  5FLX g;  4JSX C;  5K1C C;  4J8B A;  5SXM A;  4BH6 A;  3SFZ A;  4NSX A;  1SHY B;  3I2N A;  5KDO B;  4J8G A;  2XL2 A;  2B5M A;  2AGY A;  3I7H A;  2CE8 A;  4U1E I;  4OZU A;  2IWK A;  2AGX A;  2OVQ B;  2P9P C;  4X63 B;  1JJU B;  5HE3 B;  3J80 g;  2HKR A;  1NEX B;  2AH1 A;  3RMZ D;  2P9S C;  2G99 A;  3UVK A;  4E54 A;  3NVX A;  2B5N A;  2UZY B;  2I0R A;  3I89 A;  2YNN A;  4H5J A;  4K3J B;  4GQ1 A;  2XU7 A;  5EMM B;  2GC4 A;  3UVN A;  5H1M A;  4L1Q D;  4JSV C;  2MTA H;  3OKW A;  1GP2 B;  2H68 A;  3OL2 A;  4J87 A;  3EWE A;  1B9Y A;  3CIK B;  5K19 A;  3IJ0 A;  2H13 A;  4ESG A;  2EBS A;  3UVO A;  1ERJ A;  4GQ2 P;  3I7L A;  4ZOZ A;  2I0S A;  3RN0 D;  3ORV D;  5CYK B;  2YBA A;  4O3U B;  1YFQ A;  1GOT B;  2B4E A;  3NVN A;  3V7D B;  3I8C A;  3C75 H;  4HDJ A;  3BG1 A;  4A09 A;  4PSW B;  4LGN A;  4O1Q D;  5FKQ A;  3PXT D;  5C2V B;  1N6D A;  2H9L A;  2I0T A;  4ZOX A;  4A08 A;  3AFC A;  2P9N C;  5EMJ B;  4A11 A;  3AL8 A;  3EI4 A;  3JRP A;  3SMR A;  1B9X A;  4U7A A;  4L3H D;  5CXB A;  1L0Q A;  5H14 A;  4UI9 R;  4A08 B;  2CNX A;  3EMH A;  4X60 B;  4Y7R A;  2OIZ A;  4CI2 A;  2AGW A;  4E5Z A;  4PXW A;  2P9L C;  5HE2 B;  5THA A;  2AH0 A;  3VGZ A;  3IKO A;  4A0A B;  5EM2 A;  2AQ5 A;  4PBY A;  4E5Z B;  4FHL A;  5I5M A;  1S4U X;  4JSN C;  2XYI A;  5EAM A;  3UKU C;  3UR4 A;  4GGC A;  3MZL A;  5FKT A;  3C99 A;  2IUP A;  1VYH C;  1JMZ B;  2YMU A;  4FA1 D;  5IT9 g;  3IJC A;  2CE9 A;  5IGO A;  4GM3 A;  4Y5R D;  4FAN D;  4FA4 D;  4CZY A;  3RFH A;  3SWS D;  1MDA H;  3EG6 A;  2H9N A;  4J73 A;  4ERY A;  2PM6 B;  4LG9 A;  4KFM B;  3FM0 A;  2H14 A;  3RLM D;  2H3X A;  2Z2N A;  5GMK n;  3GRE A;  3UVM A;  4ZN4 A;  2OK4 A;  4CI8 A;  3SJL D;  4L3G D;  3BWS A;  4J81 A;  1PEV A;  4Z8L A;  3SXT D;  1QNI A;  3U4Y A;  4IA9 A;  4MK0 B;  1JOF A;  2IUQ A;  2J56 H;  5HE1 B;  2P9K C;  3V5W B;  1OMW B;  3J81 g;  2BBK H;  4A0B B;  1XIP A;  5GXI A;  3V9F A;  3DSM A;  4YVD A;  4JT5 C;  3F3G A;  3SCY A;  4A11 B;  2H6K A;  2J55 H;  3MZK A;  2O9K A;  4IMM A;  5A2Q g;  3I7K A;  4GGD A;  4XYI A;  4BL0 A;  4N14 A;  4D6V A;  1N6F A;  5JWZ A;  2CN2 A;  1Q47 A;  4R7A B;  5HYN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...