4J87A

Crystal structure of alpha-cop
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
327
structure length
316
Chain Sequence
MAMLTKFESRSSRAKGVAFHPTQPWILTSLHNGRIQLWDYRMGTLLDRFDGHDGPVRGIAFHPTQPIFVSGGDDYKVNVWNYKSRKLLFSLCGHMDYVRVCTFHHEYPWILSCSDDQTIRIWNWQSRNCIAILTGHSHYVMCAAFHPSEDLIVSASLDQTVRVWDISGLRMKNAAPVSMSKEDQKAQAADAIVKFVLEGHDRGVNWCAFHPTLPLILSAGDDRLVKLWRMTASKAWEVDTCRGHFNNVSCCLFHPHQELILSASEDKTIRVWDLNRRTAVQTFRRANDRFWFITVHPKLNLFAAAHDSGVMVFKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Rules for the recognition of dilysine retrieval motifs by coatomer.
pubmed doi rcsb
molecule tags Protein transport
molecule keywords coatomer subunit alpha
total genus 79
structure length 316
sequence length 327
ec nomenclature
pdb deposition date 2013-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4j87A00
2QXVA 2PM9A 2HKMA 3PSCB 3EMHA 4H5IA 3I7NA 4E5ZA 4ES0A 3V7DB 5EMJB 5CXCA 4Z8LA 3RMZD 3UKRC 2AH0A 5FKSA 4GM8A 3EI4B 2CE8A 2I0TA 4JT5C 4A0AA 4A7JA 1R5MA 4E54B 4J79A 4U7AA 5I5MA 1N6EA 4ERQA 1OLZA 1XKSA 5FQDA 2HJBA 3DSMA 4J86A 2UZXB 3C9CA 5H1MA 2B5LA 3FRXA 4X60B 3VH0A 3DM0A 1U2VC 4GM3A 1NR0A 2H14A 2YNPA 4A11A 2Z2OA 1GP2B 3RN0D 3FGBA 3IKOA 2CE9A 3RN1D 3VGZA 3IIYA 3J80g 2TRCB 3I7LA 4TZ4A 3SBQA 3OL2A 5IJ8E 3RSEC 4KFMB 4L1QD 2GC7A 2H6KA 2GC4A 2IUVA 4MK0B 4JSNC 3RFGA 3CFVA 2CN2A 3MKQA 5CYKB 5FXYA 1SQJA 3OKYB 4X61B 3ORVD 2AGZA 5GMKn 3CFSB 3AL9A 5TDHB 4QQEA 4FAVD 2H9NA 1SQ9A 3EI2B 5SXMA 3N0EA 1TBGA 3DXMC 1MDAH 4A08A 3HFQA 3OL2B 2IWKA 1GXRA 3B7FA 3BG1A 3EI1A 1TYQC 2MTAH 4QRJA 4OWRA 5K19A 4X63B 4E5ZB 3PXTD 2OIZA 4CY5A 3PSLA 1JMXB 1NEXB 3MZLA 4CY3A 4A0BA 2IURA 3ULEC 2J55H 4O3TB 5EMMB 2IAAA 1QNIA 1JMZB 4E54A 3I89A 3C99A 4BUJC 5GSAA 2P9PC 4AEZA 2CO0C 4GQBB 2AGWA 2J56H 4CI2A 4FA5D 2G99A 2J57G 4LGNA 4X3EA 4HDJA 2H9MA 2PM6B 4J82A 5IGOA 2YMUA 2HKRA 3MXXA 3ZWLB 4FA4D 1PEVA 1L0QA 4ERZA 2W18A 2PM7B 5JWZA 2B5NA 5HYNB 4G56B 3GFCA 1JJUB 1RI6A 4JD2C 4CZXA 3BG0A 4CC9A 3JZGA 5EM2A 3NVQA 2O9KA 4ERYA 4A0AB 4PSXB 4JT6C 3JZHA 2XL2A 2XYIA 3SVWD 1VYHC 2YBAA 4L3GD 2Q7QA 5FA5B 3IJ1A 4IMMA 4D0KA 4GQ1A 1MG2A 5K1CC 3AH8B 2AH1A 3UVNA 5GXIA 4FHLA 4O3UB 1K32A 4PNKB 2H6QA 2G9AA 2H47A 2HJ4A 4J84A 3EU7A 3PVUB 3IIWA 5HE3B 2PBIB 2B4EA 4PSWB 3RFHA 4PBZA 4JSPC 1XHMA 2H13A 4QL1A 3F3PA 4GZ8A 4J78A 4PXWA 2AGLA 3J81g 3DWLC 2YNOA 3AL8B 3SMRA 5IJ7E 4L3HD 3C5MA 4PC0A 5B4WA 3OKYA 5EAMA 2H68A 1PGUA 2H3XA 4ZOZA 3EI2A 4J87A 3I7KA 3KRXB 3JAMg 2Z2NA 5CXBB 2QC5A 3IJCA 5TEEA 4LG8A 2AGYA 5AFU3 4Y7RA 4J0WA 3SJLD 4CI3A 2P9KC 2OK6A 4H5JA 5HQGA 3AFCA 2OK4A 4A09B 2IWFA 2I0RA 2AQ5A 3SXTD 2HXCA 3JPXA 2H9LA 4BH6A 3JRPA 3K27A 3PVWB 5HE1B 4J0XA 3EWEA 3L4OD 5AMSA 2EBSA 4A08B 5EALA 3JZNA 3U4YA 3RLMD 4A09A 3EI4A 4JXMA 4O9DA 4UI9R 4GQ2P 3EG6A 5EARA 4J8GA 2XU7A 4K3JB 4R7AB 3F3FA 3SCYA 4FB1D 2OVQB 3IJ0A 4GM9A 3JB9L 4FWWA 4K3ID 2OVPB 3OKTA 5EM2B 3EI1B 2I3TA 4ZOXA 3N0DA 2BBKH 4FA9D 1XIPA 3VA6A 3SBPA 3I8CA 2Z2PA 1PBYB 3NVNA 3MMYA 3SN6B 1N6DA 2HYEA 5EMLB 1PI6A 5CYKA 3I7PA 2B5MA 3K26A 3EI3B 3UVMA 4J73A 5C2VB 4QT8A 2BCJB 3JROA 3UKUC 4JSXC 1K8KC 2UZYB 4D6VA 3E0CA 5THAA 4I79A 5H14A 4OZUA 5FKQA 5HE0B 4XEIC 4XYIA 2CNXA 3I8EA 4A2MA 3W15A 1MG3A 4CY2A 1S4UX 4JSVC 1A0RB 3C75H 4U1EI 3FM0A 1P22A 1B9YA 5I5JA 4FA1D 2I3SA 4ZN4A 3F3GA 4LG9A 1JOFA 2IUPA 1Q47A 3PXWD 3UVLA 4AOWA 1ERJA 3UVOA 4BL0A 4A0BB 5EAPA 4IA9A 2YB8B 4O45A 4CZYA 5CXBA 3GREA 4ZOYA 2IUQA 4YVDA 2I0SA 4N14A 2P9SC 3DXKC 3SLED 4PBYA 4GGDA 2CO0A 5IC7A 3UVKA 4ZOVA 1B9XA 5H17A 5AJAA 2YNNA 4XYHA 3ODTA 3PXSD 3OKWA 3A0FA 2XL3A 3SHFA 3AL8A 4J8BA 5FKTA 5HE2B 4O1QD 5C2WB 2OVRB 5TEFA 3MKSB 5CXCB 2GNQA 4FAND 5KDOB 1U4CA 4GGAA 1GOTB 5GXHA 4GGCA 2P9NC 5IGQA 2P9UC 5IT9g 4A11B 5C9ZB 3MZKA 1N6FA 3V5WB 4CI1A 2CN3A 3I7HA 3PE7A 1GG2B 3BWSA 3OTTA 4L9OA 2P9IC 3EI3A 2H6NA 4J81A 4A2LA 2HESX 3UR4A 3CIKB 3SFZA 2PM9B 3SBRA 5I5IA 4CY1A 4J77A 5EMKB 3KRWB 3L4MD 5FKRA 4EWRA 3I2NA 3V9FA 4Y5RD 2AGXA 3RRMC 2H9PA 5TF2A 2P9LC 4NSXA 3OW8A 5A2Qg 1FWXA 3SWSD 4CI8A 4CZVA 1SHYB 3I7OA 1OMWB 1YFQA 3NVXA 5FLXg 3P4FA 4GMBA 4ESGA 2OJYA
chains in the Genus database with same CATH superfamily
2QXVA 2PM9A 1H2WA 3K72A 2HKMA 3PSCB 3EMHA 4AMYA 3NIDA 4H5IA 3I7NA 1UOQA 4E5ZA 4ES0A 2BKLA 3V4VA 3V7DB 5EMJB 3ZE0A 5CXCA 4Z8LA 3RMZD 3NIGA 2VDNA 3UKRC 3V4PA 1U8CA 2AH0A 5FKSA 4GM8A 3EI4B 3ZDYA 2CE8A 2I0TA 4JT5C 4A0AA 4AMZA 3O4IA 4A7JA 1R5MA 4E54B 4J79A 4U7AA 4WK2A 5I5MA 1N6EA 1E8NA 1JV2A 4ERQA 1K3IA 1OLZA 1XKSA 5FQDA 2HJBA 3DSMA 3VI3A 4J86A 2UZXB 4BP8A 3C9CA 1GOGA 5H1MA 2B5LA 3FRXA 4DNVA 4X60B 3VH0A 4AN1A 3DM0A 1U2VC 4GM3A 3DDUA 1NR0A 2H14A 2YNPA 4D9SA 4A11A 2Z2OA 1GP2B 3RN0D 3FGBA 2QR5A 3IKOA 2CE9A 3IULA 3RN1D 3VGZA 3IIYA 3J80g 3ZE2A 2TRCB 3I7LA 5M5SA 4TZ4A 3SBQA 3OL2A 5IJ8E 3RSEC 4KFMB 4L1QD 2GC7A 2H6KA 2GC4A 2IUVA 4MMYA 4MK0B 4JSNC 3RFGA 3CFVA 2CN2A 3MKQA 5CYKB 1UOPA 5FXYA 1SQJA 3OKYB 4X61B 3ORVD 2AGZA 4NAAA 5GMKn 3CFSB 3VI4A 3AL9A 5TDHB 4QQEA 4FAVD 2H9NA 1SQ9A 3EI2B 5SXMA 3N0EA 1TBGA 4G55A 5E6SA 3DXMC 4G1MA 1MDAH 4A08A 3HFQA 3OL2B 2IWKA 1GXRA 4NBMA 3B7FA 3BG1A 1QFSA 3EI1A 4G1EA 2HU8A 1TYQC 2MTAH 4QRJA 4OWRA 4QAMA 5E6RA 1TYEA 5K19A 4X63B 4E5ZB 3PXTD 4MMZA 2OIZA 4CY5A 3FCUA 3IUQA 3PSLA 1JMXB 1NEXB 4O02A 5FFOA 3IJEA 3MZLA 4JHNA 2JKXA 4CY3A 4A0BA 2IURA 3ULEC 2J55H 4O3TB 5EMMB 2IAAA 1QNIA 1JMZB 4E54A 3I89A 4RE6A 3C99A 4BUJC 5GSAA 2P9PC 4AEZA 2CO0C 4GQBB 2AGWA 2J56H 4CI2A 4FA5D 2EICA 2G99A 3O4JA 2J57G 4WJKA 4LGNA 4X3EA 4HDJA 2H9MA 2PM6B 4J82A 5IGOA 2YMUA 2HKRA 1VZ3A 3MXXA 3ZWLB 4FA4D 1PEVA 4AX4A 4DNWA 1L0QA 4ERZA 2W18A 2PM7B 5JWZA 1M1XA 2VDQA 2B5NA 5HYNB 4G56B 3GFCA 1JJUB 4Z7NA 1RI6A 4JD2C 4CZXA 3BG0A 4CC9A 3JZGA 5EM2A 1UTCA 3NVQA 4L1MA 2O9KA 4ERYA 4A0AB 4BCDA 4PSXB 2VZ1A 3K6SA 4JT6C 3JZHA 2XL2A 2XYIA 3SVWD 3O4GA 1VYHC 2YBAA 4L3GD 2Q7QA 5FA5B 3IJ1A 4IMMA 4D0KA 3IVMA 4GQ1A 2XDWA 1I2MB 4UM9A 1MG2A 5K1CC 3T3MA 3AH8B 2AH1A 3UVNA 5GXIA 2VC2A 4FHLA 1VE6A 4O3UB 1K32A 4PNKB 2H6QA 2G9AA 2H47A 2HJ4A 4J84A 3EU7A 3PVUB 3IIWA 3ZE1A 5HE3B 2PBIB 2B4EA 4PSWB 3RFHA 5M5UA 4PBZA 4JSPC 5M5TA 1XHMA 2H13A 4QL1A 3F3PA 1O6GA 4GZ8A 4J78A 4PXWA 2AGLA 3J81g 2WQ8A 3DWLC 4WK0A 2YNOA 3AL8B 3SMRA 3KCIA 5IJ7E 4L3HD 3C5MA 4NC4A 4PC0A 5B4WA 3OKYA 5EAMA 2H68A 4Z7QA 1PGUA 2H3XA 1H2ZA 4ZOZA 3EI2A 4J87A 3I7KA 3KRXB 3JAMg 2Z2NA 2EIBA 1BPOA 3GD1I 5CXBB 2QC5A 3IJCA 5TEEA 4LG8A 2AGYA 5AFU3 4J0WA 4Y7RA 1GOFA 2VDLA 3SJLD 4CI3A 5C86A 2P9KC 2OK6A 3MUOA 4H5JA 5HQGA 3AFCA 2OK4A 4A09B 2IWFA 1UOOA 2I0RA 2AQ5A 3SXTD 2HXCA 3JPXA 4AN0A 5FFGA 2H9LA 4BH6A 2EIDA 3JRPA 3K27A 2QZPA 3PVWB 1E5TA 5HE1B 4J0XA 3EWEA 3L4OD 5AMSA 3FCSA 2EBSA 1QFMA 5EALA 4A08B 3JZNA 1L5GA 3U4YA 3RLMD 4A09A 3EI4A 4JXMA 4Z7OA 1A12A 4O2WA 4O9DA 4UI9R 4GQ2P 3EG6A 5EARA 4J8GA 2XU7A 4K3JB 4R7AB 3F3FA 3SCYA 2EIEA 4FB1D 2OVQB 3IJ0A 2XZGA 4GM9A 4GMBA 3JB9L 4FWWA 4K3ID 2OVPB 3OKTA 5EM2B 3EI1B 2I3TA 4ZOXA 3N0DA 2HU7A 2BBKH 4FA9D 1XIPA 3VA6A 1T2XA 2VZ3A 3EQ7A 3SBPA 3I8CA 2Z2PA 1PBYB 3NVNA 2VDMA 3MMYA 3SN6B 4NENA 1N6DA 3EQ8A 3IUNA 2HYEA 5EMLB 1PI6A 1C9LA 5CYKA 2VDRA 4RE5A 3I7PA 2B5MA 3K26A 3EI3B 1GOHA 3UVMA 3T3PA 2HU5A 4J73A 5C2VB 4QT8A 3IURA 1VZ2A 2BCJB 3JROA 3UKUC 4JSXC 1K8KC 2UZYB 4D6VA 3E0CA 5THAA 4WK4A 4I79A 5H14A 4OZUA 3QHYB 5E6UA 5FKQA 5HE0B 5M5RA 4BP9A 4XEIC 4MMXA 4XYIA 3OF7A 2CNXA 3I8EA 1H2YA 4A2MA 3W15A 1MG3A 4CY2A 1S4UX 3NIFA 4BCBA 4JSVC 3IUMA 1A0RB 3C75H 4U1EI 3FM0A 5C92A 1P22A 1B9YA 5I5JA 4FA1D 2I3SA 4ZN4A 3F3GA 4LG9A 3QI0A 1JOFA 2IUPA 3MUNA 1Q47A 3PXWD 3UVLA 4AOWA 1ERJA 1E8MA 2VDOA 3UVOA 4DNUA 4BL0A 4A0BB 5EAPA 4IA9A 2YB8B 4O45A 4CZYA 5CXBA 3GREA 4ZOYA 2IUQA 4YVDA 2I0SA 4N14A 2P9SC 3DXKC 3SLED 4PBYA 4GGDA 2CO0A 5IC7A 3UVKA 1JTDB 4ZOVA 1B9XA 5H17A 5AJAA 2YNNA 5M61A 4XYHA 3ODTA 2VDKA 3PXSD 3OKWA 3A0FA 1H2XA 2XL3A 3AL8A 4J8BA 3SHFA 5FKTA 5HE2B 4IRZA 4O1QD 5C2WB 2OVRB 5TEFA 3MKSB 5CXCB 2GNQA 4FAND 5KDOB 4UM8A 1O6FA 1U4CA 4GGAA 1GOTB 5GXHA 4GGCA 2P9NC 5IGQA 2P9UC 3ZDZA 5HDBA 4A11B 5C9ZB 5IT9g 3MZKA 2VDPA 1N6FA 3V5WB 4CI1A 2CN3A 3I7HA 3PE7A 1GG2B 3BWSA 3OTTA 2XE4A 3MVDK 4L9OA 2P9IC 3K71A 3EI3A 2H6NA 4J81A 3ZDXA 4A2LA 2HESX 3UR4A 3CIKB 3SFZA 4BCCA 3EQ9A 2PM9B 3SBRA 5I5IA 1C9IA 4CY1A 4J77A 4JHPC 3GC3B 5EMKB 3KRWB 3L4MD 5FKRA 4EWRA 3I2NA 3V9FA 4Y5RD 2AGXA 3RRMC 2H9PA 5M5VA 5TF2A 3O4HA 2P9LC 4NSXA 3OW8A 5A2Qg 1FWXA 3SWSD 4CI8A 4CZVA 1SHYB 3I7OA 1VE7A 1OMWB 3NVXA 5FLXg 3P4FA 1YR2A 1YFQA 3IUJA 4ESGA 2OJYA
chains in the Genus database with same CATH topology
2QXVA 2PM9A 2HKMA 3PSCB 3EMHA 4H5IA 3I7NA 4E5ZA 4ES0A 3V7DB 5EMJB 5CXCA 4Z8LA 3RMZD 3UKRC 2AH0A 5FKSA 4GM8A 3EI4B 2CE8A 2I0TA 4JT5C 4A0AA 4A7JA 1R5MA 4E54B 4J79A 4U7AA 5I5MA 1N6EA 4ERQA 1OLZA 1XKSA 5FQDA 2HJBA 3DSMA 4J86A 2UZXB 3C9CA 5H1MA 2B5LA 3FRXA 4X60B 3VH0A 3DM0A 1U2VC 4GM3A 1NR0A 2H14A 2YNPA 4A11A 2Z2OA 1GP2B 3RN0D 3FGBA 3IKOA 2CE9A 3RN1D 3VGZA 3IIYA 3J80g 2TRCB 3I7LA 4TZ4A 3SBQA 3OL2A 5IJ8E 3RSEC 4KFMB 4L1QD 2GC7A 2H6KA 2GC4A 2IUVA 4MK0B 4JSNC 3RFGA 3CFVA 2CN2A 3MKQA 5CYKB 5FXYA 1SQJA 3OKYB 4X61B 3ORVD 2AGZA 5GMKn 3CFSB 3AL9A 5TDHB 4QQEA 4FAVD 2H9NA 1SQ9A 3EI2B 5SXMA 3N0EA 1TBGA 3DXMC 1MDAH 4A08A 3HFQA 3OL2B 2IWKA 1GXRA 3B7FA 3BG1A 3EI1A 1TYQC 2MTAH 4QRJA 4OWRA 5K19A 4X63B 4E5ZB 3PXTD 2OIZA 4CY5A 3PSLA 1JMXB 1NEXB 3MZLA 4CY3A 4A0BA 2IURA 3ULEC 2J55H 4O3TB 5EMMB 2IAAA 1QNIA 1JMZB 4E54A 3I89A 3C99A 4BUJC 5GSAA 2P9PC 4AEZA 2CO0C 4GQBB 2AGWA 2J56H 4CI2A 4FA5D 2G99A 2J57G 4LGNA 4X3EA 4HDJA 2H9MA 2PM6B 4J82A 5IGOA 2YMUA 2HKRA 3MXXA 3ZWLB 4FA4D 1PEVA 1L0QA 4ERZA 2W18A 2PM7B 5JWZA 2B5NA 5HYNB 4G56B 3GFCA 1JJUB 1RI6A 4JD2C 4CZXA 3BG0A 4CC9A 3JZGA 5EM2A 3NVQA 2O9KA 4ERYA 4A0AB 4PSXB 4JT6C 3JZHA 2XL2A 2XYIA 3SVWD 1VYHC 2YBAA 4L3GD 2Q7QA 5FA5B 3IJ1A 4IMMA 4D0KA 4GQ1A 1MG2A 5K1CC 3AH8B 2AH1A 3UVNA 5GXIA 4FHLA 4O3UB 1K32A 4PNKB 2H6QA 2G9AA 2H47A 2HJ4A 4J84A 3EU7A 3PVUB 3IIWA 5HE3B 2PBIB 2B4EA 4PSWB 3RFHA 4PBZA 4JSPC 1XHMA 2H13A 4QL1A 3F3PA 4GZ8A 4J78A 4PXWA 2AGLA 3J81g 3DWLC 2YNOA 3AL8B 3SMRA 5IJ7E 4L3HD 3C5MA 4PC0A 5B4WA 3OKYA 5EAMA 2H68A 1PGUA 2H3XA 4ZOZA 3EI2A 4J87A 3I7KA 3KRXB 3JAMg 2Z2NA 5CXBB 2QC5A 3IJCA 5TEEA 4LG8A 2AGYA 5AFU3 4Y7RA 4J0WA 3SJLD 4CI3A 2P9KC 2OK6A 4H5JA 5HQGA 3AFCA 2OK4A 4A09B 2IWFA 2I0RA 2AQ5A 3SXTD 2HXCA 3JPXA 2H9LA 4BH6A 3JRPA 3K27A 3PVWB 5HE1B 4J0XA 3EWEA 3L4OD 5AMSA 2EBSA 4A08B 5EALA 3JZNA 3U4YA 3RLMD 4A09A 3EI4A 4JXMA 4O9DA 4UI9R 4GQ2P 3EG6A 5EARA 4J8GA 2XU7A 4K3JB 4R7AB 3F3FA 3SCYA 4FB1D 2OVQB 3IJ0A 4GM9A 3JB9L 4FWWA 4K3ID 2OVPB 3OKTA 5EM2B 3EI1B 2I3TA 4ZOXA 3N0DA 2BBKH 4FA9D 1XIPA 3VA6A 3SBPA 3I8CA 2Z2PA 1PBYB 3NVNA 3MMYA 3SN6B 1N6DA 2HYEA 5EMLB 1PI6A 5CYKA 3I7PA 2B5MA 3K26A 3EI3B 3UVMA 4J73A 5C2VB 4QT8A 2BCJB 3JROA 3UKUC 4JSXC 1K8KC 2UZYB 4D6VA 3E0CA 5THAA 4I79A 5H14A 4OZUA 5FKQA 5HE0B 4XEIC 4XYIA 2CNXA 3I8EA 4A2MA 3W15A 1MG3A 4CY2A 1S4UX 4JSVC 1A0RB 3C75H 4U1EI 3FM0A 1P22A 1B9YA 5I5JA 4FA1D 2I3SA 4ZN4A 3F3GA 4LG9A 1JOFA 2IUPA 1Q47A 3PXWD 3UVLA 4AOWA 1ERJA 3UVOA 4BL0A 4A0BB 5EAPA 4IA9A 2YB8B 4O45A 4CZYA 5CXBA 3GREA 4ZOYA 2IUQA 4YVDA 2I0SA 4N14A 2P9SC 3DXKC 3SLED 4PBYA 4GGDA 2CO0A 5IC7A 3UVKA 4ZOVA 1B9XA 5H17A 5AJAA 2YNNA 4XYHA 3ODTA 3PXSD 3OKWA 3A0FA 2XL3A 3SHFA 3AL8A 4J8BA 5FKTA 5HE2B 4O1QD 5C2WB 2OVRB 5TEFA 3MKSB 5CXCB 2GNQA 4FAND 5KDOB 1U4CA 4GGAA 1GOTB 5GXHA 4GGCA 2P9NC 5IGQA 2P9UC 5IT9g 4A11B 5C9ZB 3MZKA 1N6FA 3V5WB 4CI1A 2CN3A 3I7HA 3PE7A 1GG2B 3BWSA 3OTTA 4L9OA 2P9IC 3EI3A 2H6NA 4J81A 4A2LA 2HESX 3UR4A 3CIKB 3SFZA 2PM9B 3SBRA 5I5IA 4CY1A 4J77A 5EMKB 3KRWB 3L4MD 5FKRA 4EWRA 3I2NA 3V9FA 4Y5RD 2AGXA 3RRMC 2H9PA 5TF2A 2P9LC 4NSXA 3OW8A 5A2Qg 1FWXA 3SWSD 4CI8A 4CZVA 1SHYB 3I7OA 1OMWB 1YFQA 3NVXA 5FLXg 3P4FA 4GMBA 4ESGA 2OJYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QXV A;  2PM9 A;  2HKM A;  3PSC B;  3EMH A;  4H5I A;  3I7N A;  4E5Z A;  4ES0 A;  3V7D B;  5EMJ B;  5CXC A;  4Z8L A;  3RMZ D;  3UKR C;  2AH0 A;  5FKS A;  4GM8 A;  3EI4 B;  2CE8 A;  2I0T A;  4JT5 C;  4A0A A;  4A7J A;  1R5M A;  4E54 B;  4J79 A;  4U7A A;  5I5M A;  1N6E A;  4ERQ A;  1OLZ A;  1XKS A;  5FQD A;  2HJB A;  3DSM A;  4J86 A;  2UZX B;  3C9C A;  5H1M A;  2B5L A;  3FRX A;  4X60 B;  3VH0 A;  3DM0 A;  1U2V C;  4GM3 A;  1NR0 A;  2H14 A;  2YNP A;  4A11 A;  2Z2O A;  1GP2 B;  3RN0 D;  3FGB A;  3IKO A;  2CE9 A;  3RN1 D;  3VGZ A;  3IIY A;  3J80 g;  2TRC B;  3I7L A;  4TZ4 A;  3SBQ A;  3OL2 A;  5IJ8 E;  3RSE C;  4KFM B;  4L1Q D;  2GC7 A;  2H6K A;  2GC4 A;  2IUV A;  4MK0 B;  4JSN C;  3RFG A;  3CFV A;  2CN2 A;  3MKQ A;  5CYK B;  5FXY A;  1SQJ A;  3OKY B;  4X61 B;  3ORV D;  2AGZ A;  5GMK n;  3CFS B;  3AL9 A;  5TDH B;  4QQE A;  4FAV D;  2H9N A;  1SQ9 A;  3EI2 B;  5SXM A;  3N0E A;  1TBG A;  3DXM C;  1MDA H;  4A08 A;  3HFQ A;  3OL2 B;  2IWK A;  1GXR A;  3B7F A;  3BG1 A;  3EI1 A;  1TYQ C;  2MTA H;  4QRJ A;  4OWR A;  5K19 A;  4X63 B;  4E5Z B;  3PXT D;  2OIZ A;  4CY5 A;  3PSL A;  1JMX B;  1NEX B;  3MZL A;  4CY3 A;  4A0B A;  2IUR A;  3ULE C;  2J55 H;  4O3T B;  5EMM B;  2IAA A;  1QNI A;  1JMZ B;  4E54 A;  3I89 A;  3C99 A;  4BUJ C;  5GSA A;  2P9P C;  4AEZ A;  2CO0 C;  4GQB B;  2AGW A;  2J56 H;  4CI2 A;  4FA5 D;  2G99 A;  2J57 G;  4LGN A;  4X3E A;  4HDJ A;  2H9M A;  2PM6 B;  4J82 A;  5IGO A;  2YMU A;  2HKR A;  3MXX A;  3ZWL B;  4FA4 D;  1PEV A;  1L0Q A;  4ERZ A;  2W18 A;  2PM7 B;  5JWZ A;  2B5N A;  5HYN B;  4G56 B;  3GFC A;  1JJU B;  1RI6 A;  4JD2 C;  4CZX A;  3BG0 A;  4CC9 A;  3JZG A;  5EM2 A;  3NVQ A;  2O9K A;  4ERY A;  4A0A B;  4PSX B;  4JT6 C;  3JZH A;  2XL2 A;  2XYI A;  3SVW D;  1VYH C;  2YBA A;  4L3G D;  2Q7Q A;  5FA5 B;  3IJ1 A;  4IMM A;  4D0K A;  4GQ1 A;  1MG2 A;  5K1C C;  3AH8 B;  2AH1 A;  3UVN A;  5GXI A;  4FHL A;  4O3U B;  1K32 A;  4PNK B;  2H6Q A;  2G9A A;  2H47 A;  2HJ4 A;  4J84 A;  3EU7 A;  3PVU B;  3IIW A;  5HE3 B;  2PBI B;  2B4E A;  4PSW B;  3RFH A;  4PBZ A;  4JSP C;  1XHM A;  2H13 A;  4QL1 A;  3F3P A;  4GZ8 A;  4J78 A;  4PXW A;  2AGL A;  3J81 g;  3DWL C;  2YNO A;  3AL8 B;  3SMR A;  5IJ7 E;  4L3H D;  3C5M A;  4PC0 A;  5B4W A;  3OKY A;  5EAM A;  2H68 A;  1PGU A;  2H3X A;  4ZOZ A;  3EI2 A;  4J87 A;  3I7K A;  3KRX B;  3JAM g;  2Z2N A;  5CXB B;  2QC5 A;  3IJC A;  5TEE A;  4LG8 A;  2AGY A;  5AFU 3;  4Y7R A;  4J0W A;  3SJL D;  4CI3 A;  2P9K C;  2OK6 A;  4H5J A;  5HQG A;  3AFC A;  2OK4 A;  4A09 B;  2IWF A;  2I0R A;  2AQ5 A;  3SXT D;  2HXC A;  3JPX A;  2H9L A;  4BH6 A;  3JRP A;  3K27 A;  3PVW B;  5HE1 B;  4J0X A;  3EWE A;  3L4O D;  5AMS A;  2EBS A;  4A08 B;  5EAL A;  3JZN A;  3U4Y A;  3RLM D;  4A09 A;  3EI4 A;  4JXM A;  4O9D A;  4UI9 R;  4GQ2 P;  3EG6 A;  5EAR A;  4J8G A;  2XU7 A;  4K3J B;  4R7A B;  3F3F A;  3SCY A;  4FB1 D;  2OVQ B;  3IJ0 A;  4GM9 A;  3JB9 L;  4FWW A;  4K3I D;  2OVP B;  3OKT A;  5EM2 B;  3EI1 B;  2I3T A;  4ZOX A;  3N0D A;  2BBK H;  4FA9 D;  1XIP A;  3VA6 A;  3SBP A;  3I8C A;  2Z2P A;  1PBY B;  3NVN A;  3MMY A;  3SN6 B;  1N6D A;  2HYE A;  5EML B;  1PI6 A;  5CYK A;  3I7P A;  2B5M A;  3K26 A;  3EI3 B;  3UVM A;  4J73 A;  5C2V B;  4QT8 A;  2BCJ B;  3JRO A;  3UKU C;  4JSX C;  1K8K C;  2UZY B;  4D6V A;  3E0C A;  5THA A;  4I79 A;  5H14 A;  4OZU A;  5FKQ A;  5HE0 B;  4XEI C;  4XYI A;  2CNX A;  3I8E A;  4A2M A;  3W15 A;  1MG3 A;  4CY2 A;  1S4U X;  4JSV C;  1A0R B;  3C75 H;  4U1E I;  3FM0 A;  1P22 A;  1B9Y A;  5I5J A;  4FA1 D;  2I3S A;  4ZN4 A;  3F3G A;  4LG9 A;  1JOF A;  2IUP A;  1Q47 A;  3PXW D;  3UVL A;  4AOW A;  1ERJ A;  3UVO A;  4BL0 A;  4A0B B;  5EAP A;  4IA9 A;  2YB8 B;  4O45 A;  4CZY A;  5CXB A;  3GRE A;  4ZOY A;  2IUQ A;  4YVD A;  2I0S A;  4N14 A;  2P9S C;  3DXK C;  3SLE D;  4PBY A;  4GGD A;  2CO0 A;  5IC7 A;  3UVK A;  4ZOV A;  1B9X A;  5H17 A;  5AJA A;  2YNN A;  4XYH A;  3ODT A;  3PXS D;  3OKW A;  3A0F A;  2XL3 A;  3SHF A;  3AL8 A;  4J8B A;  5FKT A;  5HE2 B;  4O1Q D;  5C2W B;  2OVR B;  5TEF A;  3MKS B;  5CXC B;  2GNQ A;  4FAN D;  5KDO B;  1U4C A;  4GGA A;  1GOT B;  5GXH A;  4GGC A;  2P9N C;  5IGQ A;  2P9U C;  5IT9 g;  4A11 B;  5C9Z B;  3MZK A;  1N6F A;  3V5W B;  4CI1 A;  2CN3 A;  3I7H A;  3PE7 A;  1GG2 B;  3BWS A;  3OTT A;  4L9O A;  2P9I C;  3EI3 A;  2H6N A;  4J81 A;  4A2L A;  2HES X;  3UR4 A;  3CIK B;  3SFZ A;  2PM9 B;  3SBR A;  5I5I A;  4CY1 A;  4J77 A;  5EMK B;  3KRW B;  3L4M D;  5FKR A;  4EWR A;  3I2N A;  3V9F A;  4Y5R D;  2AGX A;  3RRM C;  2H9P A;  5TF2 A;  2P9L C;  4NSX A;  3OW8 A;  5A2Q g;  1FWX A;  3SWS D;  4CI8 A;  4CZV A;  1SHY B;  3I7O A;  1OMW B;  1YFQ A;  3NVX A;  5FLX g;  3P4F A;  4GMB A;  4ESG A;  2OJY A; 
#chains in the Genus database with same CATH topology
 2QXV A;  2PM9 A;  1H2W A;  3K72 A;  2HKM A;  3PSC B;  3EMH A;  4AMY A;  3NID A;  4H5I A;  3I7N A;  1UOQ A;  4E5Z A;  4ES0 A;  2BKL A;  3V4V A;  3V7D B;  5EMJ B;  3ZE0 A;  5CXC A;  4Z8L A;  3RMZ D;  3NIG A;  2VDN A;  3UKR C;  3V4P A;  1U8C A;  2AH0 A;  5FKS A;  4GM8 A;  3EI4 B;  3ZDY A;  2CE8 A;  2I0T A;  4JT5 C;  4A0A A;  4AMZ A;  3O4I A;  4A7J A;  1R5M A;  4E54 B;  4J79 A;  4U7A A;  4WK2 A;  5I5M A;  1N6E A;  1E8N A;  1JV2 A;  4ERQ A;  1K3I A;  1OLZ A;  1XKS A;  5FQD A;  2HJB A;  3DSM A;  3VI3 A;  4J86 A;  2UZX B;  4BP8 A;  3C9C A;  1GOG A;  5H1M A;  2B5L A;  3FRX A;  4DNV A;  4X60 B;  3VH0 A;  4AN1 A;  3DM0 A;  1U2V C;  4GM3 A;  3DDU A;  1NR0 A;  2H14 A;  2YNP A;  4D9S A;  4A11 A;  2Z2O A;  1GP2 B;  3RN0 D;  3FGB A;  2QR5 A;  3IKO A;  2CE9 A;  3IUL A;  3RN1 D;  3VGZ A;  3IIY A;  3J80 g;  3ZE2 A;  2TRC B;  3I7L A;  5M5S A;  4TZ4 A;  3SBQ A;  3OL2 A;  5IJ8 E;  3RSE C;  4KFM B;  4L1Q D;  2GC7 A;  2H6K A;  2GC4 A;  2IUV A;  4MMY A;  4MK0 B;  4JSN C;  3RFG A;  3CFV A;  2CN2 A;  3MKQ A;  5CYK B;  1UOP A;  5FXY A;  1SQJ A;  3OKY B;  4X61 B;  3ORV D;  2AGZ A;  4NAA A;  5GMK n;  3CFS B;  3VI4 A;  3AL9 A;  5TDH B;  4QQE A;  4FAV D;  2H9N A;  1SQ9 A;  3EI2 B;  5SXM A;  3N0E A;  1TBG A;  4G55 A;  5E6S A;  3DXM C;  4G1M A;  1MDA H;  4A08 A;  3HFQ A;  3OL2 B;  2IWK A;  1GXR A;  4NBM A;  3B7F A;  3BG1 A;  1QFS A;  3EI1 A;  4G1E A;  2HU8 A;  1TYQ C;  2MTA H;  4QRJ A;  4OWR A;  4QAM A;  5E6R A;  1TYE A;  5K19 A;  4X63 B;  4E5Z B;  3PXT D;  4MMZ A;  2OIZ A;  4CY5 A;  3FCU A;  3IUQ A;  3PSL A;  1JMX B;  1NEX B;  4O02 A;  5FFO A;  3IJE A;  3MZL A;  4JHN A;  2JKX A;  4CY3 A;  4A0B A;  2IUR A;  3ULE C;  2J55 H;  4O3T B;  5EMM B;  2IAA A;  1QNI A;  1JMZ B;  4E54 A;  3I89 A;  4RE6 A;  3C99 A;  4BUJ C;  5GSA A;  2P9P C;  4AEZ A;  2CO0 C;  4GQB B;  2AGW A;  2J56 H;  4CI2 A;  4FA5 D;  2EIC A;  2G99 A;  3O4J A;  2J57 G;  4WJK A;  4LGN A;  4X3E A;  4HDJ A;  2H9M A;  2PM6 B;  4J82 A;  5IGO A;  2YMU A;  2HKR A;  1VZ3 A;  3MXX A;  3ZWL B;  4FA4 D;  1PEV A;  4AX4 A;  4DNW A;  1L0Q A;  4ERZ A;  2W18 A;  2PM7 B;  5JWZ A;  1M1X A;  2VDQ A;  2B5N A;  5HYN B;  4G56 B;  3GFC A;  1JJU B;  4Z7N A;  1RI6 A;  4JD2 C;  4CZX A;  3BG0 A;  4CC9 A;  3JZG A;  5EM2 A;  1UTC A;  3NVQ A;  4L1M A;  2O9K A;  4ERY A;  4A0A B;  4BCD A;  4PSX B;  2VZ1 A;  3K6S A;  4JT6 C;  3JZH A;  2XL2 A;  2XYI A;  3SVW D;  3O4G A;  1VYH C;  2YBA A;  4L3G D;  2Q7Q A;  5FA5 B;  3IJ1 A;  4IMM A;  4D0K A;  3IVM A;  4GQ1 A;  2XDW A;  1I2M B;  4UM9 A;  1MG2 A;  5K1C C;  3T3M A;  3AH8 B;  2AH1 A;  3UVN A;  5GXI A;  2VC2 A;  4FHL A;  1VE6 A;  4O3U B;  1K32 A;  4PNK B;  2H6Q A;  2G9A A;  2H47 A;  2HJ4 A;  4J84 A;  3EU7 A;  3PVU B;  3IIW A;  3ZE1 A;  5HE3 B;  2PBI B;  2B4E A;  4PSW B;  3RFH A;  5M5U A;  4PBZ A;  4JSP C;  5M5T A;  1XHM A;  2H13 A;  4QL1 A;  3F3P A;  1O6G A;  4GZ8 A;  4J78 A;  4PXW A;  2AGL A;  3J81 g;  2WQ8 A;  3DWL C;  4WK0 A;  2YNO A;  3AL8 B;  3SMR A;  3KCI A;  5IJ7 E;  4L3H D;  3C5M A;  4NC4 A;  4PC0 A;  5B4W A;  3OKY A;  5EAM A;  2H68 A;  4Z7Q A;  1PGU A;  2H3X A;  1H2Z A;  4ZOZ A;  3EI2 A;  4J87 A;  3I7K A;  3KRX B;  3JAM g;  2Z2N A;  2EIB A;  1BPO A;  3GD1 I;  5CXB B;  2QC5 A;  3IJC A;  5TEE A;  4LG8 A;  2AGY A;  5AFU 3;  4J0W A;  4Y7R A;  1GOF A;  2VDL A;  3SJL D;  4CI3 A;  5C86 A;  2P9K C;  2OK6 A;  3MUO A;  4H5J A;  5HQG A;  3AFC A;  2OK4 A;  4A09 B;  2IWF A;  1UOO A;  2I0R A;  2AQ5 A;  3SXT D;  2HXC A;  3JPX A;  4AN0 A;  5FFG A;  2H9L A;  4BH6 A;  2EID A;  3JRP A;  3K27 A;  2QZP A;  3PVW B;  1E5T A;  5HE1 B;  4J0X A;  3EWE A;  3L4O D;  5AMS A;  3FCS A;  2EBS A;  1QFM A;  5EAL A;  4A08 B;  3JZN A;  1L5G A;  3U4Y A;  3RLM D;  4A09 A;  3EI4 A;  4JXM A;  4Z7O A;  1A12 A;  4O2W A;  4O9D A;  4UI9 R;  4GQ2 P;  3EG6 A;  5EAR A;  4J8G A;  2XU7 A;  4K3J B;  4R7A B;  3F3F A;  3SCY A;  2EIE A;  4FB1 D;  2OVQ B;  3IJ0 A;  2XZG A;  4GM9 A;  4GMB A;  3JB9 L;  4FWW A;  4K3I D;  2OVP B;  3OKT A;  5EM2 B;  3EI1 B;  2I3T A;  4ZOX A;  3N0D A;  2HU7 A;  2BBK H;  4FA9 D;  1XIP A;  3VA6 A;  1T2X A;  2VZ3 A;  3EQ7 A;  3SBP A;  3I8C A;  2Z2P A;  1PBY B;  3NVN A;  2VDM A;  3MMY A;  3SN6 B;  4NEN A;  1N6D A;  3EQ8 A;  3IUN A;  2HYE A;  5EML B;  1PI6 A;  1C9L A;  5CYK A;  2VDR A;  4RE5 A;  3I7P A;  2B5M A;  3K26 A;  3EI3 B;  1GOH A;  3UVM A;  3T3P A;  2HU5 A;  4J73 A;  5C2V B;  4QT8 A;  3IUR A;  1VZ2 A;  2BCJ B;  3JRO A;  3UKU C;  4JSX C;  1K8K C;  2UZY B;  4D6V A;  3E0C A;  5THA A;  4WK4 A;  4I79 A;  5H14 A;  4OZU A;  3QHY B;  5E6U A;  5FKQ A;  5HE0 B;  5M5R A;  4BP9 A;  4XEI C;  4MMX A;  4XYI A;  3OF7 A;  2CNX A;  3I8E A;  1H2Y A;  4A2M A;  3W15 A;  1MG3 A;  4CY2 A;  1S4U X;  3NIF A;  4BCB A;  4JSV C;  3IUM A;  1A0R B;  3C75 H;  4U1E I;  3FM0 A;  5C92 A;  1P22 A;  1B9Y A;  5I5J A;  4FA1 D;  2I3S A;  4ZN4 A;  3F3G A;  4LG9 A;  3QI0 A;  1JOF A;  2IUP A;  3MUN A;  1Q47 A;  3PXW D;  3UVL A;  4AOW A;  1ERJ A;  1E8M A;  2VDO A;  3UVO A;  4DNU A;  4BL0 A;  4A0B B;  5EAP A;  4IA9 A;  2YB8 B;  4O45 A;  4CZY A;  5CXB A;  3GRE A;  4ZOY A;  2IUQ A;  4YVD A;  2I0S A;  4N14 A;  2P9S C;  3DXK C;  3SLE D;  4PBY A;  4GGD A;  2CO0 A;  5IC7 A;  3UVK A;  1JTD B;  4ZOV A;  1B9X A;  5H17 A;  5AJA A;  2YNN A;  5M61 A;  4XYH A;  3ODT A;  2VDK A;  3PXS D;  3OKW A;  3A0F A;  1H2X A;  2XL3 A;  3AL8 A;  4J8B A;  3SHF A;  5FKT A;  5HE2 B;  4IRZ A;  4O1Q D;  5C2W B;  2OVR B;  5TEF A;  3MKS B;  5CXC B;  2GNQ A;  4FAN D;  5KDO B;  4UM8 A;  1O6F A;  1U4C A;  4GGA A;  1GOT B;  5GXH A;  4GGC A;  2P9N C;  5IGQ A;  2P9U C;  3ZDZ A;  5HDB A;  4A11 B;  5C9Z B;  5IT9 g;  3MZK A;  2VDP A;  1N6F A;  3V5W B;  4CI1 A;  2CN3 A;  3I7H A;  3PE7 A;  1GG2 B;  3BWS A;  3OTT A;  2XE4 A;  3MVD K;  4L9O A;  2P9I C;  3K71 A;  3EI3 A;  2H6N A;  4J81 A;  3ZDX A;  4A2L A;  2HES X;  3UR4 A;  3CIK B;  3SFZ A;  4BCC A;  3EQ9 A;  2PM9 B;  3SBR A;  5I5I A;  1C9I A;  4CY1 A;  4J77 A;  4JHP C;  3GC3 B;  5EMK B;  3KRW B;  3L4M D;  5FKR A;  4EWR A;  3I2N A;  3V9F A;  4Y5R D;  2AGX A;  3RRM C;  2H9P A;  5M5V A;  5TF2 A;  3O4H A;  2P9L C;  4NSX A;  3OW8 A;  5A2Q g;  1FWX A;  3SWS D;  4CI8 A;  4CZV A;  1SHY B;  3I7O A;  1VE7 A;  1OMW B;  3NVX A;  5FLX g;  3P4F A;  1YR2 A;  1YFQ A;  3IUJ A;  4ESG A;  2OJY A; 
#chains in the Genus database with same CATH homology
 2QXV A;  2PM9 A;  2HKM A;  3PSC B;  3EMH A;  4H5I A;  3I7N A;  4E5Z A;  4ES0 A;  3V7D B;  5EMJ B;  5CXC A;  4Z8L A;  3RMZ D;  3UKR C;  2AH0 A;  5FKS A;  4GM8 A;  3EI4 B;  2CE8 A;  2I0T A;  4JT5 C;  4A0A A;  4A7J A;  1R5M A;  4E54 B;  4J79 A;  4U7A A;  5I5M A;  1N6E A;  4ERQ A;  1OLZ A;  1XKS A;  5FQD A;  2HJB A;  3DSM A;  4J86 A;  2UZX B;  3C9C A;  5H1M A;  2B5L A;  3FRX A;  4X60 B;  3VH0 A;  3DM0 A;  1U2V C;  4GM3 A;  1NR0 A;  2H14 A;  2YNP A;  4A11 A;  2Z2O A;  1GP2 B;  3RN0 D;  3FGB A;  3IKO A;  2CE9 A;  3RN1 D;  3VGZ A;  3IIY A;  3J80 g;  2TRC B;  3I7L A;  4TZ4 A;  3SBQ A;  3OL2 A;  5IJ8 E;  3RSE C;  4KFM B;  4L1Q D;  2GC7 A;  2H6K A;  2GC4 A;  2IUV A;  4MK0 B;  4JSN C;  3RFG A;  3CFV A;  2CN2 A;  3MKQ A;  5CYK B;  5FXY A;  1SQJ A;  3OKY B;  4X61 B;  3ORV D;  2AGZ A;  5GMK n;  3CFS B;  3AL9 A;  5TDH B;  4QQE A;  4FAV D;  2H9N A;  1SQ9 A;  3EI2 B;  5SXM A;  3N0E A;  1TBG A;  3DXM C;  1MDA H;  4A08 A;  3HFQ A;  3OL2 B;  2IWK A;  1GXR A;  3B7F A;  3BG1 A;  3EI1 A;  1TYQ C;  2MTA H;  4QRJ A;  4OWR A;  5K19 A;  4X63 B;  4E5Z B;  3PXT D;  2OIZ A;  4CY5 A;  3PSL A;  1JMX B;  1NEX B;  3MZL A;  4CY3 A;  4A0B A;  2IUR A;  3ULE C;  2J55 H;  4O3T B;  5EMM B;  2IAA A;  1QNI A;  1JMZ B;  4E54 A;  3I89 A;  3C99 A;  4BUJ C;  5GSA A;  2P9P C;  4AEZ A;  2CO0 C;  4GQB B;  2AGW A;  2J56 H;  4CI2 A;  4FA5 D;  2G99 A;  2J57 G;  4LGN A;  4X3E A;  4HDJ A;  2H9M A;  2PM6 B;  4J82 A;  5IGO A;  2YMU A;  2HKR A;  3MXX A;  3ZWL B;  4FA4 D;  1PEV A;  1L0Q A;  4ERZ A;  2W18 A;  2PM7 B;  5JWZ A;  2B5N A;  5HYN B;  4G56 B;  3GFC A;  1JJU B;  1RI6 A;  4JD2 C;  4CZX A;  3BG0 A;  4CC9 A;  3JZG A;  5EM2 A;  3NVQ A;  2O9K A;  4ERY A;  4A0A B;  4PSX B;  4JT6 C;  3JZH A;  2XL2 A;  2XYI A;  3SVW D;  1VYH C;  2YBA A;  4L3G D;  2Q7Q A;  5FA5 B;  3IJ1 A;  4IMM A;  4D0K A;  4GQ1 A;  1MG2 A;  5K1C C;  3AH8 B;  2AH1 A;  3UVN A;  5GXI A;  4FHL A;  4O3U B;  1K32 A;  4PNK B;  2H6Q A;  2G9A A;  2H47 A;  2HJ4 A;  4J84 A;  3EU7 A;  3PVU B;  3IIW A;  5HE3 B;  2PBI B;  2B4E A;  4PSW B;  3RFH A;  4PBZ A;  4JSP C;  1XHM A;  2H13 A;  4QL1 A;  3F3P A;  4GZ8 A;  4J78 A;  4PXW A;  2AGL A;  3J81 g;  3DWL C;  2YNO A;  3AL8 B;  3SMR A;  5IJ7 E;  4L3H D;  3C5M A;  4PC0 A;  5B4W A;  3OKY A;  5EAM A;  2H68 A;  1PGU A;  2H3X A;  4ZOZ A;  3EI2 A;  4J87 A;  3I7K A;  3KRX B;  3JAM g;  2Z2N A;  5CXB B;  2QC5 A;  3IJC A;  5TEE A;  4LG8 A;  2AGY A;  5AFU 3;  4Y7R A;  4J0W A;  3SJL D;  4CI3 A;  2P9K C;  2OK6 A;  4H5J A;  5HQG A;  3AFC A;  2OK4 A;  4A09 B;  2IWF A;  2I0R A;  2AQ5 A;  3SXT D;  2HXC A;  3JPX A;  2H9L A;  4BH6 A;  3JRP A;  3K27 A;  3PVW B;  5HE1 B;  4J0X A;  3EWE A;  3L4O D;  5AMS A;  2EBS A;  4A08 B;  5EAL A;  3JZN A;  3U4Y A;  3RLM D;  4A09 A;  3EI4 A;  4JXM A;  4O9D A;  4UI9 R;  4GQ2 P;  3EG6 A;  5EAR A;  4J8G A;  2XU7 A;  4K3J B;  4R7A B;  3F3F A;  3SCY A;  4FB1 D;  2OVQ B;  3IJ0 A;  4GM9 A;  3JB9 L;  4FWW A;  4K3I D;  2OVP B;  3OKT A;  5EM2 B;  3EI1 B;  2I3T A;  4ZOX A;  3N0D A;  2BBK H;  4FA9 D;  1XIP A;  3VA6 A;  3SBP A;  3I8C A;  2Z2P A;  1PBY B;  3NVN A;  3MMY A;  3SN6 B;  1N6D A;  2HYE A;  5EML B;  1PI6 A;  5CYK A;  3I7P A;  2B5M A;  3K26 A;  3EI3 B;  3UVM A;  4J73 A;  5C2V B;  4QT8 A;  2BCJ B;  3JRO A;  3UKU C;  4JSX C;  1K8K C;  2UZY B;  4D6V A;  3E0C A;  5THA A;  4I79 A;  5H14 A;  4OZU A;  5FKQ A;  5HE0 B;  4XEI C;  4XYI A;  2CNX A;  3I8E A;  4A2M A;  3W15 A;  1MG3 A;  4CY2 A;  1S4U X;  4JSV C;  1A0R B;  3C75 H;  4U1E I;  3FM0 A;  1P22 A;  1B9Y A;  5I5J A;  4FA1 D;  2I3S A;  4ZN4 A;  3F3G A;  4LG9 A;  1JOF A;  2IUP A;  1Q47 A;  3PXW D;  3UVL A;  4AOW A;  1ERJ A;  3UVO A;  4BL0 A;  4A0B B;  5EAP A;  4IA9 A;  2YB8 B;  4O45 A;  4CZY A;  5CXB A;  3GRE A;  4ZOY A;  2IUQ A;  4YVD A;  2I0S A;  4N14 A;  2P9S C;  3DXK C;  3SLE D;  4PBY A;  4GGD A;  2CO0 A;  5IC7 A;  3UVK A;  4ZOV A;  1B9X A;  5H17 A;  5AJA A;  2YNN A;  4XYH A;  3ODT A;  3PXS D;  3OKW A;  3A0F A;  2XL3 A;  3SHF A;  3AL8 A;  4J8B A;  5FKT A;  5HE2 B;  4O1Q D;  5C2W B;  2OVR B;  5TEF A;  3MKS B;  5CXC B;  2GNQ A;  4FAN D;  5KDO B;  1U4C A;  4GGA A;  1GOT B;  5GXH A;  4GGC A;  2P9N C;  5IGQ A;  2P9U C;  5IT9 g;  4A11 B;  5C9Z B;  3MZK A;  1N6F A;  3V5W B;  4CI1 A;  2CN3 A;  3I7H A;  3PE7 A;  1GG2 B;  3BWS A;  3OTT A;  4L9O A;  2P9I C;  3EI3 A;  2H6N A;  4J81 A;  4A2L A;  2HES X;  3UR4 A;  3CIK B;  3SFZ A;  2PM9 B;  3SBR A;  5I5I A;  4CY1 A;  4J77 A;  5EMK B;  3KRW B;  3L4M D;  5FKR A;  4EWR A;  3I2N A;  3V9F A;  4Y5R D;  2AGX A;  3RRM C;  2H9P A;  5TF2 A;  2P9L C;  4NSX A;  3OW8 A;  5A2Q g;  1FWX A;  3SWS D;  4CI8 A;  4CZV A;  1SHY B;  3I7O A;  1OMW B;  1YFQ A;  3NVX A;  5FLX g;  3P4F A;  4GMB A;  4ESG A;  2OJY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...