4J87A

Crystal structure of alpha-cop
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
327
structure length
316
Chain Sequence
MAMLTKFESRSSRAKGVAFHPTQPWILTSLHNGRIQLWDYRMGTLLDRFDGHDGPVRGIAFHPTQPIFVSGGDDYKVNVWNYKSRKLLFSLCGHMDYVRVCTFHHEYPWILSCSDDQTIRIWNWQSRNCIAILTGHSHYVMCAAFHPSEDLIVSASLDQTVRVWDISGLRMKNAAPVSMSKEDQKAQAADAIVKFVLEGHDRGVNWCAFHPTLPLILSAGDDRLVKLWRMTASKAWEVDTCRGHFNNVSCCLFHPHQELILSASEDKTIRVWDLNRRTAVQTFRRANDRFWFITVHPKLNLFAAAHDSGVMVFKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Rules for the recognition of dilysine retrieval motifs by coatomer.
pubmed doi rcsb
molecule tags Protein transport
molecule keywords coatomer subunit alpha
total genus 79
structure length 316
sequence length 327
ec nomenclature
pdb deposition date 2013-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4j87A00
3PVWB 2HJ4A 4GM8A 5GSAA 1GP2B 3RFGA 5B4WA 2TRCB 4CY3A 3A0FA 4L3GD 5CXBB 1OMWB 3FM0A 3UKRC 3IKOA 4AOWA 3B7FA 4IMMA 2H6NA 3K26A 5IT9g 4A0BA 1VYHC 2OVQB 4CI2A 2H6QA 4ERYA 3PSLA 4QT8A 4CZXA 5FA5B 2I3TA 4K3JB 3EU7A 2GC7A 4CZVA 2H9MA 3EI2B 2BCJB 3SJLD 3V5WB 4EWRA 4FB1D 3J80g 5FKQA 4JT6C 4QQEA 3C9CA 3CFVA 3SXTD 5EARA 4X63B 5EMKB 4ZOXA 5SXMA 3OKYA 2H9PA 3I7HA 4L9OA 2P9SC 3VGZA 1ERJA 4CI1A 4FA9D 1QNIA 4CZYA 3SBQA 4GQ2P 2HESX 2IWFA 2H47A 2PBIB 1R5MA 5FKRA 4ZOZA 2YNOA 4E5ZB 3K27A 3FGBA 3I89A 4YVDA 4FAND 4E54B 5TF2A 4CY5A 2OIZA 2AGLA 4GQBB 1YFQA 3EG6A 2HXCA 3NVNA 3DSMA 3DWLC 3UVKA 3F3PA 4G56B 4PSXB 2B5MA 2H6KA 4U1EI 3UVMA 5EMLB 2IUQA 4CI8A 3I7LA 3GFCA 3I7PA 3RMZD 5HE0B 4GMBA 5GMKn 3RN1D 1PI6A 5CXBA 3E0CA 4A09B 3UVNA 4J78A 1A0RB 3JPXA 3I7NA 4ZOYA 5CXCB 3JB9L 4PBYA 3AFCA 2XL3A 3SVWD 3SMRA 3AH8B 2CN2A 4J77A 5GXHA 3SLED 4BH6A 3EMHA 3RLMD 4H5IA 4O3TB 1SQ9A 1XKSA 3OL2B 4FWWA 3IIWA 5K19A 4ZOVA 2MTAH 1RI6A 1JMXB 4O1QD 1OLZA 4FAVD 3OKTA 5IJ7E 2OK4A 4D6VA 2PM6B 5HE3B 3OKYB 4A0AB 3FRXA 2J55H 5EAPA 4MK0B 4Z8LA 1JOFA 5EMJB 3PSCB 4JXMA 1PGUA 3I7OA 5TEEA 2YNNA 2XYIA 1U4CA 2P9UC 2G99A 4KFMB 4CY1A 4PNKB 4A09A 3IIYA 4J0WA 4GM3A 3JZGA 3UKUC 4J86A 1SHYB 4ES0A 3N0EA 3I2NA 4PXWA 1B9XA 3C75H 5I5JA 3JAMg 3ULEC 2P9PC 2AGZA 3RFHA 3OW8A 5H17A 4A08A 2YB8B 5C9ZB 4U7AA 4XEIC 5I5IA 3VA6A 2AH0A 3SCYA 5THAA 5HYNB 4CI3A 3KRXB 1FWXA 1K32A 2HKMA 4JD2C 2PM9A 3BG0A 3OKWA 1JJUB 3N0DA 2XL2A 3SFZA 3AL8A 5FLXg 4XYHA 4GGCA 2Z2PA 4A7JA 2CE9A 2H9NA 4ERZA 4ESGA 4JSVC 2O9KA 4J8BA 3SN6B 3RN0D 3EI1B 3RSEC 4X3EA 1MDAH 2H13A 3C99A 2I0RA 2XU7A 5C2VB 3EI2A 4OZUA 1TYQC 4GGDA 2IAAA 4O9DA 5K1CC 5IGQA 5FKSA 2H68A 5IJ8E 2IWKA 2BBKH 5HQGA 4QRJA 4X61B 5TEFA 4LG9A 5CXCA 5IGOA 3PVUB 2UZYB 2B5LA 3V9FA 1NR0A 3AL8B 3UR4A 4FA4D 5C2WB 3KRWB 3MKSB 2OVPB 5JWZA 2P9LC 3EI3B 3EI3A 3V7DB 5TDHB 2AQ5A 5EM2B 3CIKB 2P9KC 5AJAA 2CE8A 4CC9A 3W15A 4A08B 2HKRA 2OVRB 2I0SA 3J81g 1XIPA 4XYIA 3GREA 2I0TA 3JZNA 2PM7B 4J79A 3IJ1A 4J87A 3SWSD 2UZXB 4D0KA 2OJYA 5FKTA 3C5MA 2P9IC 3BG1A 1JMZB 1Q47A 4GZ8A 4TZ4A 2B5NA 4O45A 4QL1A 5EALA 3DM0A 3UVLA 4J0XA 2IUPA 3HFQA 4JSPC 3OL2A 4GM9A 2J56H 4A0AA 1XHMA 5GXIA 5FXYA 3IJ0A 4H5JA 5IC7A 2CO0C 4Y7RA 4CY2A 3MKQA 2YMUA 4A11B 4A2MA 3RRMC 2H3XA 4R7AB 3ZWLB 2AGWA 2W18A 5A2Qg 5I5MA 5FQDA 3JRPA 2B4EA 3ODTA 3DXKC 4HDJA 3MZLA 1K8KC 2Z2OA 4JSNC 2OK6A 4FHLA 1MG2A 4LG8A 3IJCA 3NVQA 1L0QA 4GGAA 1N6EA 4E5ZA 4A0BB 5CYKA 5CYKB 5HE2B 3VH0A 2H9LA 2I3SA 3OTTA 3CFSB 1GOTB 3JZHA 3SBPA 3EI4B 2HYEA 4Y5RD 2HJBA 4J8GA 3MMYA 4BUJC 4O3UB 4PC0A 5H14A 2Q7QA 3EI4A 3UVOA 5EMMB 4E54A 3DXMC 2IURA 3ORVD 4ERQA 3EWEA 1P22A 1MG3A 3P4FA 3AL9A 2GC4A 1SQJA 4I79A 3I8CA 2AH1A 4ZN4A 4L3HD 2CNXA 4X60B 5EM2A 5KDOB 4UI9R 3U4YA 2QXVA 4LGNA 1GXRA 2PM9B 1U2VC 5AMSA 1TBGA 3NVXA 1N6DA 2CN3A 3PXWD 4FA1D 3BWSA 2AGXA 4J73A 4JSXC 3PXSD 5EAMA 1B9YA 2P9NC 2Z2NA 4N14A 2AGYA 4FA5D 4A11A 1PBYB 2J57G 4J84A 4PSWB 3SHFA 2YNPA 4J82A 4A2LA 4L1QD 4OWRA 3I8EA 2G9AA 3SBRA 3PXTD 5H1MA 5HE1B 1NEXB 3EI1A 3I7KA 3MXXA 3L4MD 4IA9A 3MZKA 2CO0A 2QC5A 4JT5C 3PE7A 1GG2B 2IUVA 3L4OD 1PEVA 1S4UX 4GQ1A 3F3GA 5AFU3 2EBSA 4PBZA 2YBAA 4BL0A 4AEZA 2GNQA 4J81A 3JROA 3F3FA 4NSXA 4K3ID 1N6FA 2H14A
chains in the Genus database with same CATH superfamily
3PVWB 2HJ4A 4GM8A 5GSAA 1GP2B 3RFGA 5B4WA 2TRCB 2QR5A 4CY3A 3A0FA 4L3GD 5CXBB 1OMWB 3FM0A 3UKRC 5C86A 3IKOA 4AOWA 3B7FA 4IMMA 2H6NA 3K26A 5IT9g 1T2XA 4A0BA 1VYHC 2OVQB 4CI2A 3NIGA 2H6QA 4ERYA 3PSLA 4QT8A 4CZXA 1M1XA 5FA5B 5M5RA 2I3TA 2VC2A 3EU7A 4K3JB 2GC7A 4CZVA 2H9MA 3EI2B 2BCJB 4JHNA 1GOHA 3SJLD 3V5WB 4EWRA 4FB1D 3J80g 4RE6A 1E8NA 5FKQA 1O6FA 4JT6C 4QQEA 3GD1I 3C9CA 3CFVA 3SXTD 5EARA 4X63B 5EMKB 4G1MA 4O02A 4ZOXA 5SXMA 3OKYA 2H9PA 3I7HA 2VZ3A 3IUMA 4L9OA 2P9SC 3VGZA 1ERJA 3FCSA 4UM8A 4CI1A 4FA9D 1A12A 1QNIA 4CZYA 3IURA 3SBQA 1O6GA 4GQ2P 2HESX 2IWFA 2VDMA 2H47A 2XE4A 2PBIB 1R5MA 5FKRA 4ZOZA 4BCBA 4DNUA 2YNOA 4E5ZB 3K27A 3FGBA 3I89A 4YVDA 4AN1A 4AMZA 4FAND 1TYEA 4E54B 5TF2A 4WK2A 3IUNA 2QZPA 1QFMA 4CY5A 2OIZA 3ZDZA 2AGLA 4GQBB 1YFQA 3EG6A 2HXCA 3NVNA 3EQ8A 3ZDYA 1H2YA 3DSMA 3DWLC 3UVKA 2VDQA 3F3PA 4G56B 4PSXB 2B5MA 2H6KA 2EIEA 4U1EI 3UVMA 4AX4A 5EMLB 2IUQA 3ZE0A 4CI8A 3I7LA 3GFCA 3I7PA 3RMZD 5HE0B 4GMBA 5GMKn 3RN1D 1PI6A 5CXBA 3E0CA 4BP8A 1JV2A 4A09B 3UVNA 4J78A 3JPXA 1A0RB 3I7NA 4ZOYA 5CXCB 3JB9L 4PBYA 3AFCA 2XL3A 3SVWD 4JHPC 3SMRA 3AH8B 2CN2A 4J77A 5GXHA 3SLED 4Z7OA 4BH6A 3EMHA 3RLMD 4H5IA 4O3TB 1SQ9A 1XKSA 3OL2B 4FWWA 5E6SA 3IIWA 5K19A 4ZOVA 2MTAH 1RI6A 4MMYA 1JMXB 4O1QD 1OLZA 4UM9A 3OKTA 4FAVD 5IJ7E 4BCCA 2OK4A 4D6VA 2PM6B 5HE3B 3OKYB 4A0AB 3FRXA 2J55H 5EAPA 2VDKA 4MK0B 3KCIA 4Z8LA 1JOFA 5EMJB 3PSCB 4JXMA 1PGUA 3I7OA 5FFOA 5TEEA 2YNNA 3O4IA 3QI0A 2XYIA 1U4CA 3IULA 2P9UC 3OF7A 2XZGA 2G99A 4KFMB 4CY1A 1U8CA 4PNKB 4A09A 3IIYA 4J0WA 4GM3A 3JZGA 3UKUC 4J86A 1SHYB 4ES0A 3N0EA 3I2NA 4PXWA 1B9XA 3C75H 5I5JA 3JAMg 1H2XA 3ULEC 2P9PC 3QHYB 1H2ZA 2AGZA 3RFHA 3OW8A 5H17A 4A08A 2YB8B 5C9ZB 4U7AA 1UOQA 4XEIC 3EQ9A 5I5IA 3VA6A 3NIFA 1GOFA 2AH0A 3ZE1A 3SCYA 5M5UA 5THAA 5HYNB 4CI3A 2VDNA 3KRXB 1FWXA 1K32A 2HKMA 4JD2C 2PM9A 3BG0A 3OKWA 1JJUB 2EICA 3N0DA 2XL2A 3SFZA 3AL8A 5FLXg 3O4JA 4XYHA 4GGCA 2Z2PA 4A7JA 2CE9A 2H9NA 4ERZA 4ESGA 4DNVA 4JSVC 2O9KA 1UTCA 4J8BA 3SN6B 3MVDK 1C9LA 3RN0D 3EI1B 3RSEC 4X3EA 1MDAH 2H13A 3C99A 2I0RA 2XU7A 5C2VB 3EI2A 4OZUA 4NAAA 1TYQC 1K3IA 4GGDA 2IAAA 4O9DA 5K1CC 5IGQA 5FKSA 2H68A 5IJ8E 2IWKA 2BBKH 5HQGA 4QRJA 4X61B 3K6SA 5TEFA 4LG9A 3K72A 2EIDA 3ZE2A 5CXCA 5IGOA 3PVUB 2UZYB 3IVMA 2B5LA 1UOOA 3V9FA 1NR0A 2XDWA 3AL8B 3UR4A 4FA4D 5C2WB 3KRWB 3MKSB 4BP9A 2OVPB 5JWZA 2P9LC 1UOPA 3EI3B 3EI3A 4AMYA 3V7DB 5TDHB 2AQ5A 5EM2B 4G1EA 3CIKB 2P9KC 5AJAA 2CE8A 4MMXA 4CC9A 4WK0A 3W15A 2HKRA 4A08B 2OVRB 2I0SA 3J81g 2VZ1A 1XIPA 4NENA 4XYIA 3GREA 5FFGA 2I0TA 3GC3B 3JZNA 2PM7B 4J79A 3IJ1A 4J87A 2VDPA 1H2WA 3SWSD 2UZXB 4D0KA 3VI4A 2OJYA 5FKTA 3C5MA 2P9IC 3BG1A 1JMZB 1Q47A 4GZ8A 4TZ4A 5E6UA 2B5NA 4O45A 4QL1A 5EALA 3DM0A 3UVLA 4J0XA 5M5TA 2IUPA 3HFQA 4JSPC 4Z7NA 3OL2A 4GM9A 2J56H 4A0AA 1XHMA 5GXIA 5FXYA 3NIDA 4QAMA 3ZDXA 3IJ0A 4H5JA 5IC7A 2CO0C 4Y7RA 4CY2A 3IUJA 4L1MA 3MKQA 2YMUA 4A11B 4A2MA 2VDOA 3RRMC 1JTDB 2H3XA 4R7AB 3ZWLB 2AGWA 1VE6A 2W18A 3T3MA 5A2Qg 5I5MA 5FQDA 4AN0A 3JRPA 2B4EA 3ODTA 3DXKC 3EQ7A 4HDJA 3MZLA 1K8KC 2Z2OA 4JSNC 2OK6A 4FHLA 1MG2A 4LG8A 3IJCA 3NVQA 1L0QA 4GGAA 1N6EA 4E5ZA 1BPOA 3IUQA 4A0BB 5CYKA 5CYKB 5HE2B 3VH0A 2VDLA 2H9LA 2I3SA 3OTTA 3CFSB 1GOTB 3JZHA 3SBPA 3EI4B 2HYEA 3V4PA 4Y5RD 2HJBA 4J8GA 3MUOA 3K71A 4WJKA 3MMYA 4BUJC 4O3UB 4PC0A 5H14A 4WK4A 2Q7QA 3EI4A 3UVOA 5EMMB 4E54A 3DXMC 2IURA 3ORVD 2HU8A 4ERQA 3EWEA 3VI3A 1P22A 1YR2A 1MG3A 3P4FA 3AL9A 2GC4A 1SQJA 4I79A 3I8CA 2AH1A 4ZN4A 4L3HD 5E6RA 2JKXA 1GOGA 1E8MA 2CNXA 3V4VA 1QFSA 4X60B 5EM2A 5KDOB 4UI9R 3U4YA 2QXVA 4G55A 4LGNA 3T3PA 1GXRA 2PM9B 1U2VC 5AMSA 1TBGA 3NVXA 4NBMA 1N6DA 2CN3A 3PXWD 2HU7A 4FA1D 3BWSA 2AGXA 4J73A 4JSXC 3PXSD 5EAMA 1B9YA 2P9NC 2Z2NA 4N14A 2AGYA 4FA5D 4A11A 1PBYB 5M5SA 3DDUA 1VZ2A 4DNWA 5HDBA 2J57G 4BCDA 2BKLA 4J84A 4PSWB 3SHFA 2YNPA 4J82A 2WQ8A 4A2LA 4L1QD 3IJEA 4OWRA 3I8EA 2G9AA 3SBRA 2EIBA 1E5TA 4O2WA 4IRZA 3O4HA 3PXTD 5H1MA 5M5VA 5HE1B 4NC4A 1NEXB 3EI1A 3I7KA 3MXXA 3L4MD 2HU5A 4IA9A 3MZKA 2CO0A 2QC5A 4JT5C 1C9IA 3PE7A 3O4GA 4D9SA 1VE7A 1GG2B 2IUVA 4Z7QA 3L4OD 1PEVA 1S4UX 1L5GA 5C92A 4GQ1A 3F3GA 5AFU3 2EBSA 4PBZA 2YBAA 1VZ3A 4BL0A 4AEZA 2GNQA 4J81A 3JROA 1I2MB 3MUNA 3F3FA 3FCUA 4NSXA 5M61A 4K3ID 4RE5A 2VDRA 1N6FA 4MMZA 2H14A
chains in the Genus database with same CATH topology
3PVWB 2HJ4A 4GM8A 5GSAA 1GP2B 3RFGA 5B4WA 2TRCB 4CY3A 3A0FA 4L3GD 5CXBB 1OMWB 3FM0A 3UKRC 3IKOA 4AOWA 3B7FA 4IMMA 2H6NA 3K26A 5IT9g 4A0BA 1VYHC 2OVQB 4CI2A 2H6QA 4ERYA 3PSLA 4QT8A 4CZXA 5FA5B 2I3TA 4K3JB 3EU7A 2GC7A 4CZVA 2H9MA 3EI2B 2BCJB 3SJLD 3V5WB 4EWRA 4FB1D 3J80g 5FKQA 4JT6C 4QQEA 3C9CA 3CFVA 3SXTD 5EARA 4X63B 5EMKB 4ZOXA 5SXMA 3OKYA 2H9PA 3I7HA 4L9OA 2P9SC 3VGZA 1ERJA 4CI1A 4FA9D 1QNIA 4CZYA 3SBQA 4GQ2P 2HESX 2IWFA 2H47A 2PBIB 1R5MA 5FKRA 4ZOZA 2YNOA 4E5ZB 3K27A 3FGBA 3I89A 4YVDA 4FAND 4E54B 5TF2A 4CY5A 2OIZA 2AGLA 4GQBB 1YFQA 3EG6A 2HXCA 3NVNA 3DSMA 3DWLC 3UVKA 3F3PA 4G56B 4PSXB 2B5MA 2H6KA 4U1EI 3UVMA 5EMLB 2IUQA 4CI8A 3I7LA 3GFCA 3I7PA 3RMZD 5HE0B 4GMBA 5GMKn 3RN1D 1PI6A 5CXBA 3E0CA 4A09B 3UVNA 4J78A 1A0RB 3JPXA 3I7NA 4ZOYA 5CXCB 3JB9L 4PBYA 3AFCA 2XL3A 3SVWD 3SMRA 3AH8B 2CN2A 4J77A 5GXHA 3SLED 4BH6A 3EMHA 3RLMD 4H5IA 4O3TB 1SQ9A 1XKSA 3OL2B 4FWWA 3IIWA 5K19A 4ZOVA 2MTAH 1RI6A 1JMXB 4O1QD 1OLZA 4FAVD 3OKTA 5IJ7E 2OK4A 4D6VA 2PM6B 5HE3B 3OKYB 4A0AB 3FRXA 2J55H 5EAPA 4MK0B 4Z8LA 1JOFA 5EMJB 3PSCB 4JXMA 1PGUA 3I7OA 5TEEA 2YNNA 2XYIA 1U4CA 2P9UC 2G99A 4KFMB 4CY1A 4PNKB 4A09A 3IIYA 4J0WA 4GM3A 3JZGA 3UKUC 4J86A 1SHYB 4ES0A 3N0EA 3I2NA 4PXWA 1B9XA 3C75H 5I5JA 3JAMg 3ULEC 2P9PC 2AGZA 3RFHA 3OW8A 5H17A 4A08A 2YB8B 5C9ZB 4U7AA 4XEIC 5I5IA 3VA6A 2AH0A 3SCYA 5THAA 5HYNB 4CI3A 3KRXB 1FWXA 1K32A 2HKMA 4JD2C 2PM9A 3BG0A 3OKWA 1JJUB 3N0DA 2XL2A 3SFZA 3AL8A 5FLXg 4XYHA 4GGCA 2Z2PA 4A7JA 2CE9A 2H9NA 4ERZA 4ESGA 4JSVC 2O9KA 4J8BA 3SN6B 3RN0D 3EI1B 3RSEC 4X3EA 1MDAH 2H13A 3C99A 2I0RA 2XU7A 5C2VB 3EI2A 4OZUA 1TYQC 4GGDA 2IAAA 4O9DA 5K1CC 5IGQA 5FKSA 2H68A 5IJ8E 2IWKA 2BBKH 5HQGA 4QRJA 4X61B 5TEFA 4LG9A 5CXCA 5IGOA 3PVUB 2UZYB 2B5LA 3V9FA 1NR0A 3AL8B 3UR4A 4FA4D 5C2WB 3KRWB 3MKSB 2OVPB 5JWZA 2P9LC 3EI3B 3EI3A 3V7DB 5TDHB 2AQ5A 5EM2B 3CIKB 2P9KC 5AJAA 2CE8A 4CC9A 3W15A 4A08B 2HKRA 2OVRB 2I0SA 3J81g 1XIPA 4XYIA 3GREA 2I0TA 3JZNA 2PM7B 4J79A 3IJ1A 4J87A 3SWSD 2UZXB 4D0KA 2OJYA 5FKTA 3C5MA 2P9IC 3BG1A 1JMZB 1Q47A 4GZ8A 4TZ4A 2B5NA 4O45A 4QL1A 5EALA 3DM0A 3UVLA 4J0XA 2IUPA 3HFQA 4JSPC 3OL2A 4GM9A 2J56H 4A0AA 1XHMA 5GXIA 5FXYA 3IJ0A 4H5JA 5IC7A 2CO0C 4Y7RA 4CY2A 3MKQA 2YMUA 4A11B 4A2MA 3RRMC 2H3XA 4R7AB 3ZWLB 2AGWA 2W18A 5A2Qg 5I5MA 5FQDA 3JRPA 2B4EA 3ODTA 3DXKC 4HDJA 3MZLA 1K8KC 2Z2OA 4JSNC 2OK6A 4FHLA 1MG2A 4LG8A 3IJCA 3NVQA 1L0QA 4GGAA 1N6EA 4E5ZA 4A0BB 5CYKA 5CYKB 5HE2B 3VH0A 2H9LA 2I3SA 3OTTA 3CFSB 1GOTB 3JZHA 3SBPA 3EI4B 2HYEA 4Y5RD 2HJBA 4J8GA 3MMYA 4BUJC 4O3UB 4PC0A 5H14A 2Q7QA 3EI4A 3UVOA 5EMMB 4E54A 3DXMC 2IURA 3ORVD 4ERQA 3EWEA 1P22A 1MG3A 3P4FA 3AL9A 2GC4A 1SQJA 4I79A 3I8CA 2AH1A 4ZN4A 4L3HD 2CNXA 4X60B 5EM2A 5KDOB 4UI9R 3U4YA 2QXVA 4LGNA 1GXRA 2PM9B 1U2VC 5AMSA 1TBGA 3NVXA 1N6DA 2CN3A 3PXWD 4FA1D 3BWSA 2AGXA 4J73A 4JSXC 3PXSD 5EAMA 1B9YA 2P9NC 2Z2NA 4N14A 2AGYA 4FA5D 4A11A 1PBYB 2J57G 4J84A 4PSWB 3SHFA 2YNPA 4J82A 4A2LA 4L1QD 4OWRA 3I8EA 2G9AA 3SBRA 3PXTD 5H1MA 5HE1B 1NEXB 3EI1A 3I7KA 3MXXA 3L4MD 4IA9A 3MZKA 2CO0A 2QC5A 4JT5C 3PE7A 1GG2B 2IUVA 3L4OD 1PEVA 1S4UX 4GQ1A 3F3GA 5AFU3 2EBSA 4PBZA 2YBAA 4BL0A 4AEZA 2GNQA 4J81A 3JROA 3F3FA 4NSXA 4K3ID 1N6FA 2H14A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PVW B;  2HJ4 A;  4GM8 A;  5GSA A;  1GP2 B;  3RFG A;  5B4W A;  2TRC B;  4CY3 A;  3A0F A;  4L3G D;  5CXB B;  1OMW B;  3FM0 A;  3UKR C;  3IKO A;  4AOW A;  3B7F A;  4IMM A;  2H6N A;  3K26 A;  5IT9 g;  4A0B A;  1VYH C;  2OVQ B;  4CI2 A;  2H6Q A;  4ERY A;  3PSL A;  4QT8 A;  4CZX A;  5FA5 B;  2I3T A;  4K3J B;  3EU7 A;  2GC7 A;  4CZV A;  2H9M A;  3EI2 B;  2BCJ B;  3SJL D;  3V5W B;  4EWR A;  4FB1 D;  3J80 g;  5FKQ A;  4JT6 C;  4QQE A;  3C9C A;  3CFV A;  3SXT D;  5EAR A;  4X63 B;  5EMK B;  4ZOX A;  5SXM A;  3OKY A;  2H9P A;  3I7H A;  4L9O A;  2P9S C;  3VGZ A;  1ERJ A;  4CI1 A;  4FA9 D;  1QNI A;  4CZY A;  3SBQ A;  4GQ2 P;  2HES X;  2IWF A;  2H47 A;  2PBI B;  1R5M A;  5FKR A;  4ZOZ A;  2YNO A;  4E5Z B;  3K27 A;  3FGB A;  3I89 A;  4YVD A;  4FAN D;  4E54 B;  5TF2 A;  4CY5 A;  2OIZ A;  2AGL A;  4GQB B;  1YFQ A;  3EG6 A;  2HXC A;  3NVN A;  3DSM A;  3DWL C;  3UVK A;  3F3P A;  4G56 B;  4PSX B;  2B5M A;  2H6K A;  4U1E I;  3UVM A;  5EML B;  2IUQ A;  4CI8 A;  3I7L A;  3GFC A;  3I7P A;  3RMZ D;  5HE0 B;  4GMB A;  5GMK n;  3RN1 D;  1PI6 A;  5CXB A;  3E0C A;  4A09 B;  3UVN A;  4J78 A;  1A0R B;  3JPX A;  3I7N A;  4ZOY A;  5CXC B;  3JB9 L;  4PBY A;  3AFC A;  2XL3 A;  3SVW D;  3SMR A;  3AH8 B;  2CN2 A;  4J77 A;  5GXH A;  3SLE D;  4BH6 A;  3EMH A;  3RLM D;  4H5I A;  4O3T B;  1SQ9 A;  1XKS A;  3OL2 B;  4FWW A;  3IIW A;  5K19 A;  4ZOV A;  2MTA H;  1RI6 A;  1JMX B;  4O1Q D;  1OLZ A;  4FAV D;  3OKT A;  5IJ7 E;  2OK4 A;  4D6V A;  2PM6 B;  5HE3 B;  3OKY B;  4A0A B;  3FRX A;  2J55 H;  5EAP A;  4MK0 B;  4Z8L A;  1JOF A;  5EMJ B;  3PSC B;  4JXM A;  1PGU A;  3I7O A;  5TEE A;  2YNN A;  2XYI A;  1U4C A;  2P9U C;  2G99 A;  4KFM B;  4CY1 A;  4PNK B;  4A09 A;  3IIY A;  4J0W A;  4GM3 A;  3JZG A;  3UKU C;  4J86 A;  1SHY B;  4ES0 A;  3N0E A;  3I2N A;  4PXW A;  1B9X A;  3C75 H;  5I5J A;  3JAM g;  3ULE C;  2P9P C;  2AGZ A;  3RFH A;  3OW8 A;  5H17 A;  4A08 A;  2YB8 B;  5C9Z B;  4U7A A;  4XEI C;  5I5I A;  3VA6 A;  2AH0 A;  3SCY A;  5THA A;  5HYN B;  4CI3 A;  3KRX B;  1FWX A;  1K32 A;  2HKM A;  4JD2 C;  2PM9 A;  3BG0 A;  3OKW A;  1JJU B;  3N0D A;  2XL2 A;  3SFZ A;  3AL8 A;  5FLX g;  4XYH A;  4GGC A;  2Z2P A;  4A7J A;  2CE9 A;  2H9N A;  4ERZ A;  4ESG A;  4JSV C;  2O9K A;  4J8B A;  3SN6 B;  3RN0 D;  3EI1 B;  3RSE C;  4X3E A;  1MDA H;  2H13 A;  3C99 A;  2I0R A;  2XU7 A;  5C2V B;  3EI2 A;  4OZU A;  1TYQ C;  4GGD A;  2IAA A;  4O9D A;  5K1C C;  5IGQ A;  5FKS A;  2H68 A;  5IJ8 E;  2IWK A;  2BBK H;  5HQG A;  4QRJ A;  4X61 B;  5TEF A;  4LG9 A;  5CXC A;  5IGO A;  3PVU B;  2UZY B;  2B5L A;  3V9F A;  1NR0 A;  3AL8 B;  3UR4 A;  4FA4 D;  5C2W B;  3KRW B;  3MKS B;  2OVP B;  5JWZ A;  2P9L C;  3EI3 B;  3EI3 A;  3V7D B;  5TDH B;  2AQ5 A;  5EM2 B;  3CIK B;  2P9K C;  5AJA A;  2CE8 A;  4CC9 A;  3W15 A;  4A08 B;  2HKR A;  2OVR B;  2I0S A;  3J81 g;  1XIP A;  4XYI A;  3GRE A;  2I0T A;  3JZN A;  2PM7 B;  4J79 A;  3IJ1 A;  4J87 A;  3SWS D;  2UZX B;  4D0K A;  2OJY A;  5FKT A;  3C5M A;  2P9I C;  3BG1 A;  1JMZ B;  1Q47 A;  4GZ8 A;  4TZ4 A;  2B5N A;  4O45 A;  4QL1 A;  5EAL A;  3DM0 A;  3UVL A;  4J0X A;  2IUP A;  3HFQ A;  4JSP C;  3OL2 A;  4GM9 A;  2J56 H;  4A0A A;  1XHM A;  5GXI A;  5FXY A;  3IJ0 A;  4H5J A;  5IC7 A;  2CO0 C;  4Y7R A;  4CY2 A;  3MKQ A;  2YMU A;  4A11 B;  4A2M A;  3RRM C;  2H3X A;  4R7A B;  3ZWL B;  2AGW A;  2W18 A;  5A2Q g;  5I5M A;  5FQD A;  3JRP A;  2B4E A;  3ODT A;  3DXK C;  4HDJ A;  3MZL A;  1K8K C;  2Z2O A;  4JSN C;  2OK6 A;  4FHL A;  1MG2 A;  4LG8 A;  3IJC A;  3NVQ A;  1L0Q A;  4GGA A;  1N6E A;  4E5Z A;  4A0B B;  5CYK A;  5CYK B;  5HE2 B;  3VH0 A;  2H9L A;  2I3S A;  3OTT A;  3CFS B;  1GOT B;  3JZH A;  3SBP A;  3EI4 B;  2HYE A;  4Y5R D;  2HJB A;  4J8G A;  3MMY A;  4BUJ C;  4O3U B;  4PC0 A;  5H14 A;  2Q7Q A;  3EI4 A;  3UVO A;  5EMM B;  4E54 A;  3DXM C;  2IUR A;  3ORV D;  4ERQ A;  3EWE A;  1P22 A;  1MG3 A;  3P4F A;  3AL9 A;  2GC4 A;  1SQJ A;  4I79 A;  3I8C A;  2AH1 A;  4ZN4 A;  4L3H D;  2CNX A;  4X60 B;  5EM2 A;  5KDO B;  4UI9 R;  3U4Y A;  2QXV A;  4LGN A;  1GXR A;  2PM9 B;  1U2V C;  5AMS A;  1TBG A;  3NVX A;  1N6D A;  2CN3 A;  3PXW D;  4FA1 D;  3BWS A;  2AGX A;  4J73 A;  4JSX C;  3PXS D;  5EAM A;  1B9Y A;  2P9N C;  2Z2N A;  4N14 A;  2AGY A;  4FA5 D;  4A11 A;  1PBY B;  2J57 G;  4J84 A;  4PSW B;  3SHF A;  2YNP A;  4J82 A;  4A2L A;  4L1Q D;  4OWR A;  3I8E A;  2G9A A;  3SBR A;  3PXT D;  5H1M A;  5HE1 B;  1NEX B;  3EI1 A;  3I7K A;  3MXX A;  3L4M D;  4IA9 A;  3MZK A;  2CO0 A;  2QC5 A;  4JT5 C;  3PE7 A;  1GG2 B;  2IUV A;  3L4O D;  1PEV A;  1S4U X;  4GQ1 A;  3F3G A;  5AFU 3;  2EBS A;  4PBZ A;  2YBA A;  4BL0 A;  4AEZ A;  2GNQ A;  4J81 A;  3JRO A;  3F3F A;  4NSX A;  4K3I D;  1N6F A;  2H14 A; 
#chains in the Genus database with same CATH topology
 3PVW B;  2HJ4 A;  4GM8 A;  5GSA A;  1GP2 B;  3RFG A;  5B4W A;  2TRC B;  2QR5 A;  4CY3 A;  3A0F A;  4L3G D;  5CXB B;  1OMW B;  3FM0 A;  3UKR C;  5C86 A;  3IKO A;  4AOW A;  3B7F A;  4IMM A;  2H6N A;  3K26 A;  5IT9 g;  1T2X A;  4A0B A;  1VYH C;  2OVQ B;  4CI2 A;  3NIG A;  2H6Q A;  4ERY A;  3PSL A;  4QT8 A;  4CZX A;  1M1X A;  5FA5 B;  5M5R A;  2I3T A;  2VC2 A;  3EU7 A;  4K3J B;  2GC7 A;  4CZV A;  2H9M A;  3EI2 B;  2BCJ B;  4JHN A;  1GOH A;  3SJL D;  3V5W B;  4EWR A;  4FB1 D;  3J80 g;  4RE6 A;  1E8N A;  5FKQ A;  1O6F A;  4JT6 C;  4QQE A;  3GD1 I;  3C9C A;  3CFV A;  3SXT D;  5EAR A;  4X63 B;  5EMK B;  4G1M A;  4O02 A;  4ZOX A;  5SXM A;  3OKY A;  2H9P A;  3I7H A;  2VZ3 A;  3IUM A;  4L9O A;  2P9S C;  3VGZ A;  1ERJ A;  3FCS A;  4UM8 A;  4CI1 A;  4FA9 D;  1A12 A;  1QNI A;  4CZY A;  3IUR A;  3SBQ A;  1O6G A;  4GQ2 P;  2HES X;  2IWF A;  2VDM A;  2H47 A;  2XE4 A;  2PBI B;  1R5M A;  5FKR A;  4ZOZ A;  4BCB A;  4DNU A;  2YNO A;  4E5Z B;  3K27 A;  3FGB A;  3I89 A;  4YVD A;  4AN1 A;  4AMZ A;  4FAN D;  1TYE A;  4E54 B;  5TF2 A;  4WK2 A;  3IUN A;  2QZP A;  1QFM A;  4CY5 A;  2OIZ A;  3ZDZ A;  2AGL A;  4GQB B;  1YFQ A;  3EG6 A;  2HXC A;  3NVN A;  3EQ8 A;  3ZDY A;  1H2Y A;  3DSM A;  3DWL C;  3UVK A;  2VDQ A;  3F3P A;  4G56 B;  4PSX B;  2B5M A;  2H6K A;  2EIE A;  4U1E I;  3UVM A;  4AX4 A;  5EML B;  2IUQ A;  3ZE0 A;  4CI8 A;  3I7L A;  3GFC A;  3I7P A;  3RMZ D;  5HE0 B;  4GMB A;  5GMK n;  3RN1 D;  1PI6 A;  5CXB A;  3E0C A;  4BP8 A;  1JV2 A;  4A09 B;  3UVN A;  4J78 A;  3JPX A;  1A0R B;  3I7N A;  4ZOY A;  5CXC B;  3JB9 L;  4PBY A;  3AFC A;  2XL3 A;  3SVW D;  4JHP C;  3SMR A;  3AH8 B;  2CN2 A;  4J77 A;  5GXH A;  3SLE D;  4Z7O A;  4BH6 A;  3EMH A;  3RLM D;  4H5I A;  4O3T B;  1SQ9 A;  1XKS A;  3OL2 B;  4FWW A;  5E6S A;  3IIW A;  5K19 A;  4ZOV A;  2MTA H;  1RI6 A;  4MMY A;  1JMX B;  4O1Q D;  1OLZ A;  4UM9 A;  3OKT A;  4FAV D;  5IJ7 E;  4BCC A;  2OK4 A;  4D6V A;  2PM6 B;  5HE3 B;  3OKY B;  4A0A B;  3FRX A;  2J55 H;  5EAP A;  2VDK A;  4MK0 B;  3KCI A;  4Z8L A;  1JOF A;  5EMJ B;  3PSC B;  4JXM A;  1PGU A;  3I7O A;  5FFO A;  5TEE A;  2YNN A;  3O4I A;  3QI0 A;  2XYI A;  1U4C A;  3IUL A;  2P9U C;  3OF7 A;  2XZG A;  2G99 A;  4KFM B;  4CY1 A;  1U8C A;  4PNK B;  4A09 A;  3IIY A;  4J0W A;  4GM3 A;  3JZG A;  3UKU C;  4J86 A;  1SHY B;  4ES0 A;  3N0E A;  3I2N A;  4PXW A;  1B9X A;  3C75 H;  5I5J A;  3JAM g;  1H2X A;  3ULE C;  2P9P C;  3QHY B;  1H2Z A;  2AGZ A;  3RFH A;  3OW8 A;  5H17 A;  4A08 A;  2YB8 B;  5C9Z B;  4U7A A;  1UOQ A;  4XEI C;  3EQ9 A;  5I5I A;  3VA6 A;  3NIF A;  1GOF A;  2AH0 A;  3ZE1 A;  3SCY A;  5M5U A;  5THA A;  5HYN B;  4CI3 A;  2VDN A;  3KRX B;  1FWX A;  1K32 A;  2HKM A;  4JD2 C;  2PM9 A;  3BG0 A;  3OKW A;  1JJU B;  2EIC A;  3N0D A;  2XL2 A;  3SFZ A;  3AL8 A;  5FLX g;  3O4J A;  4XYH A;  4GGC A;  2Z2P A;  4A7J A;  2CE9 A;  2H9N A;  4ERZ A;  4ESG A;  4DNV A;  4JSV C;  2O9K A;  1UTC A;  4J8B A;  3SN6 B;  3MVD K;  1C9L A;  3RN0 D;  3EI1 B;  3RSE C;  4X3E A;  1MDA H;  2H13 A;  3C99 A;  2I0R A;  2XU7 A;  5C2V B;  3EI2 A;  4OZU A;  4NAA A;  1TYQ C;  1K3I A;  4GGD A;  2IAA A;  4O9D A;  5K1C C;  5IGQ A;  5FKS A;  2H68 A;  5IJ8 E;  2IWK A;  2BBK H;  5HQG A;  4QRJ A;  4X61 B;  3K6S A;  5TEF A;  4LG9 A;  3K72 A;  2EID A;  3ZE2 A;  5CXC A;  5IGO A;  3PVU B;  2UZY B;  3IVM A;  2B5L A;  1UOO A;  3V9F A;  1NR0 A;  2XDW A;  3AL8 B;  3UR4 A;  4FA4 D;  5C2W B;  3KRW B;  3MKS B;  4BP9 A;  2OVP B;  5JWZ A;  2P9L C;  1UOP A;  3EI3 B;  3EI3 A;  4AMY A;  3V7D B;  5TDH B;  2AQ5 A;  5EM2 B;  4G1E A;  3CIK B;  2P9K C;  5AJA A;  2CE8 A;  4MMX A;  4CC9 A;  4WK0 A;  3W15 A;  2HKR A;  4A08 B;  2OVR B;  2I0S A;  3J81 g;  2VZ1 A;  1XIP A;  4NEN A;  4XYI A;  3GRE A;  5FFG A;  2I0T A;  3GC3 B;  3JZN A;  2PM7 B;  4J79 A;  3IJ1 A;  4J87 A;  2VDP A;  1H2W A;  3SWS D;  2UZX B;  4D0K A;  3VI4 A;  2OJY A;  5FKT A;  3C5M A;  2P9I C;  3BG1 A;  1JMZ B;  1Q47 A;  4GZ8 A;  4TZ4 A;  5E6U A;  2B5N A;  4O45 A;  4QL1 A;  5EAL A;  3DM0 A;  3UVL A;  4J0X A;  5M5T A;  2IUP A;  3HFQ A;  4JSP C;  4Z7N A;  3OL2 A;  4GM9 A;  2J56 H;  4A0A A;  1XHM A;  5GXI A;  5FXY A;  3NID A;  4QAM A;  3ZDX A;  3IJ0 A;  4H5J A;  5IC7 A;  2CO0 C;  4Y7R A;  4CY2 A;  3IUJ A;  4L1M A;  3MKQ A;  2YMU A;  4A11 B;  4A2M A;  2VDO A;  3RRM C;  1JTD B;  2H3X A;  4R7A B;  3ZWL B;  2AGW A;  1VE6 A;  2W18 A;  3T3M A;  5A2Q g;  5I5M A;  5FQD A;  4AN0 A;  3JRP A;  2B4E A;  3ODT A;  3DXK C;  3EQ7 A;  4HDJ A;  3MZL A;  1K8K C;  2Z2O A;  4JSN C;  2OK6 A;  4FHL A;  1MG2 A;  4LG8 A;  3IJC A;  3NVQ A;  1L0Q A;  4GGA A;  1N6E A;  4E5Z A;  1BPO A;  3IUQ A;  4A0B B;  5CYK A;  5CYK B;  5HE2 B;  3VH0 A;  2VDL A;  2H9L A;  2I3S A;  3OTT A;  3CFS B;  1GOT B;  3JZH A;  3SBP A;  3EI4 B;  2HYE A;  3V4P A;  4Y5R D;  2HJB A;  4J8G A;  3MUO A;  3K71 A;  4WJK A;  3MMY A;  4BUJ C;  4O3U B;  4PC0 A;  5H14 A;  4WK4 A;  2Q7Q A;  3EI4 A;  3UVO A;  5EMM B;  4E54 A;  3DXM C;  2IUR A;  3ORV D;  2HU8 A;  4ERQ A;  3EWE A;  3VI3 A;  1P22 A;  1YR2 A;  1MG3 A;  3P4F A;  3AL9 A;  2GC4 A;  1SQJ A;  4I79 A;  3I8C A;  2AH1 A;  4ZN4 A;  4L3H D;  5E6R A;  2JKX A;  1GOG A;  1E8M A;  2CNX A;  3V4V A;  1QFS A;  4X60 B;  5EM2 A;  5KDO B;  4UI9 R;  3U4Y A;  2QXV A;  4G55 A;  4LGN A;  3T3P A;  1GXR A;  2PM9 B;  1U2V C;  5AMS A;  1TBG A;  3NVX A;  4NBM A;  1N6D A;  2CN3 A;  3PXW D;  2HU7 A;  4FA1 D;  3BWS A;  2AGX A;  4J73 A;  4JSX C;  3PXS D;  5EAM A;  1B9Y A;  2P9N C;  2Z2N A;  4N14 A;  2AGY A;  4FA5 D;  4A11 A;  1PBY B;  5M5S A;  3DDU A;  1VZ2 A;  4DNW A;  5HDB A;  2J57 G;  4BCD A;  2BKL A;  4J84 A;  4PSW B;  3SHF A;  2YNP A;  4J82 A;  2WQ8 A;  4A2L A;  4L1Q D;  3IJE A;  4OWR A;  3I8E A;  2G9A A;  3SBR A;  2EIB A;  1E5T A;  4O2W A;  4IRZ A;  3O4H A;  3PXT D;  5H1M A;  5M5V A;  5HE1 B;  4NC4 A;  1NEX B;  3EI1 A;  3I7K A;  3MXX A;  3L4M D;  2HU5 A;  4IA9 A;  3MZK A;  2CO0 A;  2QC5 A;  4JT5 C;  1C9I A;  3PE7 A;  3O4G A;  4D9S A;  1VE7 A;  1GG2 B;  2IUV A;  4Z7Q A;  3L4O D;  1PEV A;  1S4U X;  1L5G A;  5C92 A;  4GQ1 A;  3F3G A;  5AFU 3;  2EBS A;  4PBZ A;  2YBA A;  1VZ3 A;  4BL0 A;  4AEZ A;  2GNQ A;  4J81 A;  3JRO A;  1I2M B;  3MUN A;  3F3F A;  3FCU A;  4NSX A;  5M61 A;  4K3I D;  4RE5 A;  2VDR A;  1N6F A;  4MMZ A;  2H14 A; 
#chains in the Genus database with same CATH homology
 3PVW B;  2HJ4 A;  4GM8 A;  5GSA A;  1GP2 B;  3RFG A;  5B4W A;  2TRC B;  4CY3 A;  3A0F A;  4L3G D;  5CXB B;  1OMW B;  3FM0 A;  3UKR C;  3IKO A;  4AOW A;  3B7F A;  4IMM A;  2H6N A;  3K26 A;  5IT9 g;  4A0B A;  1VYH C;  2OVQ B;  4CI2 A;  2H6Q A;  4ERY A;  3PSL A;  4QT8 A;  4CZX A;  5FA5 B;  2I3T A;  4K3J B;  3EU7 A;  2GC7 A;  4CZV A;  2H9M A;  3EI2 B;  2BCJ B;  3SJL D;  3V5W B;  4EWR A;  4FB1 D;  3J80 g;  5FKQ A;  4JT6 C;  4QQE A;  3C9C A;  3CFV A;  3SXT D;  5EAR A;  4X63 B;  5EMK B;  4ZOX A;  5SXM A;  3OKY A;  2H9P A;  3I7H A;  4L9O A;  2P9S C;  3VGZ A;  1ERJ A;  4CI1 A;  4FA9 D;  1QNI A;  4CZY A;  3SBQ A;  4GQ2 P;  2HES X;  2IWF A;  2H47 A;  2PBI B;  1R5M A;  5FKR A;  4ZOZ A;  2YNO A;  4E5Z B;  3K27 A;  3FGB A;  3I89 A;  4YVD A;  4FAN D;  4E54 B;  5TF2 A;  4CY5 A;  2OIZ A;  2AGL A;  4GQB B;  1YFQ A;  3EG6 A;  2HXC A;  3NVN A;  3DSM A;  3DWL C;  3UVK A;  3F3P A;  4G56 B;  4PSX B;  2B5M A;  2H6K A;  4U1E I;  3UVM A;  5EML B;  2IUQ A;  4CI8 A;  3I7L A;  3GFC A;  3I7P A;  3RMZ D;  5HE0 B;  4GMB A;  5GMK n;  3RN1 D;  1PI6 A;  5CXB A;  3E0C A;  4A09 B;  3UVN A;  4J78 A;  1A0R B;  3JPX A;  3I7N A;  4ZOY A;  5CXC B;  3JB9 L;  4PBY A;  3AFC A;  2XL3 A;  3SVW D;  3SMR A;  3AH8 B;  2CN2 A;  4J77 A;  5GXH A;  3SLE D;  4BH6 A;  3EMH A;  3RLM D;  4H5I A;  4O3T B;  1SQ9 A;  1XKS A;  3OL2 B;  4FWW A;  3IIW A;  5K19 A;  4ZOV A;  2MTA H;  1RI6 A;  1JMX B;  4O1Q D;  1OLZ A;  4FAV D;  3OKT A;  5IJ7 E;  2OK4 A;  4D6V A;  2PM6 B;  5HE3 B;  3OKY B;  4A0A B;  3FRX A;  2J55 H;  5EAP A;  4MK0 B;  4Z8L A;  1JOF A;  5EMJ B;  3PSC B;  4JXM A;  1PGU A;  3I7O A;  5TEE A;  2YNN A;  2XYI A;  1U4C A;  2P9U C;  2G99 A;  4KFM B;  4CY1 A;  4PNK B;  4A09 A;  3IIY A;  4J0W A;  4GM3 A;  3JZG A;  3UKU C;  4J86 A;  1SHY B;  4ES0 A;  3N0E A;  3I2N A;  4PXW A;  1B9X A;  3C75 H;  5I5J A;  3JAM g;  3ULE C;  2P9P C;  2AGZ A;  3RFH A;  3OW8 A;  5H17 A;  4A08 A;  2YB8 B;  5C9Z B;  4U7A A;  4XEI C;  5I5I A;  3VA6 A;  2AH0 A;  3SCY A;  5THA A;  5HYN B;  4CI3 A;  3KRX B;  1FWX A;  1K32 A;  2HKM A;  4JD2 C;  2PM9 A;  3BG0 A;  3OKW A;  1JJU B;  3N0D A;  2XL2 A;  3SFZ A;  3AL8 A;  5FLX g;  4XYH A;  4GGC A;  2Z2P A;  4A7J A;  2CE9 A;  2H9N A;  4ERZ A;  4ESG A;  4JSV C;  2O9K A;  4J8B A;  3SN6 B;  3RN0 D;  3EI1 B;  3RSE C;  4X3E A;  1MDA H;  2H13 A;  3C99 A;  2I0R A;  2XU7 A;  5C2V B;  3EI2 A;  4OZU A;  1TYQ C;  4GGD A;  2IAA A;  4O9D A;  5K1C C;  5IGQ A;  5FKS A;  2H68 A;  5IJ8 E;  2IWK A;  2BBK H;  5HQG A;  4QRJ A;  4X61 B;  5TEF A;  4LG9 A;  5CXC A;  5IGO A;  3PVU B;  2UZY B;  2B5L A;  3V9F A;  1NR0 A;  3AL8 B;  3UR4 A;  4FA4 D;  5C2W B;  3KRW B;  3MKS B;  2OVP B;  5JWZ A;  2P9L C;  3EI3 B;  3EI3 A;  3V7D B;  5TDH B;  2AQ5 A;  5EM2 B;  3CIK B;  2P9K C;  5AJA A;  2CE8 A;  4CC9 A;  3W15 A;  4A08 B;  2HKR A;  2OVR B;  2I0S A;  3J81 g;  1XIP A;  4XYI A;  3GRE A;  2I0T A;  3JZN A;  2PM7 B;  4J79 A;  3IJ1 A;  4J87 A;  3SWS D;  2UZX B;  4D0K A;  2OJY A;  5FKT A;  3C5M A;  2P9I C;  3BG1 A;  1JMZ B;  1Q47 A;  4GZ8 A;  4TZ4 A;  2B5N A;  4O45 A;  4QL1 A;  5EAL A;  3DM0 A;  3UVL A;  4J0X A;  2IUP A;  3HFQ A;  4JSP C;  3OL2 A;  4GM9 A;  2J56 H;  4A0A A;  1XHM A;  5GXI A;  5FXY A;  3IJ0 A;  4H5J A;  5IC7 A;  2CO0 C;  4Y7R A;  4CY2 A;  3MKQ A;  2YMU A;  4A11 B;  4A2M A;  3RRM C;  2H3X A;  4R7A B;  3ZWL B;  2AGW A;  2W18 A;  5A2Q g;  5I5M A;  5FQD A;  3JRP A;  2B4E A;  3ODT A;  3DXK C;  4HDJ A;  3MZL A;  1K8K C;  2Z2O A;  4JSN C;  2OK6 A;  4FHL A;  1MG2 A;  4LG8 A;  3IJC A;  3NVQ A;  1L0Q A;  4GGA A;  1N6E A;  4E5Z A;  4A0B B;  5CYK A;  5CYK B;  5HE2 B;  3VH0 A;  2H9L A;  2I3S A;  3OTT A;  3CFS B;  1GOT B;  3JZH A;  3SBP A;  3EI4 B;  2HYE A;  4Y5R D;  2HJB A;  4J8G A;  3MMY A;  4BUJ C;  4O3U B;  4PC0 A;  5H14 A;  2Q7Q A;  3EI4 A;  3UVO A;  5EMM B;  4E54 A;  3DXM C;  2IUR A;  3ORV D;  4ERQ A;  3EWE A;  1P22 A;  1MG3 A;  3P4F A;  3AL9 A;  2GC4 A;  1SQJ A;  4I79 A;  3I8C A;  2AH1 A;  4ZN4 A;  4L3H D;  2CNX A;  4X60 B;  5EM2 A;  5KDO B;  4UI9 R;  3U4Y A;  2QXV A;  4LGN A;  1GXR A;  2PM9 B;  1U2V C;  5AMS A;  1TBG A;  3NVX A;  1N6D A;  2CN3 A;  3PXW D;  4FA1 D;  3BWS A;  2AGX A;  4J73 A;  4JSX C;  3PXS D;  5EAM A;  1B9Y A;  2P9N C;  2Z2N A;  4N14 A;  2AGY A;  4FA5 D;  4A11 A;  1PBY B;  2J57 G;  4J84 A;  4PSW B;  3SHF A;  2YNP A;  4J82 A;  4A2L A;  4L1Q D;  4OWR A;  3I8E A;  2G9A A;  3SBR A;  3PXT D;  5H1M A;  5HE1 B;  1NEX B;  3EI1 A;  3I7K A;  3MXX A;  3L4M D;  4IA9 A;  3MZK A;  2CO0 A;  2QC5 A;  4JT5 C;  3PE7 A;  1GG2 B;  2IUV A;  3L4O D;  1PEV A;  1S4U X;  4GQ1 A;  3F3G A;  5AFU 3;  2EBS A;  4PBZ A;  2YBA A;  4BL0 A;  4AEZ A;  2GNQ A;  4J81 A;  3JRO A;  3F3F A;  4NSX A;  4K3I D;  1N6F A;  2H14 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...