2OIZA

Crystal structure of the tryptamine-derived (indol-3-acetamide)-ttq adduct of aromatic amine dehydrogenase
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
360
structure length
360
Chain Sequence
EVLTGGHSVSAPQENRIYVMDSVFMHLTESRVHVYDYTNGKFLGMVPTAFNGHVQVSNDGKKIYTMTTYHERITRGKRSDVVEVWDADKLTFEKEISLPPKRVQGLNYDGLFRQTTDGKFIVLQNASPATSIGIVDVAKGDYVEDVTAAAGCWSVIPQPNRPRSFMTICGDGGLLTINLGEDGKVASQSRSKQMFSVKDDPIFIAPALDKDKAHFVSYYGNVYSADFSGDEVKVDGPWSLLNDEDKAKNWVPGGYNLVGLHRASGRMYVFMHPDGKEGTHKFPAAEIWVMDTKTKQRVARIPGRDALSMTIDQQRNLMLTLDGGNVNVYDISQPEPKLLRTIEGAAEASLQVQFHPVGGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Aromatic amine dehydrogenase, small subunit
publication title New insights into the reductive half-reaction mechanism of aromatic amine dehydrogenase revealed by reaction with carbinolamine substrates.
pubmed doi rcsb
total genus 96
structure length 360
sequence length 360
chains with identical sequence B
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2007-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2oizA01
3RMZD 3K27A 3VGZA 5I5IA 5C2WB 2B5MA 3EG6A 4X3EA 4A11A 2UZXB 4CY1A 4CY2A 4OWRA 5FXYA 2OVPB 4FHLA 4GM9A 4GMBA 4CY5A 2PM7B 4CI8A 2IUVA 2P9NC 3I7LA 3NVNA 5HE3B 5I5MA 4GGCA 2YNNA 5TDHB 5FQDA 5JWZA 3I7KA 4JXMA 4GM3A 5IT9g 5EM2B 2I3SA 2XU7A 4GZ8A 4E5ZB 4J0XA 4O45A 4GQBB 1U2VC 4J78A 4J0WA 4ERYA 3EI1B 3PVWB 2AQ5A 2O9KA 3UR4A 3ORVD 3BG0A 2OJYA 5CXBB 4PBYA 2HESX 4J81A 5TEEA 4Z8LA 5EARA 1JMZB 2BBKH 3IIWA 1MG2A 5C2VB 4QRJA 5HE2B 3L4MD 4CZYA 3JAMg 5THAA 4PNKB 2CO0C 3AFCA 3EWEA 4A0BB 3FGBA 4PC0A 3OKTA 5HYNB 4FAVD 1SQJA 3PE7A 1NEXB 4QQEA 2OIZA 3RRMC 4FWWA 2YNOA 4KFMB 5HE0B 2H9PA 3PXTD 4U1EI 3MKSB 2HJBA 3L4OD 5FKSA 3CIKB 2GNQA 2I0SA 3J81g 2CN3A 2H9LA 3OKYB 3U4YA 3EI2B 2EBSA 1U4CA 2CN2A 3I7NA 3SBPA 4GGDA 3SN6B 5CYKB 3F3GA 3IIYA 2P9SC 2HYEA 3SFZA 3N0EA 3N0DA 4QL1A 3SBRA 2B4EA 2J57G 4CZXA 2PM9A 1QNIA 5EAPA 5FKRA 2IWFA 3EI3B 3AL8B 4QT8A 1OMWB 4G56B 4AOWA 3A0FA 3SLED 4FA5D 1S4UX 3OL2A 4GM8A 2UZYB 3JPXA 1PGUA 4ZOYA 3EU7A 2H47A 3P4FA 4K3ID 5EMKB 4PBZA 3I7PA 3SCYA 5IC7A 2QC5A 4GQ1A 3RLMD 5HE1B 5EMLB 3RFGA 1JOFA 5GXIA 3DXMC 2IWKA 1XHMA 4O3TB 3RN0D 2QXVA 2PM6B 1Q47A 1GOTB 2CE9A 4IMMA 3FRXA 2P9KC 3IJ1A 2I0TA 4X63B 3UVOA 2AGXA 4ES0A 2H6KA 5GXHA 4UI9R 2OK4A 4FB1D 3EI4A 2IUPA 1MDAH 5AJAA 2I0RA 1SQ9A 2P9PC 4JSNC 4H5JA 3B7FA 4A11B 3OTTA 3V5WB 4CY3A 2OK6A 3SWSD 3AH8B 3IKOA 2HJ4A 4A0AA 4IA9A 1GG2B 3MKQA 4J73A 5CXBA 4FA9D 1A0RB 4JSXC 4ZOZA 1TYQC 5IGQA 5H14A 4A09B 3ZWLB 2YBAA 3I7HA 1K32A 2J55H 2CO0A 1GP2B 4A08A 3I2NA 5FKQA 4GGAA 2HXCA 2HKMA 3VA6A 5AMSA 4XEIC 1JMXB 2G9AA 1XIPA 4JT6C 2G99A 2MTAH 4L3GD 4ERQA 4J86A 4O3UB 4AEZA 2H68A 2I3TA 2YNPA 3EI2A 3DXKC 2P9IC 2XL2A 2H6QA 3JZGA 4J8BA 5K1CC 4L9OA 4YVDA 4ZOVA 3IJ0A 4E54A 1R5MA 3OW8A 4HDJA 1JJUB 2AGZA 3JZHA 4R7AB 3W15A 3MZKA 5H1MA 5IJ8E 3E0CA 3FM0A 2PBIB 3UVLA 1K8KC 2H3XA 3RN1D 3PXSD 4MK0B 3EI3A 3J80g 3VH0A 1P22A 1TBGA 4J87A 3ULEC 4BL0A 1XKSA 5CXCB 3UKRC 1OLZA 3DM0A 4FA4D 4LG9A 3NVQA 4J84A 5IGOA 3C75H 2GC7A 3JZNA 3C5MA 3DWLC 5TF2A 4PXWA 2PM9B 5EMMB 1PI6A 4ZOXA 2H9NA 3JB9L 1L0QA 4ERZA 4U7AA 3I8EA 4N14A 4H5IA 2IUQA 4D6VA 3AL9A 4BUJC 4NSXA 3PVUB 1NR0A 3F3PA 3SXTD 2B5NA 2XL3A 3KRWB 2Z2NA 4JSPC 3I7OA 2YB8B 3PXWD 4J82A 4J77A 5C9ZB 4EWRA 5EM2A 3SVWD 4JT5C 3SMRA 4CC9A 2P9UC 3JROA 4E5ZA 5FLXg 4I79A 4A2LA 5A2Qg 2TRCB 2J56H 4CZVA 2Z2OA 3EI1A 3GREA 3MMYA 4OZUA 4Y7RA 1RI6A 4O9DA 2OVRB 2XYIA 2GC4A 5FKTA 2CE8A 1FWXA 3EI4B 2AH0A 4K3JB 4A09A 5I5JA 4GQ2P 2Q7QA 3BG1A 1N6DA 2AGLA 4O1QD 4FAND 4PSXB 4PSWB 2H6NA 4L1QD 5SXMA 5EAMA 5B4WA 4CI2A 3PSCB 4A0BA 4J8GA 3C9CA 3K26A 5KDOB 2CNXA 5AFU3 1ERJA 2AGYA 4J79A 5EALA 4A0AB 3MXXA 3V7DB 1N6FA 4BH6A 3ODTA 4JD2C 1VYHC 4XYHA 4XYIA 1B9YA 1N6EA 2H13A 3OKWA 2OVQB 2P9LC 3OKYA 4ESGA 4Y5RD 4A08B 2Z2PA 5EMJB 4CI3A 2YMUA 1B9XA 3MZLA 5CYKA 3UVNA 5HQGA 4D0KA 4FA1D 2W18A 4CI1A 3C99A 5GSAA 3IJCA 3UKUC 5GMKn 2IURA 1YFQA 4X61B 4LG8A 3PSLA 3UVKA 2H14A 1SHYB 5H17A 1PEVA 5FA5B 3JRPA 3AL8A 3EMHA 3RSEC 3F3FA 5CXCA 2AH1A 4X60B 3V9FA 5TEFA 5K19A 2BCJB 4E54B 1GXRA 2B5LA 4TZ4A 3KRXB 3CFVA 3SBQA 2H9MA 4ZN4A 3CFSB 3SHFA 3I89A 2AGWA 3NVXA 4A7JA 3UVMA 4A2MA 3GFCA 4JSVC 4LGNA 3HFQA 1PBYB 3I8CA 3RFHA 3SJLD 3OL2B 4L3HD 1MG3A 5IJ7E 2IAAA 3BWSA 2HKRA 3DSMA
chains in the Genus database with same CATH superfamily
3RMZD 2EIDA 3K27A 2VDOA 3VGZA 5I5IA 5C2WB 2B5MA 3EG6A 4UM8A 4X3EA 4A11A 2UZXB 4CY1A 4MMZA 4CY2A 4OWRA 5FXYA 2OVPB 4FHLA 4DNWA 4GM9A 3NIDA 4GMBA 1UOOA 4CY5A 2PM7B 2VDRA 3MUNA 4CI8A 2IUVA 2P9NC 3I7LA 3NVNA 5HE3B 5I5MA 4GGCA 3O4GA 2YNNA 1GOHA 3NIFA 4G55A 4WK0A 5TDHB 2JKXA 2VC2A 5FQDA 5JWZA 3I7KA 4JXMA 4GM3A 5C92A 5IT9g 5EM2B 2I3SA 2XU7A 4GZ8A 4E5ZB 4J0XA 4O45A 2XDWA 4GQBB 4RE6A 1U2VC 4J78A 4J0WA 4ERYA 3EI1B 3PVWB 2AQ5A 2O9KA 3UR4A 3ORVD 4IRZA 4WK2A 3BG0A 2OJYA 4Z7OA 5CXBB 4PBYA 2HESX 4J81A 5TEEA 4BP8A 1H2ZA 4Z8LA 3ZDXA 5EARA 1JMZB 2BBKH 3IIWA 1MG2A 5C2VB 4QRJA 5HE2B 5FFGA 3L4MD 1JTDB 4CZYA 3JAMg 5THAA 3QI0A 4PNKB 2CO0C 3AFCA 3EWEA 3IUNA 4A0BB 3FGBA 4PC0A 3OKTA 5HYNB 4G1EA 4FAVD 2QR5A 1SQJA 3PE7A 1NEXB 4QQEA 2OIZA 4WJKA 3RRMC 4FWWA 3ZE1A 4BP9A 2YNOA 1YR2A 4KFMB 4O02A 5HE0B 2H9PA 3PXTD 4U1EI 3MKSB 2QZPA 3EQ7A 1BPOA 2HJBA 1I2MB 3L4OD 3VI4A 5FKSA 3CIKB 2GNQA 2I0SA 3J81g 2CN3A 2H9LA 3OKYB 3U4YA 3EI2B 2EBSA 4NAAA 3IUMA 1U4CA 2CN2A 2HU5A 3MUOA 5M5UA 3I7NA 3SBPA 4GGDA 3SN6B 5CYKB 3F3GA 3DDUA 2EICA 3IIYA 2P9SC 2HYEA 3V4PA 5E6SA 3SFZA 3FCUA 3N0EA 4D9SA 3N0DA 3GD1I 4QL1A 3SBRA 2B4EA 2J57G 4CZXA 2VDNA 2PM9A 1QNIA 5EAPA 5FKRA 2IWFA 3EI3B 3AL8B 2HU8A 4QT8A 1C9IA 1U8CA 1OMWB 5C86A 4G56B 4AOWA 4AMZA 3A0FA 3SLED 4FA5D 1S4UX 3OL2A 3KCIA 4GM8A 2UZYB 3IJEA 3JPXA 1PGUA 4ZOYA 3K71A 3EU7A 2H47A 1QFSA 3P4FA 4K3ID 1VE7A 5EMKB 4G1MA 2VDKA 4PBZA 4Z7NA 3I7PA 3SCYA 5IC7A 1T2XA 2VZ3A 2QC5A 1E8MA 4GQ1A 3RLMD 5FFOA 5HE1B 5EMLB 3RFGA 1JOFA 1GOGA 5GXIA 3DXMC 2IWKA 1XHMA 4O3TB 3RN0D 2QXVA 2PM6B 1Q47A 2VDQA 1GOTB 2CE9A 4IMMA 3FRXA 2P9KC 3IJ1A 2I0TA 4X63B 3UVOA 2AGXA 4AX4A 2H6KA 5GXHA 4UI9R 2OK4A 4FB1D 3EI4A 2IUPA 3ZE2A 4UM9A 1E8NA 1MDAH 3ZE0A 5AJAA 2I0RA 1SQ9A 2P9PC 4JSNC 4H5JA 4MMXA 3B7FA 4DNUA 5M5RA 3GC3B 4A11B 1H2XA 3OTTA 3V5WB 4AN0A 4CY3A 2OK6A 3SWSD 3AH8B 3IKOA 2VDMA 4NENA 2HJ4A 1QFMA 4A0AA 4IA9A 1GG2B 1L5GA 3MKQA 4J73A 5CXBA 4FA9D 5HDBA 1A0RB 4JSXC 4ZOZA 1TYQC 5IGQA 4WK4A 5H14A 4A09B 3ZWLB 2YBAA 3I7HA 1K32A 2J55H 3T3MA 2CO0A 1GP2B 3IURA 4A08A 3I2NA 5FKQA 4GGAA 2HXCA 2WQ8A 2HKMA 3VA6A 4NBMA 5AMSA 4XEIC 1JMXB 2G9AA 4Z7QA 2VDPA 1XIPA 4JT6C 4QAMA 2G99A 2MTAH 3EQ9A 4L3GD 4ERQA 4J86A 4O3UB 4AEZA 2H68A 2I3TA 2YNPA 3EI2A 3DXKC 2P9IC 2XL2A 2H6QA 3JZGA 3ZDYA 1K3IA 4J8BA 5K1CC 4L9OA 4YVDA 4ZOVA 3IJ0A 4E54A 5M5VA 1O6GA 1R5MA 3OW8A 4HDJA 1JJUB 2AGZA 3JZHA 4R7AB 3W15A 3MZKA 5H1MA 5IJ8E 3E0CA 3FM0A 2PBIB 3ZDZA 3UVLA 1VZ3A 2EIBA 1K8KC 2H3XA 2EIEA 3RN1D 3PXSD 4MK0B 3EI3A 3J80g 3VH0A 1P22A 1TBGA 4J87A 3K6SA 3V4VA 3ULEC 4BL0A 3DSMA 1XKSA 5CXCB 1E5TA 1C9LA 3UKRC 1OLZA 3DM0A 4FA4D 4LG9A 3NVQA 4J84A 5IGOA 3C75H 2GC7A 4MMYA 3JZNA 3C5MA 3DWLC 5TF2A 4PXWA 4BCDA 2PM9B 5M61A 1UTCA 5EMMB 1PI6A 4ZOXA 2H9NA 1M1XA 3JB9L 3NIGA 1A12A 1L0QA 4ERZA 4U7AA 4DNVA 3I8EA 1JV2A 4H5IA 2IUQA 4N14A 2VZ1A 4D6VA 3AL9A 4BUJC 4NSXA 3PVUB 1NR0A 3F3PA 3SXTD 2B5NA 2XL3A 3KRWB 2Z2NA 3K72A 4RE5A 4JSPC 3I7OA 2YB8B 3PXWD 4J82A 4J77A 5C9ZB 4EWRA 5EM2A 3SVWD 4JT5C 3SMRA 1UOQA 2P9UC 4CC9A 3JROA 4E5ZA 5FLXg 4I79A 4A2LA 5A2Qg 2TRCB 2J56H 1GOFA 2HU7A 4CZVA 2Z2OA 3EI1A 3GREA 5M5SA 3MMYA 4OZUA 4Y7RA 5M5TA 1RI6A 3O4JA 4O9DA 3MVDK 2OVRB 2XYIA 4L1MA 2XE4A 2GC4A 5FKTA 2CE8A 4AN1A 1FWXA 3EI4B 2AH0A 4K3JB 4A09A 5I5JA 4GQ2P 2Q7QA 1UOPA 3BG1A 3IUQA 1N6DA 2AGLA 3VI3A 4O1QD 4FAND 4PSXB 4PSWB 2H6NA 4L1QD 5SXMA 5EAMA 4BCBA 5B4WA 4CI2A 3PSCB 4A0BA 4J8GA 3C9CA 3K26A 5KDOB 1VZ2A 2CNXA 5AFU3 1ERJA 1H2WA 2AGYA 4J79A 1TYEA 5EALA 4A0AB 3MXXA 3V7DB 1N6FA 4BH6A 3ODTA 3O4HA 5E6UA 4JD2C 1VYHC 4XYHA 4O2WA 4XYIA 1B9YA 1N6EA 2H13A 3OKWA 2OVQB 2P9LC 3OKYA 4JHNA 4ESGA 4Y5RD 4A08B 2Z2PA 5EMJB 4CI3A 3IULA 2YMUA 1B9XA 4ES0A 3MZLA 5CYKA 2BKLA 5HQGA 3UVNA 4D0KA 3QHYB 4FA1D 2W18A 5E6RA 4CI1A 3C99A 5GSAA 3IJCA 3UKUC 5GMKn 2IURA 4NC4A 1YFQA 4X61B 3EQ8A 4LG8A 3PSLA 3UVKA 2H14A 1SHYB 5H17A 1PEVA 5FA5B 3JRPA 1O6FA 3AL8A 3EMHA 3RSEC 3F3FA 4AMYA 5CXCA 2AH1A 4X60B 3V9FA 5TEFA 4JHPC 2BCJB 5K19A 4E54B 1GXRA 2B5LA 4TZ4A 3FCSA 3KRXB 1H2YA 3CFVA 3SBQA 3IVMA 2H9MA 4ZN4A 3CFSB 3SHFA 3I89A 3OF7A 2AGWA 3NVXA 4A7JA 3UVMA 4A2MA 2VDLA 3O4IA 3GFCA 4JSVC 4LGNA 4BCCA 3HFQA 2XZGA 1PBYB 3I8CA 1VE6A 3RFHA 3SJLD 3OL2B 4L3HD 1MG3A 3T3PA 5IJ7E 2IAAA 3BWSA 2HKRA 3IUJA
chains in the Genus database with same CATH topology
3RMZD 3K27A 3VGZA 5I5IA 5C2WB 2B5MA 3EG6A 4X3EA 4A11A 2UZXB 4CY1A 4CY2A 4OWRA 5FXYA 2OVPB 4FHLA 4GM9A 4GMBA 4CY5A 2PM7B 4CI8A 2IUVA 2P9NC 3I7LA 3NVNA 5HE3B 5I5MA 4GGCA 2YNNA 5TDHB 5FQDA 5JWZA 3I7KA 4JXMA 4GM3A 5IT9g 5EM2B 2I3SA 2XU7A 4GZ8A 4E5ZB 4J0XA 4O45A 4GQBB 1U2VC 4J78A 4J0WA 4ERYA 3EI1B 3PVWB 2AQ5A 2O9KA 3UR4A 3ORVD 3BG0A 2OJYA 5CXBB 4PBYA 2HESX 4J81A 5TEEA 4Z8LA 5EARA 1JMZB 2BBKH 3IIWA 1MG2A 5C2VB 4QRJA 5HE2B 3L4MD 4CZYA 3JAMg 5THAA 4PNKB 2CO0C 3AFCA 3EWEA 4A0BB 3FGBA 4PC0A 3OKTA 5HYNB 4FAVD 1SQJA 3PE7A 1NEXB 4QQEA 2OIZA 3RRMC 4FWWA 2YNOA 4KFMB 5HE0B 2H9PA 3PXTD 4U1EI 3MKSB 2HJBA 3L4OD 5FKSA 3CIKB 2GNQA 2I0SA 3J81g 2CN3A 2H9LA 3OKYB 3U4YA 3EI2B 2EBSA 1U4CA 2CN2A 3I7NA 3SBPA 4GGDA 3SN6B 5CYKB 3F3GA 3IIYA 2P9SC 2HYEA 3SFZA 3N0EA 3N0DA 4QL1A 3SBRA 2B4EA 2J57G 4CZXA 2PM9A 1QNIA 5EAPA 5FKRA 2IWFA 3EI3B 3AL8B 4QT8A 1OMWB 4G56B 4AOWA 3A0FA 3SLED 4FA5D 1S4UX 3OL2A 4GM8A 2UZYB 3JPXA 1PGUA 4ZOYA 3EU7A 2H47A 3P4FA 4K3ID 5EMKB 4PBZA 3I7PA 3SCYA 5IC7A 2QC5A 4GQ1A 3RLMD 5HE1B 5EMLB 3RFGA 1JOFA 5GXIA 3DXMC 2IWKA 1XHMA 4O3TB 3RN0D 2QXVA 2PM6B 1Q47A 1GOTB 2CE9A 4IMMA 3FRXA 2P9KC 3IJ1A 2I0TA 4X63B 3UVOA 2AGXA 4ES0A 2H6KA 5GXHA 4UI9R 2OK4A 4FB1D 3EI4A 2IUPA 1MDAH 5AJAA 2I0RA 1SQ9A 2P9PC 4JSNC 4H5JA 3B7FA 4A11B 3OTTA 3V5WB 4CY3A 2OK6A 3SWSD 3AH8B 3IKOA 2HJ4A 4A0AA 4IA9A 1GG2B 3MKQA 4J73A 5CXBA 4FA9D 1A0RB 4JSXC 4ZOZA 1TYQC 5IGQA 5H14A 4A09B 3ZWLB 2YBAA 3I7HA 1K32A 2J55H 2CO0A 1GP2B 4A08A 3I2NA 5FKQA 4GGAA 2HXCA 2HKMA 3VA6A 5AMSA 4XEIC 1JMXB 2G9AA 1XIPA 4JT6C 2G99A 2MTAH 4L3GD 4ERQA 4J86A 4O3UB 4AEZA 2H68A 2I3TA 2YNPA 3EI2A 3DXKC 2P9IC 2XL2A 2H6QA 3JZGA 4J8BA 5K1CC 4L9OA 4YVDA 4ZOVA 3IJ0A 4E54A 1R5MA 3OW8A 4HDJA 1JJUB 2AGZA 3JZHA 4R7AB 3W15A 3MZKA 5H1MA 5IJ8E 3E0CA 3FM0A 2PBIB 3UVLA 1K8KC 2H3XA 3RN1D 3PXSD 4MK0B 3EI3A 3J80g 3VH0A 1P22A 1TBGA 4J87A 3ULEC 4BL0A 1XKSA 5CXCB 3UKRC 1OLZA 3DM0A 4FA4D 4LG9A 3NVQA 4J84A 5IGOA 3C75H 2GC7A 3JZNA 3C5MA 3DWLC 5TF2A 4PXWA 2PM9B 5EMMB 1PI6A 4ZOXA 2H9NA 3JB9L 1L0QA 4ERZA 4U7AA 3I8EA 4N14A 4H5IA 2IUQA 4D6VA 3AL9A 4BUJC 4NSXA 3PVUB 1NR0A 3F3PA 3SXTD 2B5NA 2XL3A 3KRWB 2Z2NA 4JSPC 3I7OA 2YB8B 3PXWD 4J82A 4J77A 5C9ZB 4EWRA 5EM2A 3SVWD 4JT5C 3SMRA 4CC9A 2P9UC 3JROA 4E5ZA 5FLXg 4I79A 4A2LA 5A2Qg 2TRCB 2J56H 4CZVA 2Z2OA 3EI1A 3GREA 3MMYA 4OZUA 4Y7RA 1RI6A 4O9DA 2OVRB 2XYIA 2GC4A 5FKTA 2CE8A 1FWXA 3EI4B 2AH0A 4K3JB 4A09A 5I5JA 4GQ2P 2Q7QA 3BG1A 1N6DA 2AGLA 4O1QD 4FAND 4PSXB 4PSWB 2H6NA 4L1QD 5SXMA 5EAMA 5B4WA 4CI2A 3PSCB 4A0BA 4J8GA 3C9CA 3K26A 5KDOB 2CNXA 5AFU3 1ERJA 2AGYA 4J79A 5EALA 4A0AB 3MXXA 3V7DB 1N6FA 4BH6A 3ODTA 4JD2C 1VYHC 4XYHA 4XYIA 1B9YA 1N6EA 2H13A 3OKWA 2OVQB 2P9LC 3OKYA 4ESGA 4Y5RD 4A08B 2Z2PA 5EMJB 4CI3A 2YMUA 1B9XA 3MZLA 5CYKA 3UVNA 5HQGA 4D0KA 4FA1D 2W18A 4CI1A 3C99A 5GSAA 3IJCA 3UKUC 5GMKn 2IURA 1YFQA 4X61B 4LG8A 3PSLA 3UVKA 2H14A 1SHYB 5H17A 1PEVA 5FA5B 3JRPA 3AL8A 3EMHA 3RSEC 3F3FA 5CXCA 2AH1A 4X60B 3V9FA 5TEFA 5K19A 2BCJB 4E54B 1GXRA 2B5LA 4TZ4A 3KRXB 3CFVA 3SBQA 2H9MA 4ZN4A 3CFSB 3SHFA 3I89A 2AGWA 3NVXA 4A7JA 3UVMA 4A2MA 3GFCA 4JSVC 4LGNA 3HFQA 1PBYB 3I8CA 3RFHA 3SJLD 3OL2B 4L3HD 1MG3A 5IJ7E 2IAAA 3BWSA 2HKRA 3DSMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RMZ D;  3K27 A;  3VGZ A;  5I5I A;  5C2W B;  2B5M A;  3EG6 A;  4X3E A;  4A11 A;  2UZX B;  4CY1 A;  4CY2 A;  4OWR A;  5FXY A;  2OVP B;  4FHL A;  4GM9 A;  4GMB A;  4CY5 A;  2PM7 B;  4CI8 A;  2IUV A;  2P9N C;  3I7L A;  3NVN A;  5HE3 B;  5I5M A;  4GGC A;  2YNN A;  5TDH B;  5FQD A;  5JWZ A;  3I7K A;  4JXM A;  4GM3 A;  5IT9 g;  5EM2 B;  2I3S A;  2XU7 A;  4GZ8 A;  4E5Z B;  4J0X A;  4O45 A;  4GQB B;  1U2V C;  4J78 A;  4J0W A;  4ERY A;  3EI1 B;  3PVW B;  2AQ5 A;  2O9K A;  3UR4 A;  3ORV D;  3BG0 A;  2OJY A;  5CXB B;  4PBY A;  2HES X;  4J81 A;  5TEE A;  4Z8L A;  5EAR A;  1JMZ B;  2BBK H;  3IIW A;  1MG2 A;  5C2V B;  4QRJ A;  5HE2 B;  3L4M D;  4CZY A;  3JAM g;  5THA A;  4PNK B;  2CO0 C;  3AFC A;  3EWE A;  4A0B B;  3FGB A;  4PC0 A;  3OKT A;  5HYN B;  4FAV D;  1SQJ A;  3PE7 A;  1NEX B;  4QQE A;  2OIZ A;  3RRM C;  4FWW A;  2YNO A;  4KFM B;  5HE0 B;  2H9P A;  3PXT D;  4U1E I;  3MKS B;  2HJB A;  3L4O D;  5FKS A;  3CIK B;  2GNQ A;  2I0S A;  3J81 g;  2CN3 A;  2H9L A;  3OKY B;  3U4Y A;  3EI2 B;  2EBS A;  1U4C A;  2CN2 A;  3I7N A;  3SBP A;  4GGD A;  3SN6 B;  5CYK B;  3F3G A;  3IIY A;  2P9S C;  2HYE A;  3SFZ A;  3N0E A;  3N0D A;  4QL1 A;  3SBR A;  2B4E A;  2J57 G;  4CZX A;  2PM9 A;  1QNI A;  5EAP A;  5FKR A;  2IWF A;  3EI3 B;  3AL8 B;  4QT8 A;  1OMW B;  4G56 B;  4AOW A;  3A0F A;  3SLE D;  4FA5 D;  1S4U X;  3OL2 A;  4GM8 A;  2UZY B;  3JPX A;  1PGU A;  4ZOY A;  3EU7 A;  2H47 A;  3P4F A;  4K3I D;  5EMK B;  4PBZ A;  3I7P A;  3SCY A;  5IC7 A;  2QC5 A;  4GQ1 A;  3RLM D;  5HE1 B;  5EML B;  3RFG A;  1JOF A;  5GXI A;  3DXM C;  2IWK A;  1XHM A;  4O3T B;  3RN0 D;  2QXV A;  2PM6 B;  1Q47 A;  1GOT B;  2CE9 A;  4IMM A;  3FRX A;  2P9K C;  3IJ1 A;  2I0T A;  4X63 B;  3UVO A;  2AGX A;  4ES0 A;  2H6K A;  5GXH A;  4UI9 R;  2OK4 A;  4FB1 D;  3EI4 A;  2IUP A;  1MDA H;  5AJA A;  2I0R A;  1SQ9 A;  2P9P C;  4JSN C;  4H5J A;  3B7F A;  4A11 B;  3OTT A;  3V5W B;  4CY3 A;  2OK6 A;  3SWS D;  3AH8 B;  3IKO A;  2HJ4 A;  4A0A A;  4IA9 A;  1GG2 B;  3MKQ A;  4J73 A;  5CXB A;  4FA9 D;  1A0R B;  4JSX C;  4ZOZ A;  1TYQ C;  5IGQ A;  5H14 A;  4A09 B;  3ZWL B;  2YBA A;  3I7H A;  1K32 A;  2J55 H;  2CO0 A;  1GP2 B;  4A08 A;  3I2N A;  5FKQ A;  4GGA A;  2HXC A;  2HKM A;  3VA6 A;  5AMS A;  4XEI C;  1JMX B;  2G9A A;  1XIP A;  4JT6 C;  2G99 A;  2MTA H;  4L3G D;  4ERQ A;  4J86 A;  4O3U B;  4AEZ A;  2H68 A;  2I3T A;  2YNP A;  3EI2 A;  3DXK C;  2P9I C;  2XL2 A;  2H6Q A;  3JZG A;  4J8B A;  5K1C C;  4L9O A;  4YVD A;  4ZOV A;  3IJ0 A;  4E54 A;  1R5M A;  3OW8 A;  4HDJ A;  1JJU B;  2AGZ A;  3JZH A;  4R7A B;  3W15 A;  3MZK A;  5H1M A;  5IJ8 E;  3E0C A;  3FM0 A;  2PBI B;  3UVL A;  1K8K C;  2H3X A;  3RN1 D;  3PXS D;  4MK0 B;  3EI3 A;  3J80 g;  3VH0 A;  1P22 A;  1TBG A;  4J87 A;  3ULE C;  4BL0 A;  1XKS A;  5CXC B;  3UKR C;  1OLZ A;  3DM0 A;  4FA4 D;  4LG9 A;  3NVQ A;  4J84 A;  5IGO A;  3C75 H;  2GC7 A;  3JZN A;  3C5M A;  3DWL C;  5TF2 A;  4PXW A;  2PM9 B;  5EMM B;  1PI6 A;  4ZOX A;  2H9N A;  3JB9 L;  1L0Q A;  4ERZ A;  4U7A A;  3I8E A;  4N14 A;  4H5I A;  2IUQ A;  4D6V A;  3AL9 A;  4BUJ C;  4NSX A;  3PVU B;  1NR0 A;  3F3P A;  3SXT D;  2B5N A;  2XL3 A;  3KRW B;  2Z2N A;  4JSP C;  3I7O A;  2YB8 B;  3PXW D;  4J82 A;  4J77 A;  5C9Z B;  4EWR A;  5EM2 A;  3SVW D;  4JT5 C;  3SMR A;  4CC9 A;  2P9U C;  3JRO A;  4E5Z A;  5FLX g;  4I79 A;  4A2L A;  5A2Q g;  2TRC B;  2J56 H;  4CZV A;  2Z2O A;  3EI1 A;  3GRE A;  3MMY A;  4OZU A;  4Y7R A;  1RI6 A;  4O9D A;  2OVR B;  2XYI A;  2GC4 A;  5FKT A;  2CE8 A;  1FWX A;  3EI4 B;  2AH0 A;  4K3J B;  4A09 A;  5I5J A;  4GQ2 P;  2Q7Q A;  3BG1 A;  1N6D A;  2AGL A;  4O1Q D;  4FAN D;  4PSX B;  4PSW B;  2H6N A;  4L1Q D;  5SXM A;  5EAM A;  5B4W A;  4CI2 A;  3PSC B;  4A0B A;  4J8G A;  3C9C A;  3K26 A;  5KDO B;  2CNX A;  5AFU 3;  1ERJ A;  2AGY A;  4J79 A;  5EAL A;  4A0A B;  3MXX A;  3V7D B;  1N6F A;  4BH6 A;  3ODT A;  4JD2 C;  1VYH C;  4XYH A;  4XYI A;  1B9Y A;  1N6E A;  2H13 A;  3OKW A;  2OVQ B;  2P9L C;  3OKY A;  4ESG A;  4Y5R D;  4A08 B;  2Z2P A;  5EMJ B;  4CI3 A;  2YMU A;  1B9X A;  3MZL A;  5CYK A;  3UVN A;  5HQG A;  4D0K A;  4FA1 D;  2W18 A;  4CI1 A;  3C99 A;  5GSA A;  3IJC A;  3UKU C;  5GMK n;  2IUR A;  1YFQ A;  4X61 B;  4LG8 A;  3PSL A;  3UVK A;  2H14 A;  1SHY B;  5H17 A;  1PEV A;  5FA5 B;  3JRP A;  3AL8 A;  3EMH A;  3RSE C;  3F3F A;  5CXC A;  2AH1 A;  4X60 B;  3V9F A;  5TEF A;  5K19 A;  2BCJ B;  4E54 B;  1GXR A;  2B5L A;  4TZ4 A;  3KRX B;  3CFV A;  3SBQ A;  2H9M A;  4ZN4 A;  3CFS B;  3SHF A;  3I89 A;  2AGW A;  3NVX A;  4A7J A;  3UVM A;  4A2M A;  3GFC A;  4JSV C;  4LGN A;  3HFQ A;  1PBY B;  3I8C A;  3RFH A;  3SJL D;  3OL2 B;  4L3H D;  1MG3 A;  5IJ7 E;  2IAA A;  3BWS A;  2HKR A;  3DSM A; 
#chains in the Genus database with same CATH topology
 3RMZ D;  2EID A;  3K27 A;  2VDO A;  3VGZ A;  5I5I A;  5C2W B;  2B5M A;  3EG6 A;  4UM8 A;  4X3E A;  4A11 A;  2UZX B;  4CY1 A;  4MMZ A;  4CY2 A;  4OWR A;  5FXY A;  2OVP B;  4FHL A;  4DNW A;  4GM9 A;  3NID A;  4GMB A;  1UOO A;  4CY5 A;  2PM7 B;  2VDR A;  3MUN A;  4CI8 A;  2IUV A;  2P9N C;  3I7L A;  3NVN A;  5HE3 B;  5I5M A;  4GGC A;  3O4G A;  2YNN A;  1GOH A;  3NIF A;  4G55 A;  4WK0 A;  5TDH B;  2JKX A;  2VC2 A;  5FQD A;  5JWZ A;  3I7K A;  4JXM A;  4GM3 A;  5C92 A;  5IT9 g;  5EM2 B;  2I3S A;  2XU7 A;  4GZ8 A;  4E5Z B;  4J0X A;  4O45 A;  2XDW A;  4GQB B;  4RE6 A;  1U2V C;  4J78 A;  4J0W A;  4ERY A;  3EI1 B;  3PVW B;  2AQ5 A;  2O9K A;  3UR4 A;  3ORV D;  4IRZ A;  4WK2 A;  3BG0 A;  2OJY A;  4Z7O A;  5CXB B;  4PBY A;  2HES X;  4J81 A;  5TEE A;  4BP8 A;  1H2Z A;  4Z8L A;  3ZDX A;  5EAR A;  1JMZ B;  2BBK H;  3IIW A;  1MG2 A;  5C2V B;  4QRJ A;  5HE2 B;  5FFG A;  3L4M D;  1JTD B;  4CZY A;  3JAM g;  5THA A;  3QI0 A;  4PNK B;  2CO0 C;  3AFC A;  3EWE A;  3IUN A;  4A0B B;  3FGB A;  4PC0 A;  3OKT A;  5HYN B;  4G1E A;  4FAV D;  2QR5 A;  1SQJ A;  3PE7 A;  1NEX B;  4QQE A;  2OIZ A;  4WJK A;  3RRM C;  4FWW A;  3ZE1 A;  4BP9 A;  2YNO A;  1YR2 A;  4KFM B;  4O02 A;  5HE0 B;  2H9P A;  3PXT D;  4U1E I;  3MKS B;  2QZP A;  3EQ7 A;  1BPO A;  2HJB A;  1I2M B;  3L4O D;  3VI4 A;  5FKS A;  3CIK B;  2GNQ A;  2I0S A;  3J81 g;  2CN3 A;  2H9L A;  3OKY B;  3U4Y A;  3EI2 B;  2EBS A;  4NAA A;  3IUM A;  1U4C A;  2CN2 A;  2HU5 A;  3MUO A;  5M5U A;  3I7N A;  3SBP A;  4GGD A;  3SN6 B;  5CYK B;  3F3G A;  3DDU A;  2EIC A;  3IIY A;  2P9S C;  2HYE A;  3V4P A;  5E6S A;  3SFZ A;  3FCU A;  3N0E A;  4D9S A;  3N0D A;  3GD1 I;  4QL1 A;  3SBR A;  2B4E A;  2J57 G;  4CZX A;  2VDN A;  2PM9 A;  1QNI A;  5EAP A;  5FKR A;  2IWF A;  3EI3 B;  3AL8 B;  2HU8 A;  4QT8 A;  1C9I A;  1U8C A;  1OMW B;  5C86 A;  4G56 B;  4AOW A;  4AMZ A;  3A0F A;  3SLE D;  4FA5 D;  1S4U X;  3OL2 A;  3KCI A;  4GM8 A;  2UZY B;  3IJE A;  3JPX A;  1PGU A;  4ZOY A;  3K71 A;  3EU7 A;  2H47 A;  1QFS A;  3P4F A;  4K3I D;  1VE7 A;  5EMK B;  4G1M A;  2VDK A;  4PBZ A;  4Z7N A;  3I7P A;  3SCY A;  5IC7 A;  1T2X A;  2VZ3 A;  2QC5 A;  1E8M A;  4GQ1 A;  3RLM D;  5FFO A;  5HE1 B;  5EML B;  3RFG A;  1JOF A;  1GOG A;  5GXI A;  3DXM C;  2IWK A;  1XHM A;  4O3T B;  3RN0 D;  2QXV A;  2PM6 B;  1Q47 A;  2VDQ A;  1GOT B;  2CE9 A;  4IMM A;  3FRX A;  2P9K C;  3IJ1 A;  2I0T A;  4X63 B;  3UVO A;  2AGX A;  4AX4 A;  2H6K A;  5GXH A;  4UI9 R;  2OK4 A;  4FB1 D;  3EI4 A;  2IUP A;  3ZE2 A;  4UM9 A;  1E8N A;  1MDA H;  3ZE0 A;  5AJA A;  2I0R A;  1SQ9 A;  2P9P C;  4JSN C;  4H5J A;  4MMX A;  3B7F A;  4DNU A;  5M5R A;  3GC3 B;  4A11 B;  1H2X A;  3OTT A;  3V5W B;  4AN0 A;  4CY3 A;  2OK6 A;  3SWS D;  3AH8 B;  3IKO A;  2VDM A;  4NEN A;  2HJ4 A;  1QFM A;  4A0A A;  4IA9 A;  1GG2 B;  1L5G A;  3MKQ A;  4J73 A;  5CXB A;  4FA9 D;  5HDB A;  1A0R B;  4JSX C;  4ZOZ A;  1TYQ C;  5IGQ A;  4WK4 A;  5H14 A;  4A09 B;  3ZWL B;  2YBA A;  3I7H A;  1K32 A;  2J55 H;  3T3M A;  2CO0 A;  1GP2 B;  3IUR A;  4A08 A;  3I2N A;  5FKQ A;  4GGA A;  2HXC A;  2WQ8 A;  2HKM A;  3VA6 A;  4NBM A;  5AMS A;  4XEI C;  1JMX B;  2G9A A;  4Z7Q A;  2VDP A;  1XIP A;  4JT6 C;  4QAM A;  2G99 A;  2MTA H;  3EQ9 A;  4L3G D;  4ERQ A;  4J86 A;  4O3U B;  4AEZ A;  2H68 A;  2I3T A;  2YNP A;  3EI2 A;  3DXK C;  2P9I C;  2XL2 A;  2H6Q A;  3JZG A;  3ZDY A;  1K3I A;  4J8B A;  5K1C C;  4L9O A;  4YVD A;  4ZOV A;  3IJ0 A;  4E54 A;  5M5V A;  1O6G A;  1R5M A;  3OW8 A;  4HDJ A;  1JJU B;  2AGZ A;  3JZH A;  4R7A B;  3W15 A;  3MZK A;  5H1M A;  5IJ8 E;  3E0C A;  3FM0 A;  2PBI B;  3ZDZ A;  3UVL A;  1VZ3 A;  2EIB A;  1K8K C;  2H3X A;  2EIE A;  3RN1 D;  3PXS D;  4MK0 B;  3EI3 A;  3J80 g;  3VH0 A;  1P22 A;  1TBG A;  4J87 A;  3K6S A;  3V4V A;  3ULE C;  4BL0 A;  3DSM A;  1XKS A;  5CXC B;  1E5T A;  1C9L A;  3UKR C;  1OLZ A;  3DM0 A;  4FA4 D;  4LG9 A;  3NVQ A;  4J84 A;  5IGO A;  3C75 H;  2GC7 A;  4MMY A;  3JZN A;  3C5M A;  3DWL C;  5TF2 A;  4PXW A;  4BCD A;  2PM9 B;  5M61 A;  1UTC A;  5EMM B;  1PI6 A;  4ZOX A;  2H9N A;  1M1X A;  3JB9 L;  3NIG A;  1A12 A;  1L0Q A;  4ERZ A;  4U7A A;  4DNV A;  3I8E A;  1JV2 A;  4H5I A;  2IUQ A;  4N14 A;  2VZ1 A;  4D6V A;  3AL9 A;  4BUJ C;  4NSX A;  3PVU B;  1NR0 A;  3F3P A;  3SXT D;  2B5N A;  2XL3 A;  3KRW B;  2Z2N A;  3K72 A;  4RE5 A;  4JSP C;  3I7O A;  2YB8 B;  3PXW D;  4J82 A;  4J77 A;  5C9Z B;  4EWR A;  5EM2 A;  3SVW D;  4JT5 C;  3SMR A;  1UOQ A;  2P9U C;  4CC9 A;  3JRO A;  4E5Z A;  5FLX g;  4I79 A;  4A2L A;  5A2Q g;  2TRC B;  2J56 H;  1GOF A;  2HU7 A;  4CZV A;  2Z2O A;  3EI1 A;  3GRE A;  5M5S A;  3MMY A;  4OZU A;  4Y7R A;  5M5T A;  1RI6 A;  3O4J A;  4O9D A;  3MVD K;  2OVR B;  2XYI A;  4L1M A;  2XE4 A;  2GC4 A;  5FKT A;  2CE8 A;  4AN1 A;  1FWX A;  3EI4 B;  2AH0 A;  4K3J B;  4A09 A;  5I5J A;  4GQ2 P;  2Q7Q A;  1UOP A;  3BG1 A;  3IUQ A;  1N6D A;  2AGL A;  3VI3 A;  4O1Q D;  4FAN D;  4PSX B;  4PSW B;  2H6N A;  4L1Q D;  5SXM A;  5EAM A;  4BCB A;  5B4W A;  4CI2 A;  3PSC B;  4A0B A;  4J8G A;  3C9C A;  3K26 A;  5KDO B;  1VZ2 A;  2CNX A;  5AFU 3;  1ERJ A;  1H2W A;  2AGY A;  4J79 A;  1TYE A;  5EAL A;  4A0A B;  3MXX A;  3V7D B;  1N6F A;  4BH6 A;  3ODT A;  3O4H A;  5E6U A;  4JD2 C;  1VYH C;  4XYH A;  4O2W A;  4XYI A;  1B9Y A;  1N6E A;  2H13 A;  3OKW A;  2OVQ B;  2P9L C;  3OKY A;  4JHN A;  4ESG A;  4Y5R D;  4A08 B;  2Z2P A;  5EMJ B;  4CI3 A;  3IUL A;  2YMU A;  1B9X A;  4ES0 A;  3MZL A;  5CYK A;  2BKL A;  5HQG A;  3UVN A;  4D0K A;  3QHY B;  4FA1 D;  2W18 A;  5E6R A;  4CI1 A;  3C99 A;  5GSA A;  3IJC A;  3UKU C;  5GMK n;  2IUR A;  4NC4 A;  1YFQ A;  4X61 B;  3EQ8 A;  4LG8 A;  3PSL A;  3UVK A;  2H14 A;  1SHY B;  5H17 A;  1PEV A;  5FA5 B;  3JRP A;  1O6F A;  3AL8 A;  3EMH A;  3RSE C;  3F3F A;  4AMY A;  5CXC A;  2AH1 A;  4X60 B;  3V9F A;  5TEF A;  4JHP C;  2BCJ B;  5K19 A;  4E54 B;  1GXR A;  2B5L A;  4TZ4 A;  3FCS A;  3KRX B;  1H2Y A;  3CFV A;  3SBQ A;  3IVM A;  2H9M A;  4ZN4 A;  3CFS B;  3SHF A;  3I89 A;  3OF7 A;  2AGW A;  3NVX A;  4A7J A;  3UVM A;  4A2M A;  2VDL A;  3O4I A;  3GFC A;  4JSV C;  4LGN A;  4BCC A;  3HFQ A;  2XZG A;  1PBY B;  3I8C A;  1VE6 A;  3RFH A;  3SJL D;  3OL2 B;  4L3H D;  1MG3 A;  3T3P A;  5IJ7 E;  2IAA A;  3BWS A;  2HKR A;  3IUJ A; 
#chains in the Genus database with same CATH homology
 3RMZ D;  3K27 A;  3VGZ A;  5I5I A;  5C2W B;  2B5M A;  3EG6 A;  4X3E A;  4A11 A;  2UZX B;  4CY1 A;  4CY2 A;  4OWR A;  5FXY A;  2OVP B;  4FHL A;  4GM9 A;  4GMB A;  4CY5 A;  2PM7 B;  4CI8 A;  2IUV A;  2P9N C;  3I7L A;  3NVN A;  5HE3 B;  5I5M A;  4GGC A;  2YNN A;  5TDH B;  5FQD A;  5JWZ A;  3I7K A;  4JXM A;  4GM3 A;  5IT9 g;  5EM2 B;  2I3S A;  2XU7 A;  4GZ8 A;  4E5Z B;  4J0X A;  4O45 A;  4GQB B;  1U2V C;  4J78 A;  4J0W A;  4ERY A;  3EI1 B;  3PVW B;  2AQ5 A;  2O9K A;  3UR4 A;  3ORV D;  3BG0 A;  2OJY A;  5CXB B;  4PBY A;  2HES X;  4J81 A;  5TEE A;  4Z8L A;  5EAR A;  1JMZ B;  2BBK H;  3IIW A;  1MG2 A;  5C2V B;  4QRJ A;  5HE2 B;  3L4M D;  4CZY A;  3JAM g;  5THA A;  4PNK B;  2CO0 C;  3AFC A;  3EWE A;  4A0B B;  3FGB A;  4PC0 A;  3OKT A;  5HYN B;  4FAV D;  1SQJ A;  3PE7 A;  1NEX B;  4QQE A;  2OIZ A;  3RRM C;  4FWW A;  2YNO A;  4KFM B;  5HE0 B;  2H9P A;  3PXT D;  4U1E I;  3MKS B;  2HJB A;  3L4O D;  5FKS A;  3CIK B;  2GNQ A;  2I0S A;  3J81 g;  2CN3 A;  2H9L A;  3OKY B;  3U4Y A;  3EI2 B;  2EBS A;  1U4C A;  2CN2 A;  3I7N A;  3SBP A;  4GGD A;  3SN6 B;  5CYK B;  3F3G A;  3IIY A;  2P9S C;  2HYE A;  3SFZ A;  3N0E A;  3N0D A;  4QL1 A;  3SBR A;  2B4E A;  2J57 G;  4CZX A;  2PM9 A;  1QNI A;  5EAP A;  5FKR A;  2IWF A;  3EI3 B;  3AL8 B;  4QT8 A;  1OMW B;  4G56 B;  4AOW A;  3A0F A;  3SLE D;  4FA5 D;  1S4U X;  3OL2 A;  4GM8 A;  2UZY B;  3JPX A;  1PGU A;  4ZOY A;  3EU7 A;  2H47 A;  3P4F A;  4K3I D;  5EMK B;  4PBZ A;  3I7P A;  3SCY A;  5IC7 A;  2QC5 A;  4GQ1 A;  3RLM D;  5HE1 B;  5EML B;  3RFG A;  1JOF A;  5GXI A;  3DXM C;  2IWK A;  1XHM A;  4O3T B;  3RN0 D;  2QXV A;  2PM6 B;  1Q47 A;  1GOT B;  2CE9 A;  4IMM A;  3FRX A;  2P9K C;  3IJ1 A;  2I0T A;  4X63 B;  3UVO A;  2AGX A;  4ES0 A;  2H6K A;  5GXH A;  4UI9 R;  2OK4 A;  4FB1 D;  3EI4 A;  2IUP A;  1MDA H;  5AJA A;  2I0R A;  1SQ9 A;  2P9P C;  4JSN C;  4H5J A;  3B7F A;  4A11 B;  3OTT A;  3V5W B;  4CY3 A;  2OK6 A;  3SWS D;  3AH8 B;  3IKO A;  2HJ4 A;  4A0A A;  4IA9 A;  1GG2 B;  3MKQ A;  4J73 A;  5CXB A;  4FA9 D;  1A0R B;  4JSX C;  4ZOZ A;  1TYQ C;  5IGQ A;  5H14 A;  4A09 B;  3ZWL B;  2YBA A;  3I7H A;  1K32 A;  2J55 H;  2CO0 A;  1GP2 B;  4A08 A;  3I2N A;  5FKQ A;  4GGA A;  2HXC A;  2HKM A;  3VA6 A;  5AMS A;  4XEI C;  1JMX B;  2G9A A;  1XIP A;  4JT6 C;  2G99 A;  2MTA H;  4L3G D;  4ERQ A;  4J86 A;  4O3U B;  4AEZ A;  2H68 A;  2I3T A;  2YNP A;  3EI2 A;  3DXK C;  2P9I C;  2XL2 A;  2H6Q A;  3JZG A;  4J8B A;  5K1C C;  4L9O A;  4YVD A;  4ZOV A;  3IJ0 A;  4E54 A;  1R5M A;  3OW8 A;  4HDJ A;  1JJU B;  2AGZ A;  3JZH A;  4R7A B;  3W15 A;  3MZK A;  5H1M A;  5IJ8 E;  3E0C A;  3FM0 A;  2PBI B;  3UVL A;  1K8K C;  2H3X A;  3RN1 D;  3PXS D;  4MK0 B;  3EI3 A;  3J80 g;  3VH0 A;  1P22 A;  1TBG A;  4J87 A;  3ULE C;  4BL0 A;  1XKS A;  5CXC B;  3UKR C;  1OLZ A;  3DM0 A;  4FA4 D;  4LG9 A;  3NVQ A;  4J84 A;  5IGO A;  3C75 H;  2GC7 A;  3JZN A;  3C5M A;  3DWL C;  5TF2 A;  4PXW A;  2PM9 B;  5EMM B;  1PI6 A;  4ZOX A;  2H9N A;  3JB9 L;  1L0Q A;  4ERZ A;  4U7A A;  3I8E A;  4N14 A;  4H5I A;  2IUQ A;  4D6V A;  3AL9 A;  4BUJ C;  4NSX A;  3PVU B;  1NR0 A;  3F3P A;  3SXT D;  2B5N A;  2XL3 A;  3KRW B;  2Z2N A;  4JSP C;  3I7O A;  2YB8 B;  3PXW D;  4J82 A;  4J77 A;  5C9Z B;  4EWR A;  5EM2 A;  3SVW D;  4JT5 C;  3SMR A;  4CC9 A;  2P9U C;  3JRO A;  4E5Z A;  5FLX g;  4I79 A;  4A2L A;  5A2Q g;  2TRC B;  2J56 H;  4CZV A;  2Z2O A;  3EI1 A;  3GRE A;  3MMY A;  4OZU A;  4Y7R A;  1RI6 A;  4O9D A;  2OVR B;  2XYI A;  2GC4 A;  5FKT A;  2CE8 A;  1FWX A;  3EI4 B;  2AH0 A;  4K3J B;  4A09 A;  5I5J A;  4GQ2 P;  2Q7Q A;  3BG1 A;  1N6D A;  2AGL A;  4O1Q D;  4FAN D;  4PSX B;  4PSW B;  2H6N A;  4L1Q D;  5SXM A;  5EAM A;  5B4W A;  4CI2 A;  3PSC B;  4A0B A;  4J8G A;  3C9C A;  3K26 A;  5KDO B;  2CNX A;  5AFU 3;  1ERJ A;  2AGY A;  4J79 A;  5EAL A;  4A0A B;  3MXX A;  3V7D B;  1N6F A;  4BH6 A;  3ODT A;  4JD2 C;  1VYH C;  4XYH A;  4XYI A;  1B9Y A;  1N6E A;  2H13 A;  3OKW A;  2OVQ B;  2P9L C;  3OKY A;  4ESG A;  4Y5R D;  4A08 B;  2Z2P A;  5EMJ B;  4CI3 A;  2YMU A;  1B9X A;  3MZL A;  5CYK A;  3UVN A;  5HQG A;  4D0K A;  4FA1 D;  2W18 A;  4CI1 A;  3C99 A;  5GSA A;  3IJC A;  3UKU C;  5GMK n;  2IUR A;  1YFQ A;  4X61 B;  4LG8 A;  3PSL A;  3UVK A;  2H14 A;  1SHY B;  5H17 A;  1PEV A;  5FA5 B;  3JRP A;  3AL8 A;  3EMH A;  3RSE C;  3F3F A;  5CXC A;  2AH1 A;  4X60 B;  3V9F A;  5TEF A;  5K19 A;  2BCJ B;  4E54 B;  1GXR A;  2B5L A;  4TZ4 A;  3KRX B;  3CFV A;  3SBQ A;  2H9M A;  4ZN4 A;  3CFS B;  3SHF A;  3I89 A;  2AGW A;  3NVX A;  4A7J A;  3UVM A;  4A2M A;  3GFC A;  4JSV C;  4LGN A;  3HFQ A;  1PBY B;  3I8C A;  3RFH A;  3SJL D;  3OL2 B;  4L3H D;  1MG3 A;  5IJ7 E;  2IAA A;  3BWS A;  2HKR A;  3DSM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...