3F3GA

Crystal structure of the nucleoporin pair nup85-seh1, space group p212121
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
347
structure length
300
Chain Sequence
MQPFDSGHDDLVHDVVYDFYGRHVATCSSDQHIKVFKLDKDTSNWELSDSWRAHDSSIVAIDWASPEYGRIIASASYDKTVKLWEEDPDQEECSGRRWNKLCTLNDSKGSLYSVKFAPAHLGLKLACLGNDGILRLYDALEPSDLRSWTLTSEMKVLSIPSDFCLSWCPSRFSPEKLAVSALEQAIIYQRGKDGKLHVAAKLPGHKSLIRSISWAPSIGRWYQLIATGCKDGRIRIFKITEKSNLQVELLSEHDDHNGEVWSVSWNLTGTILSSAGDDGKVRLWKATYSNEFKCMSVITA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A fence-like coat for the nuclear pore membrane.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural protein
molecule keywords Nucleoporin SEH1
total genus 59
structure length 300
sequence length 347
chains with identical sequence B, E, F
ec nomenclature
pdb deposition date 2008-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3f3gA01
3F3GA 4UI9R 4PBZA 4O3UB 4A09A 3SBQA 1YFQA 4J0XA 3EU7A 2O9KA 1QNIA 2PBIB 4BH6A 1U2VC 3I7LA 4N14A 1JJUB 4J81A 4IMMA 5EMLB 1GOTB 5EMKB 2XL2A 4L3GD 4X60B 2H6KA 2H9LA 5CXBB 3JRPA 4D6VA 2CO0A 3SLED 1K32A 2B5MA 4Y7RA 3L4OD 4J79A 1XKSA 4ES0A 4O45A 2CO0C 3DXKC 2CE9A 3EI2A 4QL1A 3FM0A 1OLZA 3DXMC 2OK6A 2I0SA 4ERYA 5EALA 3FGBA 4GM3A 2I3SA 3BG0A 5H1MA 2YNOA 2XYIA 1TYQC 2Z2PA 3UR4A 3OKYA 5GMKn 2J56H 1TBGA 2GC4A 4J87A 4Z8LA 2AGYA 4FB1D 4O3TB 3EI1B 4O1QD 3GFCA 4A11A 5TDHB 1N6EA 2HXCA 4CZXA 3UKRC 5HE1B 3EI3B 3RN1D 3SXTD 2CNXA 4GQBB 4ERZA 5KDOB 4J8BA 3F3FA 2OVRB 3KRXB 3MKQA 4JD2C 4JSNC 5EMJB 1N6FA 3UVNA 3V7DB 2GNQA 5AJAA 3I8EA 5K19A 3HFQA 4LG9A 2OJYA 3BG1A 5FQDA 2H47A 4D0KA 2B5LA 2TRCB 4BUJC 4LGNA 3PXTD 3SN6B 4MK0B 2G99A 3OKTA 4CY2A 1SQ9A 4GM8A 5CXCB 3IIWA 3L4MD 3B7FA 2H6NA 4A0AB 5AMSA 3W15A 5B4WA 4A0BB 3AH8B 4QRJA 3PSLA 4BL0A 2P9IC 1MG3A 4A2LA 5IC7A 3RLMD 5HE2B 2AGWA 1PI6A 4JSXC 3OKYB 1OMWB 3SMRA 2QC5A 5CXCA 4PC0A 5GXIA 2QXVA 2MTAH 1NR0A 5JWZA 2IWFA 4J78A 2HKMA 3EG6A 3DM0A 4CY5A 2P9KC 3RFHA 4EWRA 3IJ1A 1NEXB 4A09B 2CN3A 3I89A 3JPXA 4JSVC 4AEZA 3DSMA 2P9PC 3MMYA 3IKOA 2AGLA 4ESGA 2H9MA 3OL2B 4J8GA 3MZLA 4E54B 1VYHC 3NVXA 1SQJA 3ODTA 5CYKA 3UVKA 3J80g 3OTTA 4JXMA 2AGXA 3A0FA 4GQ1A 1PEVA 4ERQA 4L3HD 5A2Qg 4Y5RD 2HYEA 2PM9A 4J77A 2B5NA 5H14A 5IGQA 5C2VB 4A0AA 1L0QA 4A0BA 3C75H 2XU7A 5FKRA 3VA6A 2HJBA 2PM6B 3P4FA 3SFZA 5GSAA 4J0WA 3ULEC 4GGDA 5FA5B 1MG2A 2PM9B 3RMZD 2CN2A 3MXXA 3ORVD 4J84A 3SCYA 2YNNA 4GQ2P 3J81g 3VGZA 4CI1A 3UKUC 4E5ZB 3PXWD 3V9FA 5H17A 2BCJB 3KRWB 5C9ZB 3JZGA 3SVWD 5IGOA 5EARA 3VH0A 4YVDA 2IUPA 3AL9A 3K27A 4CI3A 5EAMA 4FA1D 4PSWB 1ERJA 4ZN4A 2H13A 5FXYA 1B9YA 1JMXB 4FAVD 3PXSD 4GMBA 4PSXB 3N0EA 5I5JA 2Z2NA 5EMMB 5GXHA 4CY1A 4FA5D 4ZOZA 3AL8A 4ZOYA 3RSEC 5HQGA 3OKWA 4GZ8A 1MDAH 2UZXB 3EI2B 3I2NA 4JT5C 2H9NA 4E54A 3SBRA 5HYNB 4QQEA 5TEEA 2HJ4A 5K1CC 3N0DA 3UVOA 2H3XA 3K26A 4TZ4A 4X63B 4CI2A 3EI1A 3JROA 2XL3A 3EI4A 2H6QA 2H14A 2HESX 2IUQA 3ZWLB 5IJ8E 2G9AA 3IJCA 3NVQA 5HE0B 3V5WB 3PSCB 2P9SC 1GXRA 2OVPB 1N6DA 2I0RA 4FA4D 3I7HA 4JSPC 3I7KA 4U1EI 1Q47A 5I5MA 3AFCA 2UZYB 3CIKB 2H9PA 5IT9g 4HDJA 3JZNA 4FAND 4XEIC 3RRMC 4J82A 5EAPA 4X61B 2AGZA 4A11B 2EBSA 1XIPA 4J73A 4OWRA 2BBKH 4I79A 2H68A 4XYHA 2J55H 4QT8A 4CZYA 4OZUA 1U4CA 2CE8A 4L9OA 2IWKA 4K3ID 3DWLC 4ZOXA 1XHMA 4A08A 3SHFA 3I8CA 3I7OA 2B4EA 4A7JA 5IJ7E 3CFVA 1K8KC 2GC7A 4NSXA 2IURA 5EM2B 4CI8A 3EMHA 2J57G 2HKRA 5HE3B 3EI4B 3SWSD 4XYIA 2I3TA 3OW8A 2Q7QA 2OK4A 4L1QD 4O9DA 3JB9L 4CZVA 4GGCA 2PM7B 3IJ0A 2P9LC 1JOFA 2YBAA 1B9XA 2YB8B 3IIYA 2AH1A 5FKTA 3PVUB 2Z2OA 4FA9D 3E0CA 1SHYB 4KFMB 2OVQB 1GP2B 4ZOVA 3CFSB 1PBYB 3SBPA 3F3PA 3JZHA 3C5MA 1P22A 4PXWA 1GG2B 3AL8B 3FRXA 4A2MA 5TF2A 3EI3A 4H5IA 2OIZA 3JAMg 2YNPA 2W18A 1A0RB 4U7AA 3U4YA 4JT6C 4FWWA 4K3JB 3MZKA 4PNKB 5TEFA 5EM2A 4AOWA 2P9NC 3I7NA 3OL2A 5I5IA 1R5MA 4E5ZA 1JMZB 2IAAA 2AH0A 5SXMA 1RI6A 5AFU3 5CYKB 3BWSA 1FWXA 5C2WB 4A08B 1S4UX 5FLXg 3RFGA 1PGUA 4LG8A 4X3EA 3UVMA 4PBYA 3EWEA 3SJLD 4R7AB 3RN0D 3GREA 5THAA 4CC9A 3PE7A 4J86A 3UVLA 2I0TA 2P9UC 4GGAA 3I7PA 2YMUA 4G56B 4IA9A 3PVWB 4FHLA 5FKQA 3C99A 4H5JA 4CY3A 4GM9A 3MKSB 2IUVA 5FKSA 3NVNA 3C9CA 5CXBA 2AQ5A
chains in the Genus database with same CATH superfamily
3F3GA 1JV2A 4UI9R 4PBZA 4O3UB 5FFOA 3IJEA 4A09A 3SBQA 1YFQA 4WK2A 4J0XA 3EU7A 2O9KA 3IUNA 1QNIA 2PBIB 4BH6A 1U2VC 1TYEA 2VDQA 5C86A 3I7LA 4N14A 1JJUB 4J81A 2HU5A 4IMMA 5EMLB 1GOTB 5EMKB 2XL2A 4L3GD 4X60B 2H6KA 2H9LA 1YR2A 1M1XA 3JRPA 5CXBB 4BCBA 2CO0A 4D6VA 4BP9A 3SLED 1K32A 2B5MA 3T3MA 2QZPA 4Y7RA 5M61A 1UOPA 3L4OD 3NIFA 4J79A 5HDBA 1XKSA 4ES0A 4O45A 2CO0C 3DXKC 3ZDYA 2CE9A 3EI2A 4QL1A 4JHPC 3FM0A 1OLZA 3IUJA 3DXMC 1I2MB 2OK6A 2I0SA 4ERYA 4Z7OA 5EALA 3FGBA 3FCUA 3V4VA 2XDWA 4GM3A 3BG0A 2I3SA 5H1MA 2YNOA 2XYIA 1TYQC 2Z2PA 3UR4A 3QI0A 3OKYA 5GMKn 2J56H 1TBGA 2GC4A 4J87A 4Z8LA 2AGYA 4FB1D 4O3TB 3EI1B 4O1QD 3GFCA 4A11A 5TDHB 1N6EA 2HXCA 5E6SA 4CZXA 2VDRA 3UKRC 5HE1B 3EI3B 3RN1D 3ZDZA 4DNUA 3SXTD 2CNXA 4GQBB 3ZE1A 4ERZA 5KDOB 2XE4A 4J8BA 3F3FA 2OVRB 3KRXB 3MKQA 4JD2C 4O2WA 3ZE0A 4JSNC 4AN1A 5EMJB 1N6FA 3UVNA 3V7DB 3K6SA 2GNQA 5AJAA 3I8EA 5K19A 3HFQA 4LG9A 2OJYA 4MMYA 3BG1A 4UM8A 5FQDA 2H47A 4D0KA 2B5LA 2TRCB 4BUJC 3O4GA 3PXTD 4LGNA 3SN6B 4MK0B 2G99A 3OKTA 4CY2A 3O4HA 1SQ9A 4GM8A 5CXCB 2VZ1A 3IIWA 3L4MD 3B7FA 2H6NA 4A0AB 5AMSA 3W15A 5B4WA 4A0BB 3AH8B 4QRJA 1L5GA 3PSLA 4BL0A 2P9IC 1MG3A 4A2LA 5IC7A 3RLMD 5HE2B 2AGWA 1PI6A 4JSXC 3OKYB 1OMWB 3SMRA 2QC5A 5CXCA 4PC0A 5GXIA 4JHNA 2QXVA 1O6GA 2MTAH 1C9IA 1NR0A 5JWZA 4D9SA 2IWFA 4J78A 2HKMA 3EG6A 3IVMA 3DM0A 4CY5A 2P9KC 3RFHA 4EWRA 1H2XA 3IJ1A 1E8NA 1NEXB 3ZDXA 4A09B 5M5TA 2CN3A 3I89A 3JPXA 4JSVC 4AEZA 3DSMA 2P9PC 3EQ7A 3MMYA 5E6UA 3T3PA 1K3IA 1H2WA 2AGLA 3IKOA 4G1EA 4ESGA 2H9MA 3OL2B 1H2YA 3MZLA 4J8GA 4E54B 1VYHC 3NVXA 1SQJA 3ODTA 5CYKA 3UVKA 3J80g 3OTTA 4JXMA 2AGXA 3A0FA 1C9LA 2VDNA 4GQ1A 1PEVA 4ERQA 4L3HD 5A2Qg 4Y5RD 1U8CA 2HYEA 1VE6A 2PM9A 4J77A 2B5NA 4G1MA 5H14A 1QFMA 5C2VB 5IGQA 4A0AA 1L0QA 5M5SA 4A0BA 3C75H 2XU7A 2VDPA 5FKRA 1VZ2A 3VA6A 2HJBA 2PM6B 3IUMA 3P4FA 3SFZA 5GSAA 4J0WA 3ULEC 4BCCA 4GGDA 5FA5B 1MG2A 2PM9B 3RMZD 2CN2A 3MXXA 3ORVD 4NAAA 4AN0A 4J84A 3SCYA 2YNNA 4GQ2P 3J81g 3VGZA 4CI1A 3UKUC 4E5ZB 3PXWD 3V9FA 5H17A 2BCJB 3IURA 1GOGA 4MMZA 3KRWB 5C9ZB 3JZGA 3SVWD 5IGOA 4IRZA 5EARA 4WK0A 3VH0A 1GOFA 2IUPA 4YVDA 3AL9A 3K27A 4CI3A 5EAMA 4FA1D 4PSWB 1ERJA 2VDKA 4ZN4A 2H13A 5FXYA 1B9YA 1JMXB 4FAVD 3PXSD 2EIEA 4GMBA 5FFGA 4PSXB 3N0EA 5I5JA 2Z2NA 5EMMB 5GXHA 4CY1A 4FA5D 4ZOZA 3AL8A 3NIDA 5M5RA 3RSEC 5HQGA 4ZOYA 3OKWA 3IULA 4GZ8A 1BPOA 1MDAH 2UZXB 5M5VA 3EI2B 2VDLA 3O4IA 2EIDA 3I2NA 2H9NA 4JT5C 1UOOA 4NC4A 3SBRA 4E54A 5HYNB 4QQEA 3V4PA 5TEEA 1UOQA 2HJ4A 5K1CC 4MMXA 3N0DA 3UVOA 4AX4A 2H3XA 3K26A 4WJKA 4TZ4A 3O4JA 4X63B 4CI2A 3EI1A 3JROA 2XL3A 3EI4A 2H6QA 2H14A 4O02A 3QHYB 2HESX 3K72A 2IUQA 3ZWLB 5IJ8E 2G9AA 3IJCA 3NVQA 5HE0B 3V5WB 3PSCB 2P9SC 1GXRA 2OVPB 1N6DA 2I0RA 4FA4D 1GOHA 3I7HA 4JSPC 3I7KA 4U1EI 1Q47A 5I5MA 2EIBA 3GC3B 3AFCA 2UZYB 3CIKB 2H9PA 5IT9g 4Z7NA 3FCSA 4HDJA 3JZNA 4FAND 4XEIC 3MUNA 3RRMC 4J82A 5EAPA 1T2XA 4X61B 3EQ9A 2AGZA 4A11B 1XIPA 2EBSA 4J73A 4BCDA 4I79A 2BBKH 4OWRA 2QR5A 4L1MA 2H68A 4XYHA 2J55H 4QT8A 4CZYA 4OZUA 3DDUA 1U4CA 2CE8A 4L9OA 5E6RA 1UTCA 2IWKA 4K3ID 3DWLC 2XZGA 4ZOXA 1XHMA 4A08A 3OF7A 3SHFA 3I8CA 3I7OA 2B4EA 4A7JA 5IJ7E 4WK4A 1VE7A 3CFVA 1E8MA 1K8KC 2GC7A 4NSXA 2IURA 5EM2B 2VDOA 4CI8A 3VI4A 3EMHA 3NIGA 2J57G 2HKRA 5HE3B 3EI4B 3SWSD 4XYIA 2I3TA 3OW8A 2Q7QA 2OK4A 3MUOA 4NENA 4L1QD 4O9DA 3JB9L 3VI3A 4CZVA 4GGCA 2BKLA 2PM7B 3IJ0A 2P9LC 1JOFA 4RE6A 2YBAA 1B9XA 2YB8B 4DNVA 3MVDK 3IIYA 2AH1A 5FKTA 3PVUB 2Z2OA 4FA9D 3E0CA 4G55A 1SHYB 4KFMB 2OVQB 1GP2B 4ZOVA 3CFSB 1O6FA 1PBYB 2VDMA 4AMYA 1E5TA 3SBPA 3F3PA 1VZ3A 3JZHA 3C5MA 1P22A 4PXWA 1GG2B 3AL8B 1JTDB 3FRXA 3KCIA 2VZ3A 4A2MA 5TF2A 3ZE2A 3EI3A 3GD1I 4H5IA 2OIZA 3JAMg 2YNPA 2W18A 1A0RB 4U7AA 3U4YA 4JT6C 3EQ8A 1QFSA 4Z7QA 1A12A 2WQ8A 4FWWA 4K3JB 3MZKA 4PNKB 5TEFA 5EM2A 4AOWA 4BP8A 2P9NC 3I7NA 3OL2A 5I5IA 1R5MA 4E5ZA 1JMZB 2IAAA 4DNWA 2AH0A 5SXMA 3K71A 1RI6A 5AFU3 5CYKB 4QAMA 3BWSA 4RE5A 5C92A 1FWXA 5C2WB 4NBMA 4A08B 1S4UX 5FLXg 3RFGA 1PGUA 4LG8A 4X3EA 2JKXA 3UVMA 4UM9A 3EWEA 4PBYA 3SJLD 4R7AB 3RN0D 3GREA 5THAA 3IUQA 4CC9A 3PE7A 4J86A 3UVLA 2I0TA 2P9UC 4GGAA 3I7PA 1H2ZA 2YMUA 4G56B 4IA9A 2VC2A 3PVWB 4FHLA 5FKQA 4AMZA 5M5UA 3C99A 4H5JA 4CY3A 4GM9A 2HU7A 3MKSB 2IUVA 5FKSA 2HU8A 3NVNA 3C9CA 2EICA 5CXBA 2AQ5A
chains in the Genus database with same CATH topology
3F3GA 4UI9R 4PBZA 4O3UB 4A09A 3SBQA 1YFQA 4J0XA 3EU7A 2O9KA 1QNIA 2PBIB 4BH6A 1U2VC 3I7LA 4N14A 1JJUB 4J81A 4IMMA 5EMLB 1GOTB 5EMKB 2XL2A 4L3GD 4X60B 2H6KA 2H9LA 5CXBB 3JRPA 4D6VA 2CO0A 3SLED 1K32A 2B5MA 4Y7RA 3L4OD 4J79A 1XKSA 4ES0A 4O45A 2CO0C 3DXKC 2CE9A 3EI2A 4QL1A 3FM0A 1OLZA 3DXMC 2OK6A 2I0SA 4ERYA 5EALA 3FGBA 4GM3A 2I3SA 3BG0A 5H1MA 2YNOA 2XYIA 1TYQC 2Z2PA 3UR4A 3OKYA 5GMKn 2J56H 1TBGA 2GC4A 4J87A 4Z8LA 2AGYA 4FB1D 4O3TB 3EI1B 4O1QD 3GFCA 4A11A 5TDHB 1N6EA 2HXCA 4CZXA 3UKRC 5HE1B 3EI3B 3RN1D 3SXTD 2CNXA 4GQBB 4ERZA 5KDOB 4J8BA 3F3FA 2OVRB 3KRXB 3MKQA 4JD2C 4JSNC 5EMJB 1N6FA 3UVNA 3V7DB 2GNQA 5AJAA 3I8EA 5K19A 3HFQA 4LG9A 2OJYA 3BG1A 5FQDA 2H47A 4D0KA 2B5LA 2TRCB 4BUJC 4LGNA 3PXTD 3SN6B 4MK0B 2G99A 3OKTA 4CY2A 1SQ9A 4GM8A 5CXCB 3IIWA 3L4MD 3B7FA 2H6NA 4A0AB 5AMSA 3W15A 5B4WA 4A0BB 3AH8B 4QRJA 3PSLA 4BL0A 2P9IC 1MG3A 4A2LA 5IC7A 3RLMD 5HE2B 2AGWA 1PI6A 4JSXC 3OKYB 1OMWB 3SMRA 2QC5A 5CXCA 4PC0A 5GXIA 2QXVA 2MTAH 1NR0A 5JWZA 2IWFA 4J78A 2HKMA 3EG6A 3DM0A 4CY5A 2P9KC 3RFHA 4EWRA 3IJ1A 1NEXB 4A09B 2CN3A 3I89A 3JPXA 4JSVC 4AEZA 3DSMA 2P9PC 3MMYA 3IKOA 2AGLA 4ESGA 2H9MA 3OL2B 4J8GA 3MZLA 4E54B 1VYHC 3NVXA 1SQJA 3ODTA 5CYKA 3UVKA 3J80g 3OTTA 4JXMA 2AGXA 3A0FA 4GQ1A 1PEVA 4ERQA 4L3HD 5A2Qg 4Y5RD 2HYEA 2PM9A 4J77A 2B5NA 5H14A 5IGQA 5C2VB 4A0AA 1L0QA 4A0BA 3C75H 2XU7A 5FKRA 3VA6A 2HJBA 2PM6B 3P4FA 3SFZA 5GSAA 4J0WA 3ULEC 4GGDA 5FA5B 1MG2A 2PM9B 3RMZD 2CN2A 3MXXA 3ORVD 4J84A 3SCYA 2YNNA 4GQ2P 3J81g 3VGZA 4CI1A 3UKUC 4E5ZB 3PXWD 3V9FA 5H17A 2BCJB 3KRWB 5C9ZB 3JZGA 3SVWD 5IGOA 5EARA 3VH0A 4YVDA 2IUPA 3AL9A 3K27A 4CI3A 5EAMA 4FA1D 4PSWB 1ERJA 4ZN4A 2H13A 5FXYA 1B9YA 1JMXB 4FAVD 3PXSD 4GMBA 4PSXB 3N0EA 5I5JA 2Z2NA 5EMMB 5GXHA 4CY1A 4FA5D 4ZOZA 3AL8A 4ZOYA 3RSEC 5HQGA 3OKWA 4GZ8A 1MDAH 2UZXB 3EI2B 3I2NA 4JT5C 2H9NA 4E54A 3SBRA 5HYNB 4QQEA 5TEEA 2HJ4A 5K1CC 3N0DA 3UVOA 2H3XA 3K26A 4TZ4A 4X63B 4CI2A 3EI1A 3JROA 2XL3A 3EI4A 2H6QA 2H14A 2HESX 2IUQA 3ZWLB 5IJ8E 2G9AA 3IJCA 3NVQA 5HE0B 3V5WB 3PSCB 2P9SC 1GXRA 2OVPB 1N6DA 2I0RA 4FA4D 3I7HA 4JSPC 3I7KA 4U1EI 1Q47A 5I5MA 3AFCA 2UZYB 3CIKB 2H9PA 5IT9g 4HDJA 3JZNA 4FAND 4XEIC 3RRMC 4J82A 5EAPA 4X61B 2AGZA 4A11B 2EBSA 1XIPA 4J73A 4OWRA 2BBKH 4I79A 2H68A 4XYHA 2J55H 4QT8A 4CZYA 4OZUA 1U4CA 2CE8A 4L9OA 2IWKA 4K3ID 3DWLC 4ZOXA 1XHMA 4A08A 3SHFA 3I8CA 3I7OA 2B4EA 4A7JA 5IJ7E 3CFVA 1K8KC 2GC7A 4NSXA 2IURA 5EM2B 4CI8A 3EMHA 2J57G 2HKRA 5HE3B 3EI4B 3SWSD 4XYIA 2I3TA 3OW8A 2Q7QA 2OK4A 4L1QD 4O9DA 3JB9L 4CZVA 4GGCA 2PM7B 3IJ0A 2P9LC 1JOFA 2YBAA 1B9XA 2YB8B 3IIYA 2AH1A 5FKTA 3PVUB 2Z2OA 4FA9D 3E0CA 1SHYB 4KFMB 2OVQB 1GP2B 4ZOVA 3CFSB 1PBYB 3SBPA 3F3PA 3JZHA 3C5MA 1P22A 4PXWA 1GG2B 3AL8B 3FRXA 4A2MA 5TF2A 3EI3A 4H5IA 2OIZA 3JAMg 2YNPA 2W18A 1A0RB 4U7AA 3U4YA 4JT6C 4FWWA 4K3JB 3MZKA 4PNKB 5TEFA 5EM2A 4AOWA 2P9NC 3I7NA 3OL2A 5I5IA 1R5MA 4E5ZA 1JMZB 2IAAA 2AH0A 5SXMA 1RI6A 5AFU3 5CYKB 3BWSA 1FWXA 5C2WB 4A08B 1S4UX 5FLXg 3RFGA 1PGUA 4LG8A 4X3EA 3UVMA 4PBYA 3EWEA 3SJLD 4R7AB 3RN0D 3GREA 5THAA 4CC9A 3PE7A 4J86A 3UVLA 2I0TA 2P9UC 4GGAA 3I7PA 2YMUA 4G56B 4IA9A 3PVWB 4FHLA 5FKQA 3C99A 4H5JA 4CY3A 4GM9A 3MKSB 2IUVA 5FKSA 3NVNA 3C9CA 5CXBA 2AQ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F3G A;  4UI9 R;  4PBZ A;  4O3U B;  4A09 A;  3SBQ A;  1YFQ A;  4J0X A;  3EU7 A;  2O9K A;  1QNI A;  2PBI B;  4BH6 A;  1U2V C;  3I7L A;  4N14 A;  1JJU B;  4J81 A;  4IMM A;  5EML B;  1GOT B;  5EMK B;  2XL2 A;  4L3G D;  4X60 B;  2H6K A;  2H9L A;  5CXB B;  3JRP A;  4D6V A;  2CO0 A;  3SLE D;  1K32 A;  2B5M A;  4Y7R A;  3L4O D;  4J79 A;  1XKS A;  4ES0 A;  4O45 A;  2CO0 C;  3DXK C;  2CE9 A;  3EI2 A;  4QL1 A;  3FM0 A;  1OLZ A;  3DXM C;  2OK6 A;  2I0S A;  4ERY A;  5EAL A;  3FGB A;  4GM3 A;  2I3S A;  3BG0 A;  5H1M A;  2YNO A;  2XYI A;  1TYQ C;  2Z2P A;  3UR4 A;  3OKY A;  5GMK n;  2J56 H;  1TBG A;  2GC4 A;  4J87 A;  4Z8L A;  2AGY A;  4FB1 D;  4O3T B;  3EI1 B;  4O1Q D;  3GFC A;  4A11 A;  5TDH B;  1N6E A;  2HXC A;  4CZX A;  3UKR C;  5HE1 B;  3EI3 B;  3RN1 D;  3SXT D;  2CNX A;  4GQB B;  4ERZ A;  5KDO B;  4J8B A;  3F3F A;  2OVR B;  3KRX B;  3MKQ A;  4JD2 C;  4JSN C;  5EMJ B;  1N6F A;  3UVN A;  3V7D B;  2GNQ A;  5AJA A;  3I8E A;  5K19 A;  3HFQ A;  4LG9 A;  2OJY A;  3BG1 A;  5FQD A;  2H47 A;  4D0K A;  2B5L A;  2TRC B;  4BUJ C;  4LGN A;  3PXT D;  3SN6 B;  4MK0 B;  2G99 A;  3OKT A;  4CY2 A;  1SQ9 A;  4GM8 A;  5CXC B;  3IIW A;  3L4M D;  3B7F A;  2H6N A;  4A0A B;  5AMS A;  3W15 A;  5B4W A;  4A0B B;  3AH8 B;  4QRJ A;  3PSL A;  4BL0 A;  2P9I C;  1MG3 A;  4A2L A;  5IC7 A;  3RLM D;  5HE2 B;  2AGW A;  1PI6 A;  4JSX C;  3OKY B;  1OMW B;  3SMR A;  2QC5 A;  5CXC A;  4PC0 A;  5GXI A;  2QXV A;  2MTA H;  1NR0 A;  5JWZ A;  2IWF A;  4J78 A;  2HKM A;  3EG6 A;  3DM0 A;  4CY5 A;  2P9K C;  3RFH A;  4EWR A;  3IJ1 A;  1NEX B;  4A09 B;  2CN3 A;  3I89 A;  3JPX A;  4JSV C;  4AEZ A;  3DSM A;  2P9P C;  3MMY A;  3IKO A;  2AGL A;  4ESG A;  2H9M A;  3OL2 B;  4J8G A;  3MZL A;  4E54 B;  1VYH C;  3NVX A;  1SQJ A;  3ODT A;  5CYK A;  3UVK A;  3J80 g;  3OTT A;  4JXM A;  2AGX A;  3A0F A;  4GQ1 A;  1PEV A;  4ERQ A;  4L3H D;  5A2Q g;  4Y5R D;  2HYE A;  2PM9 A;  4J77 A;  2B5N A;  5H14 A;  5IGQ A;  5C2V B;  4A0A A;  1L0Q A;  4A0B A;  3C75 H;  2XU7 A;  5FKR A;  3VA6 A;  2HJB A;  2PM6 B;  3P4F A;  3SFZ A;  5GSA A;  4J0W A;  3ULE C;  4GGD A;  5FA5 B;  1MG2 A;  2PM9 B;  3RMZ D;  2CN2 A;  3MXX A;  3ORV D;  4J84 A;  3SCY A;  2YNN A;  4GQ2 P;  3J81 g;  3VGZ A;  4CI1 A;  3UKU C;  4E5Z B;  3PXW D;  3V9F A;  5H17 A;  2BCJ B;  3KRW B;  5C9Z B;  3JZG A;  3SVW D;  5IGO A;  5EAR A;  3VH0 A;  4YVD A;  2IUP A;  3AL9 A;  3K27 A;  4CI3 A;  5EAM A;  4FA1 D;  4PSW B;  1ERJ A;  4ZN4 A;  2H13 A;  5FXY A;  1B9Y A;  1JMX B;  4FAV D;  3PXS D;  4GMB A;  4PSX B;  3N0E A;  5I5J A;  2Z2N A;  5EMM B;  5GXH A;  4CY1 A;  4FA5 D;  4ZOZ A;  3AL8 A;  4ZOY A;  3RSE C;  5HQG A;  3OKW A;  4GZ8 A;  1MDA H;  2UZX B;  3EI2 B;  3I2N A;  4JT5 C;  2H9N A;  4E54 A;  3SBR A;  5HYN B;  4QQE A;  5TEE A;  2HJ4 A;  5K1C C;  3N0D A;  3UVO A;  2H3X A;  3K26 A;  4TZ4 A;  4X63 B;  4CI2 A;  3EI1 A;  3JRO A;  2XL3 A;  3EI4 A;  2H6Q A;  2H14 A;  2HES X;  2IUQ A;  3ZWL B;  5IJ8 E;  2G9A A;  3IJC A;  3NVQ A;  5HE0 B;  3V5W B;  3PSC B;  2P9S C;  1GXR A;  2OVP B;  1N6D A;  2I0R A;  4FA4 D;  3I7H A;  4JSP C;  3I7K A;  4U1E I;  1Q47 A;  5I5M A;  3AFC A;  2UZY B;  3CIK B;  2H9P A;  5IT9 g;  4HDJ A;  3JZN A;  4FAN D;  4XEI C;  3RRM C;  4J82 A;  5EAP A;  4X61 B;  2AGZ A;  4A11 B;  2EBS A;  1XIP A;  4J73 A;  4OWR A;  2BBK H;  4I79 A;  2H68 A;  4XYH A;  2J55 H;  4QT8 A;  4CZY A;  4OZU A;  1U4C A;  2CE8 A;  4L9O A;  2IWK A;  4K3I D;  3DWL C;  4ZOX A;  1XHM A;  4A08 A;  3SHF A;  3I8C A;  3I7O A;  2B4E A;  4A7J A;  5IJ7 E;  3CFV A;  1K8K C;  2GC7 A;  4NSX A;  2IUR A;  5EM2 B;  4CI8 A;  3EMH A;  2J57 G;  2HKR A;  5HE3 B;  3EI4 B;  3SWS D;  4XYI A;  2I3T A;  3OW8 A;  2Q7Q A;  2OK4 A;  4L1Q D;  4O9D A;  3JB9 L;  4CZV A;  4GGC A;  2PM7 B;  3IJ0 A;  2P9L C;  1JOF A;  2YBA A;  1B9X A;  2YB8 B;  3IIY A;  2AH1 A;  5FKT A;  3PVU B;  2Z2O A;  4FA9 D;  3E0C A;  1SHY B;  4KFM B;  2OVQ B;  1GP2 B;  4ZOV A;  3CFS B;  1PBY B;  3SBP A;  3F3P A;  3JZH A;  3C5M A;  1P22 A;  4PXW A;  1GG2 B;  3AL8 B;  3FRX A;  4A2M A;  5TF2 A;  3EI3 A;  4H5I A;  2OIZ A;  3JAM g;  2YNP A;  2W18 A;  1A0R B;  4U7A A;  3U4Y A;  4JT6 C;  4FWW A;  4K3J B;  3MZK A;  4PNK B;  5TEF A;  5EM2 A;  4AOW A;  2P9N C;  3I7N A;  3OL2 A;  5I5I A;  1R5M A;  4E5Z A;  1JMZ B;  2IAA A;  2AH0 A;  5SXM A;  1RI6 A;  5AFU 3;  5CYK B;  3BWS A;  1FWX A;  5C2W B;  4A08 B;  1S4U X;  5FLX g;  3RFG A;  1PGU A;  4LG8 A;  4X3E A;  3UVM A;  4PBY A;  3EWE A;  3SJL D;  4R7A B;  3RN0 D;  3GRE A;  5THA A;  4CC9 A;  3PE7 A;  4J86 A;  3UVL A;  2I0T A;  2P9U C;  4GGA A;  3I7P A;  2YMU A;  4G56 B;  4IA9 A;  3PVW B;  4FHL A;  5FKQ A;  3C99 A;  4H5J A;  4CY3 A;  4GM9 A;  3MKS B;  2IUV A;  5FKS A;  3NVN A;  3C9C A;  5CXB A;  2AQ5 A; 
#chains in the Genus database with same CATH topology
 3F3G A;  1JV2 A;  4UI9 R;  4PBZ A;  4O3U B;  5FFO A;  3IJE A;  4A09 A;  3SBQ A;  1YFQ A;  4WK2 A;  4J0X A;  3EU7 A;  2O9K A;  3IUN A;  1QNI A;  2PBI B;  4BH6 A;  1U2V C;  1TYE A;  2VDQ A;  5C86 A;  3I7L A;  4N14 A;  1JJU B;  4J81 A;  2HU5 A;  4IMM A;  5EML B;  1GOT B;  5EMK B;  2XL2 A;  4L3G D;  4X60 B;  2H6K A;  2H9L A;  1YR2 A;  1M1X A;  3JRP A;  5CXB B;  4BCB A;  2CO0 A;  4D6V A;  4BP9 A;  3SLE D;  1K32 A;  2B5M A;  3T3M A;  2QZP A;  4Y7R A;  5M61 A;  1UOP A;  3L4O D;  3NIF A;  4J79 A;  5HDB A;  1XKS A;  4ES0 A;  4O45 A;  2CO0 C;  3DXK C;  3ZDY A;  2CE9 A;  3EI2 A;  4QL1 A;  4JHP C;  3FM0 A;  1OLZ A;  3IUJ A;  3DXM C;  1I2M B;  2OK6 A;  2I0S A;  4ERY A;  4Z7O A;  5EAL A;  3FGB A;  3FCU A;  3V4V A;  2XDW A;  4GM3 A;  3BG0 A;  2I3S A;  5H1M A;  2YNO A;  2XYI A;  1TYQ C;  2Z2P A;  3UR4 A;  3QI0 A;  3OKY A;  5GMK n;  2J56 H;  1TBG A;  2GC4 A;  4J87 A;  4Z8L A;  2AGY A;  4FB1 D;  4O3T B;  3EI1 B;  4O1Q D;  3GFC A;  4A11 A;  5TDH B;  1N6E A;  2HXC A;  5E6S A;  4CZX A;  2VDR A;  3UKR C;  5HE1 B;  3EI3 B;  3RN1 D;  3ZDZ A;  4DNU A;  3SXT D;  2CNX A;  4GQB B;  3ZE1 A;  4ERZ A;  5KDO B;  2XE4 A;  4J8B A;  3F3F A;  2OVR B;  3KRX B;  3MKQ A;  4JD2 C;  4O2W A;  3ZE0 A;  4JSN C;  4AN1 A;  5EMJ B;  1N6F A;  3UVN A;  3V7D B;  3K6S A;  2GNQ A;  5AJA A;  3I8E A;  5K19 A;  3HFQ A;  4LG9 A;  2OJY A;  4MMY A;  3BG1 A;  4UM8 A;  5FQD A;  2H47 A;  4D0K A;  2B5L A;  2TRC B;  4BUJ C;  3O4G A;  3PXT D;  4LGN A;  3SN6 B;  4MK0 B;  2G99 A;  3OKT A;  4CY2 A;  3O4H A;  1SQ9 A;  4GM8 A;  5CXC B;  2VZ1 A;  3IIW A;  3L4M D;  3B7F A;  2H6N A;  4A0A B;  5AMS A;  3W15 A;  5B4W A;  4A0B B;  3AH8 B;  4QRJ A;  1L5G A;  3PSL A;  4BL0 A;  2P9I C;  1MG3 A;  4A2L A;  5IC7 A;  3RLM D;  5HE2 B;  2AGW A;  1PI6 A;  4JSX C;  3OKY B;  1OMW B;  3SMR A;  2QC5 A;  5CXC A;  4PC0 A;  5GXI A;  4JHN A;  2QXV A;  1O6G A;  2MTA H;  1C9I A;  1NR0 A;  5JWZ A;  4D9S A;  2IWF A;  4J78 A;  2HKM A;  3EG6 A;  3IVM A;  3DM0 A;  4CY5 A;  2P9K C;  3RFH A;  4EWR A;  1H2X A;  3IJ1 A;  1E8N A;  1NEX B;  3ZDX A;  4A09 B;  5M5T A;  2CN3 A;  3I89 A;  3JPX A;  4JSV C;  4AEZ A;  3DSM A;  2P9P C;  3EQ7 A;  3MMY A;  5E6U A;  3T3P A;  1K3I A;  1H2W A;  2AGL A;  3IKO A;  4G1E A;  4ESG A;  2H9M A;  3OL2 B;  1H2Y A;  3MZL A;  4J8G A;  4E54 B;  1VYH C;  3NVX A;  1SQJ A;  3ODT A;  5CYK A;  3UVK A;  3J80 g;  3OTT A;  4JXM A;  2AGX A;  3A0F A;  1C9L A;  2VDN A;  4GQ1 A;  1PEV A;  4ERQ A;  4L3H D;  5A2Q g;  4Y5R D;  1U8C A;  2HYE A;  1VE6 A;  2PM9 A;  4J77 A;  2B5N A;  4G1M A;  5H14 A;  1QFM A;  5C2V B;  5IGQ A;  4A0A A;  1L0Q A;  5M5S A;  4A0B A;  3C75 H;  2XU7 A;  2VDP A;  5FKR A;  1VZ2 A;  3VA6 A;  2HJB A;  2PM6 B;  3IUM A;  3P4F A;  3SFZ A;  5GSA A;  4J0W A;  3ULE C;  4BCC A;  4GGD A;  5FA5 B;  1MG2 A;  2PM9 B;  3RMZ D;  2CN2 A;  3MXX A;  3ORV D;  4NAA A;  4AN0 A;  4J84 A;  3SCY A;  2YNN A;  4GQ2 P;  3J81 g;  3VGZ A;  4CI1 A;  3UKU C;  4E5Z B;  3PXW D;  3V9F A;  5H17 A;  2BCJ B;  3IUR A;  1GOG A;  4MMZ A;  3KRW B;  5C9Z B;  3JZG A;  3SVW D;  5IGO A;  4IRZ A;  5EAR A;  4WK0 A;  3VH0 A;  1GOF A;  2IUP A;  4YVD A;  3AL9 A;  3K27 A;  4CI3 A;  5EAM A;  4FA1 D;  4PSW B;  1ERJ A;  2VDK A;  4ZN4 A;  2H13 A;  5FXY A;  1B9Y A;  1JMX B;  4FAV D;  3PXS D;  2EIE A;  4GMB A;  5FFG A;  4PSX B;  3N0E A;  5I5J A;  2Z2N A;  5EMM B;  5GXH A;  4CY1 A;  4FA5 D;  4ZOZ A;  3AL8 A;  3NID A;  5M5R A;  3RSE C;  5HQG A;  4ZOY A;  3OKW A;  3IUL A;  4GZ8 A;  1BPO A;  1MDA H;  2UZX B;  5M5V A;  3EI2 B;  2VDL A;  3O4I A;  2EID A;  3I2N A;  2H9N A;  4JT5 C;  1UOO A;  4NC4 A;  3SBR A;  4E54 A;  5HYN B;  4QQE A;  3V4P A;  5TEE A;  1UOQ A;  2HJ4 A;  5K1C C;  4MMX A;  3N0D A;  3UVO A;  4AX4 A;  2H3X A;  3K26 A;  4WJK A;  4TZ4 A;  3O4J A;  4X63 B;  4CI2 A;  3EI1 A;  3JRO A;  2XL3 A;  3EI4 A;  2H6Q A;  2H14 A;  4O02 A;  3QHY B;  2HES X;  3K72 A;  2IUQ A;  3ZWL B;  5IJ8 E;  2G9A A;  3IJC A;  3NVQ A;  5HE0 B;  3V5W B;  3PSC B;  2P9S C;  1GXR A;  2OVP B;  1N6D A;  2I0R A;  4FA4 D;  1GOH A;  3I7H A;  4JSP C;  3I7K A;  4U1E I;  1Q47 A;  5I5M A;  2EIB A;  3GC3 B;  3AFC A;  2UZY B;  3CIK B;  2H9P A;  5IT9 g;  4Z7N A;  3FCS A;  4HDJ A;  3JZN A;  4FAN D;  4XEI C;  3MUN A;  3RRM C;  4J82 A;  5EAP A;  1T2X A;  4X61 B;  3EQ9 A;  2AGZ A;  4A11 B;  1XIP A;  2EBS A;  4J73 A;  4BCD A;  4I79 A;  2BBK H;  4OWR A;  2QR5 A;  4L1M A;  2H68 A;  4XYH A;  2J55 H;  4QT8 A;  4CZY A;  4OZU A;  3DDU A;  1U4C A;  2CE8 A;  4L9O A;  5E6R A;  1UTC A;  2IWK A;  4K3I D;  3DWL C;  2XZG A;  4ZOX A;  1XHM A;  4A08 A;  3OF7 A;  3SHF A;  3I8C A;  3I7O A;  2B4E A;  4A7J A;  5IJ7 E;  4WK4 A;  1VE7 A;  3CFV A;  1E8M A;  1K8K C;  2GC7 A;  4NSX A;  2IUR A;  5EM2 B;  2VDO A;  4CI8 A;  3VI4 A;  3EMH A;  3NIG A;  2J57 G;  2HKR A;  5HE3 B;  3EI4 B;  3SWS D;  4XYI A;  2I3T A;  3OW8 A;  2Q7Q A;  2OK4 A;  3MUO A;  4NEN A;  4L1Q D;  4O9D A;  3JB9 L;  3VI3 A;  4CZV A;  4GGC A;  2BKL A;  2PM7 B;  3IJ0 A;  2P9L C;  1JOF A;  4RE6 A;  2YBA A;  1B9X A;  2YB8 B;  4DNV A;  3MVD K;  3IIY A;  2AH1 A;  5FKT A;  3PVU B;  2Z2O A;  4FA9 D;  3E0C A;  4G55 A;  1SHY B;  4KFM B;  2OVQ B;  1GP2 B;  4ZOV A;  3CFS B;  1O6F A;  1PBY B;  2VDM A;  4AMY A;  1E5T A;  3SBP A;  3F3P A;  1VZ3 A;  3JZH A;  3C5M A;  1P22 A;  4PXW A;  1GG2 B;  3AL8 B;  1JTD B;  3FRX A;  3KCI A;  2VZ3 A;  4A2M A;  5TF2 A;  3ZE2 A;  3EI3 A;  3GD1 I;  4H5I A;  2OIZ A;  3JAM g;  2YNP A;  2W18 A;  1A0R B;  4U7A A;  3U4Y A;  4JT6 C;  3EQ8 A;  1QFS A;  4Z7Q A;  1A12 A;  2WQ8 A;  4FWW A;  4K3J B;  3MZK A;  4PNK B;  5TEF A;  5EM2 A;  4AOW A;  4BP8 A;  2P9N C;  3I7N A;  3OL2 A;  5I5I A;  1R5M A;  4E5Z A;  1JMZ B;  2IAA A;  4DNW A;  2AH0 A;  5SXM A;  3K71 A;  1RI6 A;  5AFU 3;  5CYK B;  4QAM A;  3BWS A;  4RE5 A;  5C92 A;  1FWX A;  5C2W B;  4NBM A;  4A08 B;  1S4U X;  5FLX g;  3RFG A;  1PGU A;  4LG8 A;  4X3E A;  2JKX A;  3UVM A;  4UM9 A;  3EWE A;  4PBY A;  3SJL D;  4R7A B;  3RN0 D;  3GRE A;  5THA A;  3IUQ A;  4CC9 A;  3PE7 A;  4J86 A;  3UVL A;  2I0T A;  2P9U C;  4GGA A;  3I7P A;  1H2Z A;  2YMU A;  4G56 B;  4IA9 A;  2VC2 A;  3PVW B;  4FHL A;  5FKQ A;  4AMZ A;  5M5U A;  3C99 A;  4H5J A;  4CY3 A;  4GM9 A;  2HU7 A;  3MKS B;  2IUV A;  5FKS A;  2HU8 A;  3NVN A;  3C9C A;  2EIC A;  5CXB A;  2AQ5 A; 
#chains in the Genus database with same CATH homology
 3F3G A;  4UI9 R;  4PBZ A;  4O3U B;  4A09 A;  3SBQ A;  1YFQ A;  4J0X A;  3EU7 A;  2O9K A;  1QNI A;  2PBI B;  4BH6 A;  1U2V C;  3I7L A;  4N14 A;  1JJU B;  4J81 A;  4IMM A;  5EML B;  1GOT B;  5EMK B;  2XL2 A;  4L3G D;  4X60 B;  2H6K A;  2H9L A;  5CXB B;  3JRP A;  4D6V A;  2CO0 A;  3SLE D;  1K32 A;  2B5M A;  4Y7R A;  3L4O D;  4J79 A;  1XKS A;  4ES0 A;  4O45 A;  2CO0 C;  3DXK C;  2CE9 A;  3EI2 A;  4QL1 A;  3FM0 A;  1OLZ A;  3DXM C;  2OK6 A;  2I0S A;  4ERY A;  5EAL A;  3FGB A;  4GM3 A;  2I3S A;  3BG0 A;  5H1M A;  2YNO A;  2XYI A;  1TYQ C;  2Z2P A;  3UR4 A;  3OKY A;  5GMK n;  2J56 H;  1TBG A;  2GC4 A;  4J87 A;  4Z8L A;  2AGY A;  4FB1 D;  4O3T B;  3EI1 B;  4O1Q D;  3GFC A;  4A11 A;  5TDH B;  1N6E A;  2HXC A;  4CZX A;  3UKR C;  5HE1 B;  3EI3 B;  3RN1 D;  3SXT D;  2CNX A;  4GQB B;  4ERZ A;  5KDO B;  4J8B A;  3F3F A;  2OVR B;  3KRX B;  3MKQ A;  4JD2 C;  4JSN C;  5EMJ B;  1N6F A;  3UVN A;  3V7D B;  2GNQ A;  5AJA A;  3I8E A;  5K19 A;  3HFQ A;  4LG9 A;  2OJY A;  3BG1 A;  5FQD A;  2H47 A;  4D0K A;  2B5L A;  2TRC B;  4BUJ C;  4LGN A;  3PXT D;  3SN6 B;  4MK0 B;  2G99 A;  3OKT A;  4CY2 A;  1SQ9 A;  4GM8 A;  5CXC B;  3IIW A;  3L4M D;  3B7F A;  2H6N A;  4A0A B;  5AMS A;  3W15 A;  5B4W A;  4A0B B;  3AH8 B;  4QRJ A;  3PSL A;  4BL0 A;  2P9I C;  1MG3 A;  4A2L A;  5IC7 A;  3RLM D;  5HE2 B;  2AGW A;  1PI6 A;  4JSX C;  3OKY B;  1OMW B;  3SMR A;  2QC5 A;  5CXC A;  4PC0 A;  5GXI A;  2QXV A;  2MTA H;  1NR0 A;  5JWZ A;  2IWF A;  4J78 A;  2HKM A;  3EG6 A;  3DM0 A;  4CY5 A;  2P9K C;  3RFH A;  4EWR A;  3IJ1 A;  1NEX B;  4A09 B;  2CN3 A;  3I89 A;  3JPX A;  4JSV C;  4AEZ A;  3DSM A;  2P9P C;  3MMY A;  3IKO A;  2AGL A;  4ESG A;  2H9M A;  3OL2 B;  4J8G A;  3MZL A;  4E54 B;  1VYH C;  3NVX A;  1SQJ A;  3ODT A;  5CYK A;  3UVK A;  3J80 g;  3OTT A;  4JXM A;  2AGX A;  3A0F A;  4GQ1 A;  1PEV A;  4ERQ A;  4L3H D;  5A2Q g;  4Y5R D;  2HYE A;  2PM9 A;  4J77 A;  2B5N A;  5H14 A;  5IGQ A;  5C2V B;  4A0A A;  1L0Q A;  4A0B A;  3C75 H;  2XU7 A;  5FKR A;  3VA6 A;  2HJB A;  2PM6 B;  3P4F A;  3SFZ A;  5GSA A;  4J0W A;  3ULE C;  4GGD A;  5FA5 B;  1MG2 A;  2PM9 B;  3RMZ D;  2CN2 A;  3MXX A;  3ORV D;  4J84 A;  3SCY A;  2YNN A;  4GQ2 P;  3J81 g;  3VGZ A;  4CI1 A;  3UKU C;  4E5Z B;  3PXW D;  3V9F A;  5H17 A;  2BCJ B;  3KRW B;  5C9Z B;  3JZG A;  3SVW D;  5IGO A;  5EAR A;  3VH0 A;  4YVD A;  2IUP A;  3AL9 A;  3K27 A;  4CI3 A;  5EAM A;  4FA1 D;  4PSW B;  1ERJ A;  4ZN4 A;  2H13 A;  5FXY A;  1B9Y A;  1JMX B;  4FAV D;  3PXS D;  4GMB A;  4PSX B;  3N0E A;  5I5J A;  2Z2N A;  5EMM B;  5GXH A;  4CY1 A;  4FA5 D;  4ZOZ A;  3AL8 A;  4ZOY A;  3RSE C;  5HQG A;  3OKW A;  4GZ8 A;  1MDA H;  2UZX B;  3EI2 B;  3I2N A;  4JT5 C;  2H9N A;  4E54 A;  3SBR A;  5HYN B;  4QQE A;  5TEE A;  2HJ4 A;  5K1C C;  3N0D A;  3UVO A;  2H3X A;  3K26 A;  4TZ4 A;  4X63 B;  4CI2 A;  3EI1 A;  3JRO A;  2XL3 A;  3EI4 A;  2H6Q A;  2H14 A;  2HES X;  2IUQ A;  3ZWL B;  5IJ8 E;  2G9A A;  3IJC A;  3NVQ A;  5HE0 B;  3V5W B;  3PSC B;  2P9S C;  1GXR A;  2OVP B;  1N6D A;  2I0R A;  4FA4 D;  3I7H A;  4JSP C;  3I7K A;  4U1E I;  1Q47 A;  5I5M A;  3AFC A;  2UZY B;  3CIK B;  2H9P A;  5IT9 g;  4HDJ A;  3JZN A;  4FAN D;  4XEI C;  3RRM C;  4J82 A;  5EAP A;  4X61 B;  2AGZ A;  4A11 B;  2EBS A;  1XIP A;  4J73 A;  4OWR A;  2BBK H;  4I79 A;  2H68 A;  4XYH A;  2J55 H;  4QT8 A;  4CZY A;  4OZU A;  1U4C A;  2CE8 A;  4L9O A;  2IWK A;  4K3I D;  3DWL C;  4ZOX A;  1XHM A;  4A08 A;  3SHF A;  3I8C A;  3I7O A;  2B4E A;  4A7J A;  5IJ7 E;  3CFV A;  1K8K C;  2GC7 A;  4NSX A;  2IUR A;  5EM2 B;  4CI8 A;  3EMH A;  2J57 G;  2HKR A;  5HE3 B;  3EI4 B;  3SWS D;  4XYI A;  2I3T A;  3OW8 A;  2Q7Q A;  2OK4 A;  4L1Q D;  4O9D A;  3JB9 L;  4CZV A;  4GGC A;  2PM7 B;  3IJ0 A;  2P9L C;  1JOF A;  2YBA A;  1B9X A;  2YB8 B;  3IIY A;  2AH1 A;  5FKT A;  3PVU B;  2Z2O A;  4FA9 D;  3E0C A;  1SHY B;  4KFM B;  2OVQ B;  1GP2 B;  4ZOV A;  3CFS B;  1PBY B;  3SBP A;  3F3P A;  3JZH A;  3C5M A;  1P22 A;  4PXW A;  1GG2 B;  3AL8 B;  3FRX A;  4A2M A;  5TF2 A;  3EI3 A;  4H5I A;  2OIZ A;  3JAM g;  2YNP A;  2W18 A;  1A0R B;  4U7A A;  3U4Y A;  4JT6 C;  4FWW A;  4K3J B;  3MZK A;  4PNK B;  5TEF A;  5EM2 A;  4AOW A;  2P9N C;  3I7N A;  3OL2 A;  5I5I A;  1R5M A;  4E5Z A;  1JMZ B;  2IAA A;  2AH0 A;  5SXM A;  1RI6 A;  5AFU 3;  5CYK B;  3BWS A;  1FWX A;  5C2W B;  4A08 B;  1S4U X;  5FLX g;  3RFG A;  1PGU A;  4LG8 A;  4X3E A;  3UVM A;  4PBY A;  3EWE A;  3SJL D;  4R7A B;  3RN0 D;  3GRE A;  5THA A;  4CC9 A;  3PE7 A;  4J86 A;  3UVL A;  2I0T A;  2P9U C;  4GGA A;  3I7P A;  2YMU A;  4G56 B;  4IA9 A;  3PVW B;  4FHL A;  5FKQ A;  3C99 A;  4H5J A;  4CY3 A;  4GM9 A;  3MKS B;  2IUV A;  5FKS A;  3NVN A;  3C9C A;  5CXB A;  2AQ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...