2OIZA

Crystal structure of the tryptamine-derived (indol-3-acetamide)-ttq adduct of aromatic amine dehydrogenase
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
360
structure length
360
Chain Sequence
EVLTGGHSVSAPQENRIYVMDSVFMHLTESRVHVYDYTNGKFLGMVPTAFNGHVQVSNDGKKIYTMTTYHERITRGKRSDVVEVWDADKLTFEKEISLPPKRVQGLNYDGLFRQTTDGKFIVLQNASPATSIGIVDVAKGDYVEDVTAAAGCWSVIPQPNRPRSFMTICGDGGLLTINLGEDGKVASQSRSKQMFSVKDDPIFIAPALDKDKAHFVSYYGNVYSADFSGDEVKVDGPWSLLNDEDKAKNWVPGGYNLVGLHRASGRMYVFMHPDGKEGTHKFPAAEIWVMDTKTKQRVARIPGRDALSMTIDQQRNLMLTLDGGNVNVYDISQPEPKLLRTIEGAAEASLQVQFHPVGGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aromatic amine dehydrogenase, small subunit
publication title New insights into the reductive half-reaction mechanism of aromatic amine dehydrogenase revealed by reaction with carbinolamine substrates.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 96
structure length 360
sequence length 360
chains with identical sequence B
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2007-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2oizA01
3U4YA 3EI4A 3W15A 2UZXB 3DM0A 3BG1A 2YNOA 5HE2B 4ZN4A 4A08A 3JZHA 1SHYB 4E54A 3NVNA 3PXSD 3FRXA 4KFMB 5I5JA 3EWEA 3SBQA 2AH1A 4FAND 5IGOA 1A0RB 3IKOA 5GMKn 3DWLC 2GC7A 4PXWA 3UVLA 2OVRB 4FB1D 1S4UX 4R7AB 5HYNB 3I7OA 5HE1B 3SN6B 1QNIA 3I7NA 4ZOZA 2OIZA 1L0QA 1N6FA 4LGNA 3RRMC 1VYHC 1SQJA 1TBGA 5B4WA 5FKRA 3I89A 3RFHA 3PXWD 2AGWA 4D6VA 3SVWD 4CI3A 3MZKA 5EM2A 4A7JA 1R5MA 2I3TA 2XYIA 4Z8LA 4FHLA 5EAPA 4LG9A 2G9AA 3NVXA 1GXRA 5HQGA 4X61B 3K26A 2XL2A 4N14A 4X3EA 4H5IA 1K8KC 5TEFA 5H17A 4A09B 5AJAA 3BWSA 2I3SA 4Y7RA 3SMRA 5IT9g 3C75H 2IUQA 3MMYA 2PM9B 1N6EA 5EAMA 2Q7QA 2HJ4A 2P9IC 3FM0A 5FKQA 3UR4A 4QRJA 5IJ7E 2I0SA 2AQ5A 3OL2B 1GG2B 3OKWA 3EI1B 4J87A 3IIWA 4MK0B 4PC0A 3EMHA 1N6DA 2P9NC 2J57G 5CXCA 3AFCA 4H5JA 3UKRC 2IURA 1PBYB 1GP2B 3F3GA 3RLMD 3PE7A 3EI2B 4AEZA 3MXXA 3PSCB 4A0BB 2EBSA 3DSMA 3OKYA 4A2LA 1JOFA 5EARA 3KRWB 5AMSA 2HYEA 3JZNA 1Q47A 1GOTB 2PBIB 4O9DA 3VH0A 2P9PC 2MTAH 3SBRA 3AL8A 2TRCB 2OVPB 1ERJA 2H6QA 4LG8A 3UVKA 4PSWB 5TDHB 4GGCA 5I5IA 1B9YA 4XEIC 4XYIA 3GFCA 5TF2A 1SQ9A 2CO0C 4J77A 4NSXA 3L4MD 4J8GA 4ZOVA 3EI4B 5TEEA 4O1QD 2P9SC 3C9CA 3MZLA 3OKTA 5EMLB 3PVUB 1FWXA 2YNNA 3DXKC 1U4CA 4J0WA 4GZ8A 3B7FA 4QL1A 4JT5C 2G99A 4O3UB 4E54B 1MG3A 4CZVA 5SXMA 3F3FA 2YNPA 5GXIA 3V5WB 4A0AA 3OTTA 4GM8A 4CC9A 3P4FA 4CI8A 3VA6A 3PSLA 4FA9D 3SLED 2PM7B 1U2VC 3PXTD 1PEVA 2Z2OA 3JRPA 1OLZA 2H14A 5HE0B 2XU7A 3K27A 5IGQA 3AH8B 5GSAA 3I7KA 4OWRA 2H47A 1OMWB 3E0CA 4X63B 2CE9A 1NR0A 5H14A 5IJ8E 3ZWLB 2H9PA 4L1QD 4FA1D 5HE3B 3SCYA 2CN3A 3GREA 5CYKA 3ODTA 2YMUA 2Z2NA 2GNQA 4O45A 3RN0D 4U7AA 4JSPC 4PBZA 2H13A 2H68A 2H3XA 4YVDA 4GGAA 3IJCA 2IAAA 5FQDA 4J78A 4L3GD 4CZYA 2XL3A 2P9KC 3UVNA 4HDJA 2OK4A 2CO0A 3MKSB 4ZOYA 4EWRA 4FA4D 2BBKH 2W18A 2OK6A 3RN1D 3EI1A 4CY1A 4OZUA 2AGYA 1YFQA 3EI3A 3UVMA 4JSNC 4J0XA 3I7PA 4ERYA 2IWFA 3BG0A 5FA5B 3I2NA 5C9ZB 3SWSD 2HXCA 4CI1A 4TZ4A 4CY3A 3I7HA 4X60B 3EI2A 3N0EA 5H1MA 3RFGA 3IJ0A 4QQEA 4GQ2P 5CXBA 3V9FA 2CNXA 5EMJB 2IWKA 2P9LC 3DXMC 4GM9A 3C99A 4J84A 3C5MA 2AGLA 3AL8B 5EMMB 2P9UC 4L3HD 2YBAA 3AL9A 2H6KA 4CZXA 3CIKB 4A11B 1MG2A 3IIYA 5C2WB 2IUPA 5K1CC 3A0FA 4J86A 4JSVC 3JB9L 4G56B 4E5ZA 2HKMA 1XIPA 3RSEC 5A2Qg 3L4OD 2HESX 3CFSB 4J82A 5EMKB 4A08B 4U1EI 3JROA 4GM3A 3ULEC 5AFU3 5C2VB 1XHMA 2QXVA 4JSXC 4FAVD 2YB8B 2HKRA 4JXMA 4A2MA 4A0AB 4BUJC 1JJUB 4D0KA 4IMMA 5K19A 4CI2A 4GMBA 3J81g 4IA9A 4J8BA 3F3PA 2IUVA 4K3JB 3FGBA 5GXHA 1P22A 2B5NA 3JPXA 2B5LA 1PI6A 4ES0A 4JD2C 2OJYA 4GGDA 4BL0A 2QC5A 5I5MA 5EM2B 3ORVD 3OW8A 4PNKB 1XKSA 2H9NA 4FWWA 4AOWA 1MDAH 2BCJB 4J81A 4L9OA 5IC7A 2AH0A 1JMXB 4QT8A 3I8EA 5THAA 2CE8A 3NVQA 4J79A 4A09A 3IJ1A 2OVQB 5JWZA 1TYQC 5CYKB 4K3ID 1B9XA 2H6NA 2AGXA 5EALA 5KDOB 2B4EA 3V7DB 2I0TA 3UKUC 3SBPA 2PM9A 4XYHA 3EU7A 2CN2A 3HFQA 5FLXg 2Z2PA 3OL2A 4PBYA 4ERZA 4CY2A 1PGUA 5FKTA 2O9KA 5CXCB 2B5MA 2AGZA 4BH6A 3EI3B 1K32A 2H9LA 4GQBB 4J73A 4A0BA 5FXYA 3OKYB 3N0DA 4FA5D 3JZGA 2GC4A 4CY5A 2J56H 4I79A 1RI6A 3UVOA 2I0RA 4ESGA 3MKQA 3PVWB 3SFZA 5CXBB 3SXTD 3I8CA 4O3TB 2J55H 3JAMg 1JMZB 4JT6C 5FKSA 4GQ1A 4Y5RD 3CFVA 3I7LA 3VGZA 3EG6A 4ZOXA 3SJLD 4ERQA 3SHFA 2UZYB 3J80g 4PSXB 2PM6B 3KRXB 1NEXB 4UI9R 2H9MA 4A11A 2HJBA 4E5ZB 3RMZD
chains in the Genus database with same CATH superfamily
2VZ3A 4WJKA 3U4YA 3EI4A 3MVDK 3W15A 4NENA 2UZXB 3DM0A 4BP8A 3BG1A 2YNOA 5HE2B 4ZN4A 3O4GA 2VDQA 4A08A 3JZHA 1SHYB 4E54A 3NVNA 3PXSD 4RE5A 3FRXA 4KFMB 1O6FA 3ZDZA 4WK4A 5I5JA 2QZPA 3EWEA 4DNWA 2EICA 3SBQA 2AH1A 4FAND 5IGOA 1A0RB 3IKOA 5GMKn 3DWLC 2GC7A 4PXWA 3UVLA 2OVRB 4FB1D 1S4UX 1VZ2A 2QR5A 4R7AB 5HYNB 1C9IA 3I7OA 3IULA 5HE1B 1QNIA 3SN6B 3I7NA 3VI4A 4ZOZA 2OIZA 1L0QA 1N6FA 4LGNA 3RRMC 1C9LA 1VYHC 1SQJA 1TBGA 3EQ7A 5B4WA 1GOGA 5FKRA 3I89A 3RFHA 5C92A 3PXWD 2AGWA 4D6VA 3SVWD 4CI3A 3MZKA 5EM2A 4A7JA 1R5MA 2I3TA 2XYIA 4L1MA 4Z8LA 4UM8A 3KCIA 4FHLA 5EAPA 4LG9A 2G9AA 3NVXA 1GXRA 4BCBA 5HQGA 4X61B 3K26A 1JV2A 2XL2A 4NC4A 4N14A 4X3EA 4H5IA 1K8KC 5TEFA 5H17A 4A09B 3GC3B 5AJAA 3O4HA 3BWSA 2I3SA 4Y7RA 3SMRA 5IT9g 3C75H 2IUQA 3MMYA 2PM9B 1N6EA 5EAMA 2Q7QA 2HJ4A 2P9IC 3FM0A 5FKQA 3UR4A 2EIBA 4QRJA 5IJ7E 5M5UA 2I0SA 2AQ5A 3OL2B 1GG2B 1QFMA 3OKWA 2BKLA 3ZE2A 3EI1B 4J87A 3IIWA 4MK0B 4PC0A 3IJEA 3EMHA 1N6DA 2HU8A 3IUNA 2P9NC 2J57G 3ZDXA 3IURA 5CXCA 3AFCA 3EQ8A 4H5JA 3UKRC 3QHYB 4AMYA 2XZGA 2IURA 1PBYB 1GP2B 3F3GA 1H2ZA 4QAMA 3RLMD 3PE7A 3EI2B 4AEZA 3MXXA 3PSCB 4A0BB 1U8CA 3VI3A 2EBSA 4AX4A 3DSMA 3OKYA 1VE6A 4A2LA 4RE6A 1JOFA 5EARA 3KRWB 3NIDA 5AMSA 2HYEA 3JZNA 2VDRA 1Q47A 1GOTB 2PBIB 4O9DA 3VH0A 2P9PC 2MTAH 3SBRA 3AL8A 4G55A 2TRCB 2OVPB 1ERJA 4JHPC 2H6QA 1A12A 4LG8A 3NIFA 3UVKA 4PSWB 5TDHB 4GGCA 5I5IA 1B9YA 2XDWA 4XEIC 4XYIA 3GFCA 5TF2A 1SQ9A 2CO0C 4AN1A 4J77A 4NSXA 3L4MD 4J8GA 4ZOVA 3EI4B 5TEEA 4O1QD 2P9SC 3C9CA 3MZLA 3OKTA 5EMLB 3PVUB 1FWXA 2YNNA 3DXKC 1U4CA 4J0WA 4UM9A 4GZ8A 2XE4A 3B7FA 4QL1A 4JT5C 2G99A 4O3UB 4E54B 1MG3A 5FFOA 4CZVA 5SXMA 3F3FA 2WQ8A 2YNPA 5GXIA 2VDMA 3V5WB 4A0AA 2JKXA 3OTTA 4GM8A 1YR2A 4CC9A 3IUQA 3P4FA 4CI8A 3VA6A 3PSLA 4FA9D 3SLED 1E8NA 2PM7B 1U2VC 3PXTD 1PEVA 2Z2OA 4AMZA 4JHNA 1JTDB 3JRPA 1OLZA 2H14A 5HE0B 3OF7A 2XU7A 3K27A 5IGQA 3AH8B 5GSAA 3I7KA 4OWRA 2H47A 5E6RA 1OMWB 3E0CA 1H2WA 4X63B 1M1XA 2CE9A 1NR0A 5H14A 5IJ8E 4O02A 3ZWLB 2H9PA 4L1QD 4FA1D 5HE3B 3SCYA 2CN3A 3EQ9A 3GREA 4D9SA 5CYKA 3IUJA 3ODTA 2YMUA 2Z2NA 3V4VA 2GNQA 4O45A 1T2XA 3RN0D 1QFSA 4U7AA 4JSPC 4PBZA 2H13A 2H68A 1VE7A 2H3XA 4YVDA 4GGAA 3IJCA 2IAAA 5FQDA 4J78A 3O4JA 4L3GD 4CZYA 2XL3A 2P9KC 4Z7OA 3UVNA 4HDJA 2OK4A 3FCSA 2CO0A 3MKSB 4ZOYA 4EWRA 4FA4D 2BBKH 2W18A 2OK6A 4DNUA 3RN1D 3EI1A 4CY1A 4OZUA 2AGYA 1YFQA 3EI3A 3UVMA 4JSNC 4J0XA 1UOQA 1L5GA 3I7PA 4ERYA 2IWFA 3BG0A 5FA5B 1E5TA 3I2NA 2VDNA 5C9ZB 4AN0A 3SWSD 5M61A 2HXCA 4CI1A 4TZ4A 4CY3A 3I7HA 4X60B 3EI2A 3N0EA 5H1MA 3RFGA 3QI0A 3IJ0A 4QQEA 4GQ2P 5CXBA 3V9FA 2CNXA 4G1EA 5EMJB 2VDKA 2IWKA 2P9LC 4NBMA 1K3IA 3DDUA 3DXMC 4GM9A 5M5SA 3C99A 4J84A 3T3MA 3C5MA 3NIGA 2AGLA 3AL8B 5EMMB 1GOHA 2P9UC 3K6SA 5M5RA 4L3HD 2YBAA 4BCCA 2VDOA 3AL9A 2H6KA 4CZXA 3CIKB 4A11B 1MG2A 3IIYA 5C2WB 2IUPA 5K1CC 3A0FA 4J86A 4JSVC 4BCDA 3JB9L 4G56B 4E5ZA 2HKMA 1XIPA 2HU7A 3RSEC 5A2Qg 3L4OD 2HESX 3CFSB 4J82A 5EMKB 2EIEA 1BPOA 4A08B 4U1EI 3JROA 4GM3A 1UOOA 1TYEA 3ULEC 5AFU3 4NAAA 4MMYA 5C2VB 1XHMA 2QXVA 4JSXC 5E6UA 2YB8B 1UOPA 2HKRA 4FAVD 3FCUA 4MMZA 1E8MA 4JXMA 4A2MA 4A0AB 4BUJC 4Z7NA 1JJUB 4D0KA 4IMMA 3IVMA 4CI2A 4GMBA 5K19A 3J81g 2HU5A 4IA9A 4J8BA 3F3PA 2IUVA 4K3JB 3FGBA 5GXHA 1P22A 2B5NA 3JPXA 2B5LA 1PI6A 4ES0A 4JD2C 2OJYA 4GGDA 4BL0A 2QC5A 5I5MA 5E6SA 5HDBA 4BP9A 5EM2B 3ORVD 3OW8A 4Z7QA 4PNKB 2VZ1A 1XKSA 2H9NA 1H2XA 4FWWA 4AOWA 1MDAH 2BCJB 4J81A 4L9OA 5IC7A 2AH0A 1JMXB 4QT8A 3I8EA 5THAA 5M5TA 2CE8A 3NVQA 4J79A 4A09A 3IJ1A 2OVQB 5JWZA 4DNVA 1TYQC 5CYKB 4K3ID 1B9XA 2H6NA 2AGXA 5EALA 5KDOB 2B4EA 3V7DB 2I0TA 3UKUC 4IRZA 3SBPA 2PM9A 4XYHA 3EU7A 2CN2A 3HFQA 5M5VA 5FLXg 2Z2PA 3OL2A 4PBYA 4ERZA 3ZE1A 4CY2A 1PGUA 1UTCA 5FKTA 3O4IA 2O9KA 5CXCB 2B5MA 3IUMA 2AGZA 3GD1I 4BH6A 1O6GA 1H2YA 4MMXA 2VDPA 3EI3B 1K32A 2H9LA 3T3PA 4GQBB 4J73A 2VDLA 5FXYA 4A0BA 3OKYB 3N0DA 4FA5D 3JZGA 2EIDA 2GC4A 5FFGA 4CY5A 4O2WA 2J56H 4I79A 1I2MB 1RI6A 3MUNA 5C86A 3UVOA 2I0RA 4ESGA 3MKQA 3PVWB 4G1MA 2VC2A 3SFZA 5CXBB 3SXTD 3I8CA 4O3TB 2J55H 3JAMg 1JMZB 1VZ3A 4WK2A 4JT6C 5FKSA 4GQ1A 4WK0A 4Y5RD 3V4PA 3CFVA 3I7LA 3VGZA 3EG6A 4ZOXA 3SJLD 4ERQA 3ZDYA 3SHFA 2UZYB 3J80g 4PSXB 2PM6B 3ZE0A 3KRXB 1NEXB 4UI9R 3K72A 2H9MA 4A11A 3K71A 1GOFA 3MUOA 2HJBA 4E5ZB 3RMZD
chains in the Genus database with same CATH topology
3U4YA 3EI4A 3W15A 2UZXB 3DM0A 3BG1A 2YNOA 5HE2B 4ZN4A 4A08A 3JZHA 1SHYB 4E54A 3NVNA 3PXSD 3FRXA 4KFMB 5I5JA 3EWEA 3SBQA 2AH1A 4FAND 5IGOA 1A0RB 3IKOA 5GMKn 3DWLC 2GC7A 4PXWA 3UVLA 2OVRB 4FB1D 1S4UX 4R7AB 5HYNB 3I7OA 5HE1B 3SN6B 1QNIA 3I7NA 4ZOZA 2OIZA 1L0QA 1N6FA 4LGNA 3RRMC 1VYHC 1SQJA 1TBGA 5B4WA 5FKRA 3I89A 3RFHA 3PXWD 2AGWA 4D6VA 3SVWD 4CI3A 3MZKA 5EM2A 4A7JA 1R5MA 2I3TA 2XYIA 4Z8LA 4FHLA 5EAPA 4LG9A 2G9AA 3NVXA 1GXRA 5HQGA 4X61B 3K26A 2XL2A 4N14A 4X3EA 4H5IA 1K8KC 5TEFA 5H17A 4A09B 5AJAA 3BWSA 2I3SA 4Y7RA 3SMRA 5IT9g 3C75H 2IUQA 3MMYA 2PM9B 1N6EA 5EAMA 2Q7QA 2HJ4A 2P9IC 3FM0A 5FKQA 3UR4A 4QRJA 5IJ7E 2I0SA 2AQ5A 3OL2B 1GG2B 3OKWA 3EI1B 4J87A 3IIWA 4MK0B 4PC0A 3EMHA 1N6DA 2P9NC 2J57G 5CXCA 3AFCA 4H5JA 3UKRC 2IURA 1PBYB 1GP2B 3F3GA 3RLMD 3PE7A 3EI2B 4AEZA 3MXXA 3PSCB 4A0BB 2EBSA 3DSMA 3OKYA 4A2LA 1JOFA 5EARA 3KRWB 5AMSA 2HYEA 3JZNA 1Q47A 1GOTB 2PBIB 4O9DA 3VH0A 2P9PC 2MTAH 3SBRA 3AL8A 2TRCB 2OVPB 1ERJA 2H6QA 4LG8A 3UVKA 4PSWB 5TDHB 4GGCA 5I5IA 1B9YA 4XEIC 4XYIA 3GFCA 5TF2A 1SQ9A 2CO0C 4J77A 4NSXA 3L4MD 4J8GA 4ZOVA 3EI4B 5TEEA 4O1QD 2P9SC 3C9CA 3MZLA 3OKTA 5EMLB 3PVUB 1FWXA 2YNNA 3DXKC 1U4CA 4J0WA 4GZ8A 3B7FA 4QL1A 4JT5C 2G99A 4O3UB 4E54B 1MG3A 4CZVA 5SXMA 3F3FA 2YNPA 5GXIA 3V5WB 4A0AA 3OTTA 4GM8A 4CC9A 3P4FA 4CI8A 3VA6A 3PSLA 4FA9D 3SLED 2PM7B 1U2VC 3PXTD 1PEVA 2Z2OA 3JRPA 1OLZA 2H14A 5HE0B 2XU7A 3K27A 5IGQA 3AH8B 5GSAA 3I7KA 4OWRA 2H47A 1OMWB 3E0CA 4X63B 2CE9A 1NR0A 5H14A 5IJ8E 3ZWLB 2H9PA 4L1QD 4FA1D 5HE3B 3SCYA 2CN3A 3GREA 5CYKA 3ODTA 2YMUA 2Z2NA 2GNQA 4O45A 3RN0D 4U7AA 4JSPC 4PBZA 2H13A 2H68A 2H3XA 4YVDA 4GGAA 3IJCA 2IAAA 5FQDA 4J78A 4L3GD 4CZYA 2XL3A 2P9KC 3UVNA 4HDJA 2OK4A 2CO0A 3MKSB 4ZOYA 4EWRA 4FA4D 2BBKH 2W18A 2OK6A 3RN1D 3EI1A 4CY1A 4OZUA 2AGYA 1YFQA 3EI3A 3UVMA 4JSNC 4J0XA 3I7PA 4ERYA 2IWFA 3BG0A 5FA5B 3I2NA 5C9ZB 3SWSD 2HXCA 4CI1A 4TZ4A 4CY3A 3I7HA 4X60B 3EI2A 3N0EA 5H1MA 3RFGA 3IJ0A 4QQEA 4GQ2P 5CXBA 3V9FA 2CNXA 5EMJB 2IWKA 2P9LC 3DXMC 4GM9A 3C99A 4J84A 3C5MA 2AGLA 3AL8B 5EMMB 2P9UC 4L3HD 2YBAA 3AL9A 2H6KA 4CZXA 3CIKB 4A11B 1MG2A 3IIYA 5C2WB 2IUPA 5K1CC 3A0FA 4J86A 4JSVC 3JB9L 4G56B 4E5ZA 2HKMA 1XIPA 3RSEC 5A2Qg 3L4OD 2HESX 3CFSB 4J82A 5EMKB 4A08B 4U1EI 3JROA 4GM3A 3ULEC 5AFU3 5C2VB 1XHMA 2QXVA 4JSXC 4FAVD 2YB8B 2HKRA 4JXMA 4A2MA 4A0AB 4BUJC 1JJUB 4D0KA 4IMMA 5K19A 4CI2A 4GMBA 3J81g 4IA9A 4J8BA 3F3PA 2IUVA 4K3JB 3FGBA 5GXHA 1P22A 2B5NA 3JPXA 2B5LA 1PI6A 4ES0A 4JD2C 2OJYA 4GGDA 4BL0A 2QC5A 5I5MA 5EM2B 3ORVD 3OW8A 4PNKB 1XKSA 2H9NA 4FWWA 4AOWA 1MDAH 2BCJB 4J81A 4L9OA 5IC7A 2AH0A 1JMXB 4QT8A 3I8EA 5THAA 2CE8A 3NVQA 4J79A 4A09A 3IJ1A 2OVQB 5JWZA 1TYQC 5CYKB 4K3ID 1B9XA 2H6NA 2AGXA 5EALA 5KDOB 2B4EA 3V7DB 2I0TA 3UKUC 3SBPA 2PM9A 4XYHA 3EU7A 2CN2A 3HFQA 5FLXg 2Z2PA 3OL2A 4PBYA 4ERZA 4CY2A 1PGUA 5FKTA 2O9KA 5CXCB 2B5MA 2AGZA 4BH6A 3EI3B 1K32A 2H9LA 4GQBB 4J73A 4A0BA 5FXYA 3OKYB 3N0DA 4FA5D 3JZGA 2GC4A 4CY5A 2J56H 4I79A 1RI6A 3UVOA 2I0RA 4ESGA 3MKQA 3PVWB 3SFZA 5CXBB 3SXTD 3I8CA 4O3TB 2J55H 3JAMg 1JMZB 4JT6C 5FKSA 4GQ1A 4Y5RD 3CFVA 3I7LA 3VGZA 3EG6A 4ZOXA 3SJLD 4ERQA 3SHFA 2UZYB 3J80g 4PSXB 2PM6B 3KRXB 1NEXB 4UI9R 2H9MA 4A11A 2HJBA 4E5ZB 3RMZD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U4Y A;  3EI4 A;  3W15 A;  2UZX B;  3DM0 A;  3BG1 A;  2YNO A;  5HE2 B;  4ZN4 A;  4A08 A;  3JZH A;  1SHY B;  4E54 A;  3NVN A;  3PXS D;  3FRX A;  4KFM B;  5I5J A;  3EWE A;  3SBQ A;  2AH1 A;  4FAN D;  5IGO A;  1A0R B;  3IKO A;  5GMK n;  3DWL C;  2GC7 A;  4PXW A;  3UVL A;  2OVR B;  4FB1 D;  1S4U X;  4R7A B;  5HYN B;  3I7O A;  5HE1 B;  3SN6 B;  1QNI A;  3I7N A;  4ZOZ A;  2OIZ A;  1L0Q A;  1N6F A;  4LGN A;  3RRM C;  1VYH C;  1SQJ A;  1TBG A;  5B4W A;  5FKR A;  3I89 A;  3RFH A;  3PXW D;  2AGW A;  4D6V A;  3SVW D;  4CI3 A;  3MZK A;  5EM2 A;  4A7J A;  1R5M A;  2I3T A;  2XYI A;  4Z8L A;  4FHL A;  5EAP A;  4LG9 A;  2G9A A;  3NVX A;  1GXR A;  5HQG A;  4X61 B;  3K26 A;  2XL2 A;  4N14 A;  4X3E A;  4H5I A;  1K8K C;  5TEF A;  5H17 A;  4A09 B;  5AJA A;  3BWS A;  2I3S A;  4Y7R A;  3SMR A;  5IT9 g;  3C75 H;  2IUQ A;  3MMY A;  2PM9 B;  1N6E A;  5EAM A;  2Q7Q A;  2HJ4 A;  2P9I C;  3FM0 A;  5FKQ A;  3UR4 A;  4QRJ A;  5IJ7 E;  2I0S A;  2AQ5 A;  3OL2 B;  1GG2 B;  3OKW A;  3EI1 B;  4J87 A;  3IIW A;  4MK0 B;  4PC0 A;  3EMH A;  1N6D A;  2P9N C;  2J57 G;  5CXC A;  3AFC A;  4H5J A;  3UKR C;  2IUR A;  1PBY B;  1GP2 B;  3F3G A;  3RLM D;  3PE7 A;  3EI2 B;  4AEZ A;  3MXX A;  3PSC B;  4A0B B;  2EBS A;  3DSM A;  3OKY A;  4A2L A;  1JOF A;  5EAR A;  3KRW B;  5AMS A;  2HYE A;  3JZN A;  1Q47 A;  1GOT B;  2PBI B;  4O9D A;  3VH0 A;  2P9P C;  2MTA H;  3SBR A;  3AL8 A;  2TRC B;  2OVP B;  1ERJ A;  2H6Q A;  4LG8 A;  3UVK A;  4PSW B;  5TDH B;  4GGC A;  5I5I A;  1B9Y A;  4XEI C;  4XYI A;  3GFC A;  5TF2 A;  1SQ9 A;  2CO0 C;  4J77 A;  4NSX A;  3L4M D;  4J8G A;  4ZOV A;  3EI4 B;  5TEE A;  4O1Q D;  2P9S C;  3C9C A;  3MZL A;  3OKT A;  5EML B;  3PVU B;  1FWX A;  2YNN A;  3DXK C;  1U4C A;  4J0W A;  4GZ8 A;  3B7F A;  4QL1 A;  4JT5 C;  2G99 A;  4O3U B;  4E54 B;  1MG3 A;  4CZV A;  5SXM A;  3F3F A;  2YNP A;  5GXI A;  3V5W B;  4A0A A;  3OTT A;  4GM8 A;  4CC9 A;  3P4F A;  4CI8 A;  3VA6 A;  3PSL A;  4FA9 D;  3SLE D;  2PM7 B;  1U2V C;  3PXT D;  1PEV A;  2Z2O A;  3JRP A;  1OLZ A;  2H14 A;  5HE0 B;  2XU7 A;  3K27 A;  5IGQ A;  3AH8 B;  5GSA A;  3I7K A;  4OWR A;  2H47 A;  1OMW B;  3E0C A;  4X63 B;  2CE9 A;  1NR0 A;  5H14 A;  5IJ8 E;  3ZWL B;  2H9P A;  4L1Q D;  4FA1 D;  5HE3 B;  3SCY A;  2CN3 A;  3GRE A;  5CYK A;  3ODT A;  2YMU A;  2Z2N A;  2GNQ A;  4O45 A;  3RN0 D;  4U7A A;  4JSP C;  4PBZ A;  2H13 A;  2H68 A;  2H3X A;  4YVD A;  4GGA A;  3IJC A;  2IAA A;  5FQD A;  4J78 A;  4L3G D;  4CZY A;  2XL3 A;  2P9K C;  3UVN A;  4HDJ A;  2OK4 A;  2CO0 A;  3MKS B;  4ZOY A;  4EWR A;  4FA4 D;  2BBK H;  2W18 A;  2OK6 A;  3RN1 D;  3EI1 A;  4CY1 A;  4OZU A;  2AGY A;  1YFQ A;  3EI3 A;  3UVM A;  4JSN C;  4J0X A;  3I7P A;  4ERY A;  2IWF A;  3BG0 A;  5FA5 B;  3I2N A;  5C9Z B;  3SWS D;  2HXC A;  4CI1 A;  4TZ4 A;  4CY3 A;  3I7H A;  4X60 B;  3EI2 A;  3N0E A;  5H1M A;  3RFG A;  3IJ0 A;  4QQE A;  4GQ2 P;  5CXB A;  3V9F A;  2CNX A;  5EMJ B;  2IWK A;  2P9L C;  3DXM C;  4GM9 A;  3C99 A;  4J84 A;  3C5M A;  2AGL A;  3AL8 B;  5EMM B;  2P9U C;  4L3H D;  2YBA A;  3AL9 A;  2H6K A;  4CZX A;  3CIK B;  4A11 B;  1MG2 A;  3IIY A;  5C2W B;  2IUP A;  5K1C C;  3A0F A;  4J86 A;  4JSV C;  3JB9 L;  4G56 B;  4E5Z A;  2HKM A;  1XIP A;  3RSE C;  5A2Q g;  3L4O D;  2HES X;  3CFS B;  4J82 A;  5EMK B;  4A08 B;  4U1E I;  3JRO A;  4GM3 A;  3ULE C;  5AFU 3;  5C2V B;  1XHM A;  2QXV A;  4JSX C;  4FAV D;  2YB8 B;  2HKR A;  4JXM A;  4A2M A;  4A0A B;  4BUJ C;  1JJU B;  4D0K A;  4IMM A;  5K19 A;  4CI2 A;  4GMB A;  3J81 g;  4IA9 A;  4J8B A;  3F3P A;  2IUV A;  4K3J B;  3FGB A;  5GXH A;  1P22 A;  2B5N A;  3JPX A;  2B5L A;  1PI6 A;  4ES0 A;  4JD2 C;  2OJY A;  4GGD A;  4BL0 A;  2QC5 A;  5I5M A;  5EM2 B;  3ORV D;  3OW8 A;  4PNK B;  1XKS A;  2H9N A;  4FWW A;  4AOW A;  1MDA H;  2BCJ B;  4J81 A;  4L9O A;  5IC7 A;  2AH0 A;  1JMX B;  4QT8 A;  3I8E A;  5THA A;  2CE8 A;  3NVQ A;  4J79 A;  4A09 A;  3IJ1 A;  2OVQ B;  5JWZ A;  1TYQ C;  5CYK B;  4K3I D;  1B9X A;  2H6N A;  2AGX A;  5EAL A;  5KDO B;  2B4E A;  3V7D B;  2I0T A;  3UKU C;  3SBP A;  2PM9 A;  4XYH A;  3EU7 A;  2CN2 A;  3HFQ A;  5FLX g;  2Z2P A;  3OL2 A;  4PBY A;  4ERZ A;  4CY2 A;  1PGU A;  5FKT A;  2O9K A;  5CXC B;  2B5M A;  2AGZ A;  4BH6 A;  3EI3 B;  1K32 A;  2H9L A;  4GQB B;  4J73 A;  4A0B A;  5FXY A;  3OKY B;  3N0D A;  4FA5 D;  3JZG A;  2GC4 A;  4CY5 A;  2J56 H;  4I79 A;  1RI6 A;  3UVO A;  2I0R A;  4ESG A;  3MKQ A;  3PVW B;  3SFZ A;  5CXB B;  3SXT D;  3I8C A;  4O3T B;  2J55 H;  3JAM g;  1JMZ B;  4JT6 C;  5FKS A;  4GQ1 A;  4Y5R D;  3CFV A;  3I7L A;  3VGZ A;  3EG6 A;  4ZOX A;  3SJL D;  4ERQ A;  3SHF A;  2UZY B;  3J80 g;  4PSX B;  2PM6 B;  3KRX B;  1NEX B;  4UI9 R;  2H9M A;  4A11 A;  2HJB A;  4E5Z B;  3RMZ D; 
#chains in the Genus database with same CATH topology
 2VZ3 A;  4WJK A;  3U4Y A;  3EI4 A;  3MVD K;  3W15 A;  4NEN A;  2UZX B;  3DM0 A;  4BP8 A;  3BG1 A;  2YNO A;  5HE2 B;  4ZN4 A;  3O4G A;  2VDQ A;  4A08 A;  3JZH A;  1SHY B;  4E54 A;  3NVN A;  3PXS D;  4RE5 A;  3FRX A;  4KFM B;  1O6F A;  3ZDZ A;  4WK4 A;  5I5J A;  2QZP A;  3EWE A;  4DNW A;  2EIC A;  3SBQ A;  2AH1 A;  4FAN D;  5IGO A;  1A0R B;  3IKO A;  5GMK n;  3DWL C;  2GC7 A;  4PXW A;  3UVL A;  2OVR B;  4FB1 D;  1S4U X;  1VZ2 A;  2QR5 A;  4R7A B;  5HYN B;  1C9I A;  3I7O A;  3IUL A;  5HE1 B;  1QNI A;  3SN6 B;  3I7N A;  3VI4 A;  4ZOZ A;  2OIZ A;  1L0Q A;  1N6F A;  4LGN A;  3RRM C;  1C9L A;  1VYH C;  1SQJ A;  1TBG A;  3EQ7 A;  5B4W A;  1GOG A;  5FKR A;  3I89 A;  3RFH A;  5C92 A;  3PXW D;  2AGW A;  4D6V A;  3SVW D;  4CI3 A;  3MZK A;  5EM2 A;  4A7J A;  1R5M A;  2I3T A;  2XYI A;  4L1M A;  4Z8L A;  4UM8 A;  3KCI A;  4FHL A;  5EAP A;  4LG9 A;  2G9A A;  3NVX A;  1GXR A;  4BCB A;  5HQG A;  4X61 B;  3K26 A;  1JV2 A;  2XL2 A;  4NC4 A;  4N14 A;  4X3E A;  4H5I A;  1K8K C;  5TEF A;  5H17 A;  4A09 B;  3GC3 B;  5AJA A;  3O4H A;  3BWS A;  2I3S A;  4Y7R A;  3SMR A;  5IT9 g;  3C75 H;  2IUQ A;  3MMY A;  2PM9 B;  1N6E A;  5EAM A;  2Q7Q A;  2HJ4 A;  2P9I C;  3FM0 A;  5FKQ A;  3UR4 A;  2EIB A;  4QRJ A;  5IJ7 E;  5M5U A;  2I0S A;  2AQ5 A;  3OL2 B;  1GG2 B;  1QFM A;  3OKW A;  2BKL A;  3ZE2 A;  3EI1 B;  4J87 A;  3IIW A;  4MK0 B;  4PC0 A;  3IJE A;  3EMH A;  1N6D A;  2HU8 A;  3IUN A;  2P9N C;  2J57 G;  3ZDX A;  3IUR A;  5CXC A;  3AFC A;  3EQ8 A;  4H5J A;  3UKR C;  3QHY B;  4AMY A;  2XZG A;  2IUR A;  1PBY B;  1GP2 B;  3F3G A;  1H2Z A;  4QAM A;  3RLM D;  3PE7 A;  3EI2 B;  4AEZ A;  3MXX A;  3PSC B;  4A0B B;  1U8C A;  3VI3 A;  2EBS A;  4AX4 A;  3DSM A;  3OKY A;  1VE6 A;  4A2L A;  4RE6 A;  1JOF A;  5EAR A;  3KRW B;  3NID A;  5AMS A;  2HYE A;  3JZN A;  2VDR A;  1Q47 A;  1GOT B;  2PBI B;  4O9D A;  3VH0 A;  2P9P C;  2MTA H;  3SBR A;  3AL8 A;  4G55 A;  2TRC B;  2OVP B;  1ERJ A;  4JHP C;  2H6Q A;  1A12 A;  4LG8 A;  3NIF A;  3UVK A;  4PSW B;  5TDH B;  4GGC A;  5I5I A;  1B9Y A;  2XDW A;  4XEI C;  4XYI A;  3GFC A;  5TF2 A;  1SQ9 A;  2CO0 C;  4AN1 A;  4J77 A;  4NSX A;  3L4M D;  4J8G A;  4ZOV A;  3EI4 B;  5TEE A;  4O1Q D;  2P9S C;  3C9C A;  3MZL A;  3OKT A;  5EML B;  3PVU B;  1FWX A;  2YNN A;  3DXK C;  1U4C A;  4J0W A;  4UM9 A;  4GZ8 A;  2XE4 A;  3B7F A;  4QL1 A;  4JT5 C;  2G99 A;  4O3U B;  4E54 B;  1MG3 A;  5FFO A;  4CZV A;  5SXM A;  3F3F A;  2WQ8 A;  2YNP A;  5GXI A;  2VDM A;  3V5W B;  4A0A A;  2JKX A;  3OTT A;  4GM8 A;  1YR2 A;  4CC9 A;  3IUQ A;  3P4F A;  4CI8 A;  3VA6 A;  3PSL A;  4FA9 D;  3SLE D;  1E8N A;  2PM7 B;  1U2V C;  3PXT D;  1PEV A;  2Z2O A;  4AMZ A;  4JHN A;  1JTD B;  3JRP A;  1OLZ A;  2H14 A;  5HE0 B;  3OF7 A;  2XU7 A;  3K27 A;  5IGQ A;  3AH8 B;  5GSA A;  3I7K A;  4OWR A;  2H47 A;  5E6R A;  1OMW B;  3E0C A;  1H2W A;  4X63 B;  1M1X A;  2CE9 A;  1NR0 A;  5H14 A;  5IJ8 E;  4O02 A;  3ZWL B;  2H9P A;  4L1Q D;  4FA1 D;  5HE3 B;  3SCY A;  2CN3 A;  3EQ9 A;  3GRE A;  4D9S A;  5CYK A;  3IUJ A;  3ODT A;  2YMU A;  2Z2N A;  3V4V A;  2GNQ A;  4O45 A;  1T2X A;  3RN0 D;  1QFS A;  4U7A A;  4JSP C;  4PBZ A;  2H13 A;  2H68 A;  1VE7 A;  2H3X A;  4YVD A;  4GGA A;  3IJC A;  2IAA A;  5FQD A;  4J78 A;  3O4J A;  4L3G D;  4CZY A;  2XL3 A;  2P9K C;  4Z7O A;  3UVN A;  4HDJ A;  2OK4 A;  3FCS A;  2CO0 A;  3MKS B;  4ZOY A;  4EWR A;  4FA4 D;  2BBK H;  2W18 A;  2OK6 A;  4DNU A;  3RN1 D;  3EI1 A;  4CY1 A;  4OZU A;  2AGY A;  1YFQ A;  3EI3 A;  3UVM A;  4JSN C;  4J0X A;  1UOQ A;  1L5G A;  3I7P A;  4ERY A;  2IWF A;  3BG0 A;  5FA5 B;  1E5T A;  3I2N A;  2VDN A;  5C9Z B;  4AN0 A;  3SWS D;  5M61 A;  2HXC A;  4CI1 A;  4TZ4 A;  4CY3 A;  3I7H A;  4X60 B;  3EI2 A;  3N0E A;  5H1M A;  3RFG A;  3QI0 A;  3IJ0 A;  4QQE A;  4GQ2 P;  5CXB A;  3V9F A;  2CNX A;  4G1E A;  5EMJ B;  2VDK A;  2IWK A;  2P9L C;  4NBM A;  1K3I A;  3DDU A;  3DXM C;  4GM9 A;  5M5S A;  3C99 A;  4J84 A;  3T3M A;  3C5M A;  3NIG A;  2AGL A;  3AL8 B;  5EMM B;  1GOH A;  2P9U C;  3K6S A;  5M5R A;  4L3H D;  2YBA A;  4BCC A;  2VDO A;  3AL9 A;  2H6K A;  4CZX A;  3CIK B;  4A11 B;  1MG2 A;  3IIY A;  5C2W B;  2IUP A;  5K1C C;  3A0F A;  4J86 A;  4JSV C;  4BCD A;  3JB9 L;  4G56 B;  4E5Z A;  2HKM A;  1XIP A;  2HU7 A;  3RSE C;  5A2Q g;  3L4O D;  2HES X;  3CFS B;  4J82 A;  5EMK B;  2EIE A;  1BPO A;  4A08 B;  4U1E I;  3JRO A;  4GM3 A;  1UOO A;  1TYE A;  3ULE C;  5AFU 3;  4NAA A;  4MMY A;  5C2V B;  1XHM A;  2QXV A;  4JSX C;  5E6U A;  2YB8 B;  1UOP A;  2HKR A;  4FAV D;  3FCU A;  4MMZ A;  1E8M A;  4JXM A;  4A2M A;  4A0A B;  4BUJ C;  4Z7N A;  1JJU B;  4D0K A;  4IMM A;  3IVM A;  4CI2 A;  4GMB A;  5K19 A;  3J81 g;  2HU5 A;  4IA9 A;  4J8B A;  3F3P A;  2IUV A;  4K3J B;  3FGB A;  5GXH A;  1P22 A;  2B5N A;  3JPX A;  2B5L A;  1PI6 A;  4ES0 A;  4JD2 C;  2OJY A;  4GGD A;  4BL0 A;  2QC5 A;  5I5M A;  5E6S A;  5HDB A;  4BP9 A;  5EM2 B;  3ORV D;  3OW8 A;  4Z7Q A;  4PNK B;  2VZ1 A;  1XKS A;  2H9N A;  1H2X A;  4FWW A;  4AOW A;  1MDA H;  2BCJ B;  4J81 A;  4L9O A;  5IC7 A;  2AH0 A;  1JMX B;  4QT8 A;  3I8E A;  5THA A;  5M5T A;  2CE8 A;  3NVQ A;  4J79 A;  4A09 A;  3IJ1 A;  2OVQ B;  5JWZ A;  4DNV A;  1TYQ C;  5CYK B;  4K3I D;  1B9X A;  2H6N A;  2AGX A;  5EAL A;  5KDO B;  2B4E A;  3V7D B;  2I0T A;  3UKU C;  4IRZ A;  3SBP A;  2PM9 A;  4XYH A;  3EU7 A;  2CN2 A;  3HFQ A;  5M5V A;  5FLX g;  2Z2P A;  3OL2 A;  4PBY A;  4ERZ A;  3ZE1 A;  4CY2 A;  1PGU A;  1UTC A;  5FKT A;  3O4I A;  2O9K A;  5CXC B;  2B5M A;  3IUM A;  2AGZ A;  3GD1 I;  4BH6 A;  1O6G A;  1H2Y A;  4MMX A;  2VDP A;  3EI3 B;  1K32 A;  2H9L A;  3T3P A;  4GQB B;  4J73 A;  2VDL A;  5FXY A;  4A0B A;  3OKY B;  3N0D A;  4FA5 D;  3JZG A;  2EID A;  2GC4 A;  5FFG A;  4CY5 A;  4O2W A;  2J56 H;  4I79 A;  1I2M B;  1RI6 A;  3MUN A;  5C86 A;  3UVO A;  2I0R A;  4ESG A;  3MKQ A;  3PVW B;  4G1M A;  2VC2 A;  3SFZ A;  5CXB B;  3SXT D;  3I8C A;  4O3T B;  2J55 H;  3JAM g;  1JMZ B;  1VZ3 A;  4WK2 A;  4JT6 C;  5FKS A;  4GQ1 A;  4WK0 A;  4Y5R D;  3V4P A;  3CFV A;  3I7L A;  3VGZ A;  3EG6 A;  4ZOX A;  3SJL D;  4ERQ A;  3ZDY A;  3SHF A;  2UZY B;  3J80 g;  4PSX B;  2PM6 B;  3ZE0 A;  3KRX B;  1NEX B;  4UI9 R;  3K72 A;  2H9M A;  4A11 A;  3K71 A;  1GOF A;  3MUO A;  2HJB A;  4E5Z B;  3RMZ D; 
#chains in the Genus database with same CATH homology
 3U4Y A;  3EI4 A;  3W15 A;  2UZX B;  3DM0 A;  3BG1 A;  2YNO A;  5HE2 B;  4ZN4 A;  4A08 A;  3JZH A;  1SHY B;  4E54 A;  3NVN A;  3PXS D;  3FRX A;  4KFM B;  5I5J A;  3EWE A;  3SBQ A;  2AH1 A;  4FAN D;  5IGO A;  1A0R B;  3IKO A;  5GMK n;  3DWL C;  2GC7 A;  4PXW A;  3UVL A;  2OVR B;  4FB1 D;  1S4U X;  4R7A B;  5HYN B;  3I7O A;  5HE1 B;  3SN6 B;  1QNI A;  3I7N A;  4ZOZ A;  2OIZ A;  1L0Q A;  1N6F A;  4LGN A;  3RRM C;  1VYH C;  1SQJ A;  1TBG A;  5B4W A;  5FKR A;  3I89 A;  3RFH A;  3PXW D;  2AGW A;  4D6V A;  3SVW D;  4CI3 A;  3MZK A;  5EM2 A;  4A7J A;  1R5M A;  2I3T A;  2XYI A;  4Z8L A;  4FHL A;  5EAP A;  4LG9 A;  2G9A A;  3NVX A;  1GXR A;  5HQG A;  4X61 B;  3K26 A;  2XL2 A;  4N14 A;  4X3E A;  4H5I A;  1K8K C;  5TEF A;  5H17 A;  4A09 B;  5AJA A;  3BWS A;  2I3S A;  4Y7R A;  3SMR A;  5IT9 g;  3C75 H;  2IUQ A;  3MMY A;  2PM9 B;  1N6E A;  5EAM A;  2Q7Q A;  2HJ4 A;  2P9I C;  3FM0 A;  5FKQ A;  3UR4 A;  4QRJ A;  5IJ7 E;  2I0S A;  2AQ5 A;  3OL2 B;  1GG2 B;  3OKW A;  3EI1 B;  4J87 A;  3IIW A;  4MK0 B;  4PC0 A;  3EMH A;  1N6D A;  2P9N C;  2J57 G;  5CXC A;  3AFC A;  4H5J A;  3UKR C;  2IUR A;  1PBY B;  1GP2 B;  3F3G A;  3RLM D;  3PE7 A;  3EI2 B;  4AEZ A;  3MXX A;  3PSC B;  4A0B B;  2EBS A;  3DSM A;  3OKY A;  4A2L A;  1JOF A;  5EAR A;  3KRW B;  5AMS A;  2HYE A;  3JZN A;  1Q47 A;  1GOT B;  2PBI B;  4O9D A;  3VH0 A;  2P9P C;  2MTA H;  3SBR A;  3AL8 A;  2TRC B;  2OVP B;  1ERJ A;  2H6Q A;  4LG8 A;  3UVK A;  4PSW B;  5TDH B;  4GGC A;  5I5I A;  1B9Y A;  4XEI C;  4XYI A;  3GFC A;  5TF2 A;  1SQ9 A;  2CO0 C;  4J77 A;  4NSX A;  3L4M D;  4J8G A;  4ZOV A;  3EI4 B;  5TEE A;  4O1Q D;  2P9S C;  3C9C A;  3MZL A;  3OKT A;  5EML B;  3PVU B;  1FWX A;  2YNN A;  3DXK C;  1U4C A;  4J0W A;  4GZ8 A;  3B7F A;  4QL1 A;  4JT5 C;  2G99 A;  4O3U B;  4E54 B;  1MG3 A;  4CZV A;  5SXM A;  3F3F A;  2YNP A;  5GXI A;  3V5W B;  4A0A A;  3OTT A;  4GM8 A;  4CC9 A;  3P4F A;  4CI8 A;  3VA6 A;  3PSL A;  4FA9 D;  3SLE D;  2PM7 B;  1U2V C;  3PXT D;  1PEV A;  2Z2O A;  3JRP A;  1OLZ A;  2H14 A;  5HE0 B;  2XU7 A;  3K27 A;  5IGQ A;  3AH8 B;  5GSA A;  3I7K A;  4OWR A;  2H47 A;  1OMW B;  3E0C A;  4X63 B;  2CE9 A;  1NR0 A;  5H14 A;  5IJ8 E;  3ZWL B;  2H9P A;  4L1Q D;  4FA1 D;  5HE3 B;  3SCY A;  2CN3 A;  3GRE A;  5CYK A;  3ODT A;  2YMU A;  2Z2N A;  2GNQ A;  4O45 A;  3RN0 D;  4U7A A;  4JSP C;  4PBZ A;  2H13 A;  2H68 A;  2H3X A;  4YVD A;  4GGA A;  3IJC A;  2IAA A;  5FQD A;  4J78 A;  4L3G D;  4CZY A;  2XL3 A;  2P9K C;  3UVN A;  4HDJ A;  2OK4 A;  2CO0 A;  3MKS B;  4ZOY A;  4EWR A;  4FA4 D;  2BBK H;  2W18 A;  2OK6 A;  3RN1 D;  3EI1 A;  4CY1 A;  4OZU A;  2AGY A;  1YFQ A;  3EI3 A;  3UVM A;  4JSN C;  4J0X A;  3I7P A;  4ERY A;  2IWF A;  3BG0 A;  5FA5 B;  3I2N A;  5C9Z B;  3SWS D;  2HXC A;  4CI1 A;  4TZ4 A;  4CY3 A;  3I7H A;  4X60 B;  3EI2 A;  3N0E A;  5H1M A;  3RFG A;  3IJ0 A;  4QQE A;  4GQ2 P;  5CXB A;  3V9F A;  2CNX A;  5EMJ B;  2IWK A;  2P9L C;  3DXM C;  4GM9 A;  3C99 A;  4J84 A;  3C5M A;  2AGL A;  3AL8 B;  5EMM B;  2P9U C;  4L3H D;  2YBA A;  3AL9 A;  2H6K A;  4CZX A;  3CIK B;  4A11 B;  1MG2 A;  3IIY A;  5C2W B;  2IUP A;  5K1C C;  3A0F A;  4J86 A;  4JSV C;  3JB9 L;  4G56 B;  4E5Z A;  2HKM A;  1XIP A;  3RSE C;  5A2Q g;  3L4O D;  2HES X;  3CFS B;  4J82 A;  5EMK B;  4A08 B;  4U1E I;  3JRO A;  4GM3 A;  3ULE C;  5AFU 3;  5C2V B;  1XHM A;  2QXV A;  4JSX C;  4FAV D;  2YB8 B;  2HKR A;  4JXM A;  4A2M A;  4A0A B;  4BUJ C;  1JJU B;  4D0K A;  4IMM A;  5K19 A;  4CI2 A;  4GMB A;  3J81 g;  4IA9 A;  4J8B A;  3F3P A;  2IUV A;  4K3J B;  3FGB A;  5GXH A;  1P22 A;  2B5N A;  3JPX A;  2B5L A;  1PI6 A;  4ES0 A;  4JD2 C;  2OJY A;  4GGD A;  4BL0 A;  2QC5 A;  5I5M A;  5EM2 B;  3ORV D;  3OW8 A;  4PNK B;  1XKS A;  2H9N A;  4FWW A;  4AOW A;  1MDA H;  2BCJ B;  4J81 A;  4L9O A;  5IC7 A;  2AH0 A;  1JMX B;  4QT8 A;  3I8E A;  5THA A;  2CE8 A;  3NVQ A;  4J79 A;  4A09 A;  3IJ1 A;  2OVQ B;  5JWZ A;  1TYQ C;  5CYK B;  4K3I D;  1B9X A;  2H6N A;  2AGX A;  5EAL A;  5KDO B;  2B4E A;  3V7D B;  2I0T A;  3UKU C;  3SBP A;  2PM9 A;  4XYH A;  3EU7 A;  2CN2 A;  3HFQ A;  5FLX g;  2Z2P A;  3OL2 A;  4PBY A;  4ERZ A;  4CY2 A;  1PGU A;  5FKT A;  2O9K A;  5CXC B;  2B5M A;  2AGZ A;  4BH6 A;  3EI3 B;  1K32 A;  2H9L A;  4GQB B;  4J73 A;  4A0B A;  5FXY A;  3OKY B;  3N0D A;  4FA5 D;  3JZG A;  2GC4 A;  4CY5 A;  2J56 H;  4I79 A;  1RI6 A;  3UVO A;  2I0R A;  4ESG A;  3MKQ A;  3PVW B;  3SFZ A;  5CXB B;  3SXT D;  3I8C A;  4O3T B;  2J55 H;  3JAM g;  1JMZ B;  4JT6 C;  5FKS A;  4GQ1 A;  4Y5R D;  3CFV A;  3I7L A;  3VGZ A;  3EG6 A;  4ZOX A;  3SJL D;  4ERQ A;  3SHF A;  2UZY B;  3J80 g;  4PSX B;  2PM6 B;  3KRX B;  1NEX B;  4UI9 R;  2H9M A;  4A11 A;  2HJB A;  4E5Z B;  3RMZ D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...