3F3GA

Crystal structure of the nucleoporin pair nup85-seh1, space group p212121
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
347
structure length
300
Chain Sequence
MQPFDSGHDDLVHDVVYDFYGRHVATCSSDQHIKVFKLDKDTSNWELSDSWRAHDSSIVAIDWASPEYGRIIASASYDKTVKLWEEDPDQEECSGRRWNKLCTLNDSKGSLYSVKFAPAHLGLKLACLGNDGILRLYDALEPSDLRSWTLTSEMKVLSIPSDFCLSWCPSRFSPEKLAVSALEQAIIYQRGKDGKLHVAAKLPGHKSLIRSISWAPSIGRWYQLIATGCKDGRIRIFKITEKSNLQVELLSEHDDHNGEVWSVSWNLTGTILSSAGDDGKVRLWKATYSNEFKCMSVITA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleoporin SEH1
publication title A fence-like coat for the nuclear pore membrane.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural protein
total genus 59
structure length 300
sequence length 347
chains with identical sequence B, E, F
ec nomenclature
pdb deposition date 2008-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3f3gA01
2B4EA 2Z2NA 4JD2C 3KRWB 3OKYA 3ODTA 2IAAA 5H14A 2W18A 2J56H 4E54A 2H3XA 3SWSD 5EAMA 1ERJA 1K8KC 4PXWA 5SXMA 3B7FA 4Y7RA 4AOWA 2IUPA 3C75H 4CY3A 4ZOZA 5C9ZB 1PGUA 4JT6C 4GM9A 2H9LA 2PM7B 2OVQB 2HESX 5IC7A 2H68A 3UVNA 3UKRC 5HE1B 5H17A 3VA6A 3AL8A 1VYHC 5THAA 4JSPC 2CE8A 3K26A 3OW8A 4CZXA 4BUJC 4PBYA 4E5ZB 4A0AB 1SQ9A 3RFGA 5KDOB 3RSEC 1Q47A 3SHFA 3MKQA 3SN6B 1R5MA 2P9SC 3F3FA 4L9OA 4BH6A 4O3TB 4A11B 5I5MA 2OVRB 4A08A 3GREA 4MK0B 4L3HD 4A2MA 2HXCA 3JB9L 4OZUA 3ORVD 4YVDA 5EMKB 3I7NA 4E5ZA 5FKSA 4A0AA 3EU7A 5IT9g 4XEIC 5AJAA 1N6FA 3EI2A 3CFVA 3PVWB 2AH1A 4QRJA 4A11A 5CXCB 4J87A 2HJ4A 2GC7A 4J86A 4J8BA 4AEZA 2HYEA 5JWZA 2P9PC 4CZYA 2H9NA 3C99A 3C5MA 2IWKA 5K19A 3W15A 1SQJA 5EALA 3NVXA 3I7LA 4A7JA 3F3PA 5CYKB 5HE2B 3GFCA 3V5WB 2YNNA 2G99A 5K1CC 3I7HA 1K32A 2P9LC 4XYIA 4ERQA 5AMSA 3IJ0A 1JMXB 4CZVA 4J77A 3L4MD 5GXHA 4LG9A 4A0BB 5EARA 5TEFA 4FA4D 2H6QA 5EMJB 5H1MA 4ES0A 3PSCB 3PE7A 3OTTA 5IGQA 3EG6A 2IUQA 3I89A 4PSXB 3IJ1A 3CFSB 1S4UX 4CY1A 1A0RB 2XU7A 3SXTD 2G9AA 3DXMC 5GMKn 3SCYA 3AL8B 5FQDA 4CI1A 3BG1A 2I0SA 4GMBA 1XIPA 1FWXA 4QQEA 4H5JA 2H13A 4GZ8A 3PXTD 2Z2PA 3SBQA 2CO0C 2O9KA 4CC9A 5I5IA 4D6VA 4J78A 4FWWA 2XYIA 4J8GA 3V7DB 3HFQA 1JOFA 4PC0A 3RFHA 4A08B 2P9UC 4O1QD 2AGWA 2YNPA 3JAMg 4PNKB 2AGYA 3E0CA 4QL1A 3RN0D 4FAND 4GQ1A 4X61B 3FM0A 5HE3B 3RLMD 4FA5D 3I2NA 4JSXC 1NEXB 1B9XA 3I7PA 5AFU3 3EI1B 1XHMA 2I0RA 3EI2B 4J79A 3SBPA 2EBSA 1PI6A 2MTAH 3AH8B 3MMYA 2BBKH 2H47A 3OL2B 4J81A 2YMUA 4FHLA 5HE0B 3SVWD 5FKTA 3SLED 4X60B 4HDJA 5FKQA 5HYNB 2HJBA 4L3GD 5TEEA 5IJ7E 3EI1A 2Q7QA 2CO0A 4GGCA 3AL9A 3N0DA 1MDAH 2OVPB 2YBAA 2TRCB 3OL2A 1GXRA 2AGLA 2H14A 4CI3A 1YFQA 4O45A 4D0KA 1XKSA 1B9YA 2J55H 2AGZA 2I3TA 3PXSD 3NVQA 3ZWLB 1PEVA 4G56B 1RI6A 2AGXA 4A2LA 2UZXB 2PBIB 2H6KA 3JRPA 3SFZA 3EMHA 2HKMA 4JSNC 4X3EA 4ERYA 4ERZA 2QXVA 3I8EA 4CI2A 3UVKA 3IKOA 2XL2A 3C9CA 1SHYB 3RMZD 2BCJB 5C2WB 3JZHA 3P4FA 3EWEA 1N6EA 4OWRA 5IGOA 4Y5RD 3J81g 3FRXA 3MZLA 2AQ5A 4BL0A 2AH0A 2YNOA 4X63B 4Z8LA 3L4OD 4GQ2P 1N6DA 4FB1D 3NVNA 4L1QD 5FLXg 4JT5C 3MZKA 4GGDA 3EI3B 3IJCA 3UR4A 4CY2A 3UKUC 3V9FA 3EI4A 4PBZA 4ZOYA 3VGZA 2P9NC 4GM3A 3FGBA 5I5JA 4A09A 4JXMA 3UVLA 3RRMC 1MG2A 2Z2OA 3DM0A 1MG3A 3I7KA 2OIZA 4J84A 5EMLB 3EI3A 3PSLA 4LGNA 2OK4A 3AFCA 3I7OA 5HQGA 5GXIA 5EM2B 3U4YA 4FA1D 2I3SA 5EMMB 2CE9A 4EWRA 2GC4A 5CXBB 5GSAA 2B5LA 2J57G 4N14A 2P9IC 4FA9D 1L0QA 1JJUB 5A2Qg 4ZOVA 5EM2A 4CY5A 2YB8B 3KRXB 4LG8A 3SMRA 1TBGA 5B4WA 2PM6B 4R7AB 4FAVD 3PXWD 5CXBA 3IIYA 3I8CA 1PBYB 2GNQA 4O9DA 4K3JB 3DXKC 4GM8A 3BWSA 3ULEC 4U1EI 4TZ4A 2H6NA 4GGAA 4J0WA 3PVUB 2P9KC 2IWFA 4J0XA 3CIKB 3SJLD 3MXXA 4IMMA 5TF2A 1GP2B 1P22A 3UVMA 3JZNA 4PSWB 4J82A 4CI8A 3N0EA 5FA5B 2B5MA 5IJ8E 4ZN4A 2CN2A 5EAPA 4U7AA 4H5IA 1GOTB 3SBRA 2PM9B 3A0FA 2H9MA 3BG0A 3DSMA 2H9PA 4O3UB 4ESGA 4ZOXA 3EI4B 1TYQC 1OLZA 3IIWA 2HKRA 1NR0A 2IUVA 5CXCA 2CNXA 5C2VB 3DWLC 4JSVC 4A09B 3JZGA 3J80g 3JPXA 3OKWA 4J73A 2PM9A 4I79A 3RN1D 3UVOA 2UZYB 2XL3A 3OKTA 4KFMB 5FXYA 3K27A 2IURA 3OKYB 2QC5A 1U4CA 5FKRA 2B5NA 1GG2B 4IA9A 2OJYA 1JMZB 5CYKA 4E54B 4UI9R 1U2VC 4XYHA 1OMWB 3VH0A 4NSXA 2I0TA 2CN3A 3F3GA 3MKSB 5TDHB 3JROA 4GQBB 4QT8A 2OK6A 1QNIA 4A0BA 4K3ID
chains in the Genus database with same CATH superfamily
3ZE2A 2B4EA 2Z2NA 4JD2C 3KRWB 3OKYA 3ODTA 2IAAA 4WJKA 5H14A 2W18A 2J56H 4E54A 4DNWA 2H3XA 3SWSD 5EAMA 1ERJA 1K8KC 2VC2A 4PXWA 5SXMA 3B7FA 4Y7RA 4AOWA 2IUPA 3C75H 4CY3A 4ZOZA 5C9ZB 1PGUA 1K3IA 4JT6C 4GM9A 2H9LA 2PM7B 2OVQB 2HESX 5IC7A 2H68A 3UVNA 3UKRC 4WK0A 5H17A 5HE1B 3VA6A 3AL8A 1VYHC 3IULA 4L1MA 5THAA 4D9SA 2VDKA 4JSPC 3O4GA 2CE8A 3K26A 3OW8A 4CZXA 4BUJC 4PBYA 4E5ZB 4A0AB 1SQ9A 3NIGA 3IURA 3RFGA 5KDOB 3T3MA 3RSEC 1JV2A 1Q47A 3VI4A 3SHFA 3MKQA 3SN6B 1R5MA 5E6UA 2P9SC 3F3FA 4L9OA 4BH6A 4O3TB 4A11B 1L5GA 5I5MA 2OVRB 4A08A 3GREA 3V4VA 4MK0B 4L3HD 4A2MA 4DNVA 2HXCA 3JB9L 4OZUA 3ORVD 4YVDA 5EMKB 1UOPA 3I7NA 4E5ZA 5FKSA 4A0AA 3EU7A 5IT9g 3MUNA 3NIFA 4XEIC 4BCDA 1O6FA 5AJAA 1N6FA 5FFGA 3EI2A 3CFVA 3PVWB 2AH1A 4QRJA 4A11A 2BKLA 5CXCB 4J87A 2HJ4A 2GC7A 4J86A 4J8BA 3IJEA 4AEZA 2HYEA 5JWZA 2P9PC 1TYEA 4CZYA 2H9NA 4BP8A 3QHYB 3C99A 3MVDK 3C5MA 2IWKA 5K19A 5C92A 3W15A 2XE4A 1SQJA 5EALA 1H2XA 3NVXA 3I7LA 4A7JA 3F3PA 5CYKB 5HE2B 3GFCA 3V5WB 2YNNA 2G99A 4Z7QA 3VI3A 1QFMA 5K1CC 3I7HA 1K32A 2P9LC 4XYIA 4ERQA 3V4PA 5AMSA 3IJ0A 1JMXB 4CZVA 4J77A 3L4MD 5GXHA 3EQ8A 4LG9A 4A0BB 5EARA 5TEFA 4FA4D 2H6QA 5EMJB 1BPOA 5H1MA 5E6SA 4ES0A 3PSCB 3PE7A 3OTTA 2VZ3A 5IGQA 1E8NA 3EG6A 2IUQA 3I89A 5C86A 4PSXB 3IJ1A 3CFSB 1I2MB 1S4UX 4CY1A 1A0RB 2XU7A 3SXTD 2G9AA 3DXMC 5GMKn 3SCYA 2EIEA 3AL8B 5FQDA 4CI1A 2VDLA 3BG1A 2I0SA 4GMBA 1XIPA 1FWXA 4QQEA 4H5JA 3MUOA 2EIDA 4NC4A 4AX4A 2H13A 4G1EA 4BCBA 4GZ8A 3PXTD 2Z2PA 3SBQA 4NAAA 2CO0C 2O9KA 4CC9A 5I5IA 4D6VA 3O4IA 4J78A 4FWWA 2XYIA 4J8GA 3V7DB 3HFQA 3O4JA 1JOFA 4NENA 4PC0A 3RFHA 4A08B 2P9UC 4O1QD 2AGWA 2YNPA 3JAMg 4PNKB 2AGYA 4NBMA 2VZ1A 3E0CA 4QL1A 3RN0D 4FAND 4GQ1A 4X61B 3FM0A 5HE3B 3RLMD 4FA5D 1T2XA 3FCSA 4AN1A 3I2NA 4JSXC 1NEXB 1B9XA 3I7PA 5AFU3 1GOHA 3EI1B 5FFOA 1XHMA 2I0RA 3EI2B 4J79A 3SBPA 2EBSA 1PI6A 2MTAH 3AH8B 4G1MA 3MMYA 3NIDA 2BBKH 4JHNA 2H47A 1GOGA 3OL2B 4J81A 1H2YA 2YMUA 1H2WA 4FHLA 5HE0B 1VZ2A 3SVWD 5FKTA 3SLED 4X60B 4HDJA 2VDRA 5FKQA 1C9IA 5HYNB 2HU7A 2HJBA 4L3GD 5TEEA 5IJ7E 1M1XA 5M5TA 1U8CA 3EI1A 5M61A 3DDUA 2Q7QA 2CO0A 4GGCA 3AL9A 3N0DA 1MDAH 2OVPB 2YBAA 5HDBA 2TRCB 3OL2A 1GXRA 2AGLA 5M5RA 2H14A 4CI3A 1YFQA 4O45A 4D0KA 1XKSA 1B9YA 2J55H 2AGZA 2I3TA 3PXSD 3NVQA 3ZWLB 1PEVA 4G56B 1RI6A 2AGXA 4A2LA 2UZXB 2PBIB 2H6KA 3T3PA 3JRPA 3SFZA 3EMHA 2HKMA 4JSNC 4X3EA 2HU5A 5M5SA 4ERYA 4ERZA 2QXVA 3IUQA 3I8EA 4CI2A 3UVKA 3IKOA 2XL2A 3C9CA 1SHYB 4G55A 3RMZD 2VDOA 2BCJB 5C2WB 2QR5A 3JZHA 3P4FA 3K72A 3EWEA 1N6EA 4OWRA 3EQ9A 4Y5RD 5IGOA 3J81g 3FRXA 3MZLA 2AQ5A 3IVMA 2VDMA 4BL0A 2AH0A 2YNOA 4AMYA 4X63B 4Z8LA 3ZE1A 3L4OD 4GQ2P 1N6DA 4FB1D 3NVNA 4L1QD 5FLXg 4MMXA 4JT5C 5M5UA 3MZKA 4GGDA 3EI3B 3IJCA 3UR4A 4CY2A 4MMZA 3UKUC 4WK4A 1QFSA 3V9FA 3EI4A 2XZGA 4PBZA 4ZOYA 3VGZA 2P9NC 3GD1I 4GM3A 3FGBA 3ZDYA 5I5JA 4A09A 4JXMA 3UVLA 3RRMC 1H2ZA 1MG2A 1VZ3A 2Z2OA 4UM9A 3DM0A 2EIBA 1MG3A 3I7KA 5E6RA 2OIZA 4J84A 1O6GA 5EMLB 1UOOA 3EI3A 3PSLA 2XDWA 2VDQA 4LGNA 2OK4A 3AFCA 3I7OA 5HQGA 5GXIA 4Z7NA 5EM2B 3U4YA 3GC3B 4FA1D 2I3SA 3IUMA 5EMMB 3EQ7A 4BP9A 2CE9A 4EWRA 2GC4A 3K6SA 5CXBB 5GSAA 4AMZA 2B5LA 2J57G 4N14A 2P9IC 4FA9D 1L0QA 1JJUB 5A2Qg 4ZOVA 1UTCA 5EM2A 4CY5A 2YB8B 3KRXB 4LG8A 4MMYA 1TBGA 3SMRA 5B4WA 2PM6B 4R7AB 4FAVD 3FCUA 3PXWD 4O02A 1JTDB 5CXBA 3ZDZA 3IIYA 3I8CA 4WK2A 1PBYB 2VDNA 3O4HA 2GNQA 4O9DA 4K3JB 3K71A 3DXKC 4GM8A 3BWSA 3IUNA 4U1EI 3ULEC 4TZ4A 2H6NA 4GGAA 4J0WA 2HU8A 2WQ8A 3PVUB 2P9KC 4JHPC 2IWFA 1VE6A 4J0XA 1YR2A 3CIKB 3SJLD 3MXXA 4IMMA 1A12A 3QI0A 4UM8A 5TF2A 1GP2B 1P22A 4Z7OA 3UVMA 3JZNA 4PSWB 4J82A 4CI8A 3N0EA 5FA5B 2B5MA 2JKXA 5IJ8E 3IUJA 4ZN4A 2CN2A 5EAPA 4U7AA 4H5IA 1GOTB 4O2WA 2PM9B 3SBRA 3A0FA 2H9MA 3BG0A 3DSMA 4DNUA 4RE6A 2H9PA 4O3UB 4ESGA 4ZOXA 4IRZA 1UOQA 3EI4B 1TYQC 1OLZA 3IIWA 2HKRA 1NR0A 2IUVA 5CXCA 2CNXA 5C2VB 3DWLC 3KCIA 4JSVC 1C9LA 4A09B 3JZGA 3J80g 3JPXA 3ZDXA 2QZPA 1VE7A 5M5VA 3OKWA 4J73A 2VDPA 2PM9A 4I79A 3RN1D 3UVOA 2UZYB 2XL3A 3OKTA 4KFMB 5FXYA 3K27A 2IURA 3OKYB 2QC5A 4BCCA 1E8MA 1U4CA 2EICA 5FKRA 2B5NA 1GG2B 4IA9A 1GOFA 2OJYA 1JMZB 5CYKA 4E54B 4UI9R 1U2VC 3OF7A 4QAMA 4XYHA 1OMWB 3VH0A 1E5TA 4AN0A 4NSXA 3ZE0A 2I0TA 2CN3A 3F3GA 3MKSB 5TDHB 4RE5A 3JROA 4GQBB 4QT8A 2OK6A 1QNIA 4A0BA 4K3ID
chains in the Genus database with same CATH topology
2B4EA 2Z2NA 4JD2C 3KRWB 3OKYA 3ODTA 2IAAA 5H14A 2W18A 2J56H 4E54A 2H3XA 3SWSD 5EAMA 1ERJA 1K8KC 4PXWA 5SXMA 3B7FA 4Y7RA 4AOWA 2IUPA 3C75H 4CY3A 4ZOZA 5C9ZB 1PGUA 4JT6C 4GM9A 2H9LA 2PM7B 2OVQB 2HESX 5IC7A 2H68A 3UVNA 3UKRC 5HE1B 5H17A 3VA6A 3AL8A 1VYHC 5THAA 4JSPC 2CE8A 3K26A 3OW8A 4CZXA 4BUJC 4PBYA 4E5ZB 4A0AB 1SQ9A 3RFGA 5KDOB 3RSEC 1Q47A 3SHFA 3MKQA 3SN6B 1R5MA 2P9SC 3F3FA 4L9OA 4BH6A 4O3TB 4A11B 5I5MA 2OVRB 4A08A 3GREA 4MK0B 4L3HD 4A2MA 2HXCA 3JB9L 4OZUA 3ORVD 4YVDA 5EMKB 3I7NA 4E5ZA 5FKSA 4A0AA 3EU7A 5IT9g 4XEIC 5AJAA 1N6FA 3EI2A 3CFVA 3PVWB 2AH1A 4QRJA 4A11A 5CXCB 4J87A 2HJ4A 2GC7A 4J86A 4J8BA 4AEZA 2HYEA 5JWZA 2P9PC 4CZYA 2H9NA 3C99A 3C5MA 2IWKA 5K19A 3W15A 1SQJA 5EALA 3NVXA 3I7LA 4A7JA 3F3PA 5CYKB 5HE2B 3GFCA 3V5WB 2YNNA 2G99A 5K1CC 3I7HA 1K32A 2P9LC 4XYIA 4ERQA 5AMSA 3IJ0A 1JMXB 4CZVA 4J77A 3L4MD 5GXHA 4LG9A 4A0BB 5EARA 5TEFA 4FA4D 2H6QA 5EMJB 5H1MA 4ES0A 3PSCB 3PE7A 3OTTA 5IGQA 3EG6A 2IUQA 3I89A 4PSXB 3IJ1A 3CFSB 1S4UX 4CY1A 1A0RB 2XU7A 3SXTD 2G9AA 3DXMC 5GMKn 3SCYA 3AL8B 5FQDA 4CI1A 3BG1A 2I0SA 4GMBA 1XIPA 1FWXA 4QQEA 4H5JA 2H13A 4GZ8A 3PXTD 2Z2PA 3SBQA 2CO0C 2O9KA 4CC9A 5I5IA 4D6VA 4J78A 4FWWA 2XYIA 4J8GA 3V7DB 3HFQA 1JOFA 4PC0A 3RFHA 4A08B 2P9UC 4O1QD 2AGWA 2YNPA 3JAMg 4PNKB 2AGYA 3E0CA 4QL1A 3RN0D 4FAND 4GQ1A 4X61B 3FM0A 5HE3B 3RLMD 4FA5D 3I2NA 4JSXC 1NEXB 1B9XA 3I7PA 5AFU3 3EI1B 1XHMA 2I0RA 3EI2B 4J79A 3SBPA 2EBSA 1PI6A 2MTAH 3AH8B 3MMYA 2BBKH 2H47A 3OL2B 4J81A 2YMUA 4FHLA 5HE0B 3SVWD 5FKTA 3SLED 4X60B 4HDJA 5FKQA 5HYNB 2HJBA 4L3GD 5TEEA 5IJ7E 3EI1A 2Q7QA 2CO0A 4GGCA 3AL9A 3N0DA 1MDAH 2OVPB 2YBAA 2TRCB 3OL2A 1GXRA 2AGLA 2H14A 4CI3A 1YFQA 4O45A 4D0KA 1XKSA 1B9YA 2J55H 2AGZA 2I3TA 3PXSD 3NVQA 3ZWLB 1PEVA 4G56B 1RI6A 2AGXA 4A2LA 2UZXB 2PBIB 2H6KA 3JRPA 3SFZA 3EMHA 2HKMA 4JSNC 4X3EA 4ERYA 4ERZA 2QXVA 3I8EA 4CI2A 3UVKA 3IKOA 2XL2A 3C9CA 1SHYB 3RMZD 2BCJB 5C2WB 3JZHA 3P4FA 3EWEA 1N6EA 4OWRA 5IGOA 4Y5RD 3J81g 3FRXA 3MZLA 2AQ5A 4BL0A 2AH0A 2YNOA 4X63B 4Z8LA 3L4OD 4GQ2P 1N6DA 4FB1D 3NVNA 4L1QD 5FLXg 4JT5C 3MZKA 4GGDA 3EI3B 3IJCA 3UR4A 4CY2A 3UKUC 3V9FA 3EI4A 4PBZA 4ZOYA 3VGZA 2P9NC 4GM3A 3FGBA 5I5JA 4A09A 4JXMA 3UVLA 3RRMC 1MG2A 2Z2OA 3DM0A 1MG3A 3I7KA 2OIZA 4J84A 5EMLB 3EI3A 3PSLA 4LGNA 2OK4A 3AFCA 3I7OA 5HQGA 5GXIA 5EM2B 3U4YA 4FA1D 2I3SA 5EMMB 2CE9A 4EWRA 2GC4A 5CXBB 5GSAA 2B5LA 2J57G 4N14A 2P9IC 4FA9D 1L0QA 1JJUB 5A2Qg 4ZOVA 5EM2A 4CY5A 2YB8B 3KRXB 4LG8A 3SMRA 1TBGA 5B4WA 2PM6B 4R7AB 4FAVD 3PXWD 5CXBA 3IIYA 3I8CA 1PBYB 2GNQA 4O9DA 4K3JB 3DXKC 4GM8A 3BWSA 3ULEC 4U1EI 4TZ4A 2H6NA 4GGAA 4J0WA 3PVUB 2P9KC 2IWFA 4J0XA 3CIKB 3SJLD 3MXXA 4IMMA 5TF2A 1GP2B 1P22A 3UVMA 3JZNA 4PSWB 4J82A 4CI8A 3N0EA 5FA5B 2B5MA 5IJ8E 4ZN4A 2CN2A 5EAPA 4U7AA 4H5IA 1GOTB 3SBRA 2PM9B 3A0FA 2H9MA 3BG0A 3DSMA 2H9PA 4O3UB 4ESGA 4ZOXA 3EI4B 1TYQC 1OLZA 3IIWA 2HKRA 1NR0A 2IUVA 5CXCA 2CNXA 5C2VB 3DWLC 4JSVC 4A09B 3JZGA 3J80g 3JPXA 3OKWA 4J73A 2PM9A 4I79A 3RN1D 3UVOA 2UZYB 2XL3A 3OKTA 4KFMB 5FXYA 3K27A 2IURA 3OKYB 2QC5A 1U4CA 5FKRA 2B5NA 1GG2B 4IA9A 2OJYA 1JMZB 5CYKA 4E54B 4UI9R 1U2VC 4XYHA 1OMWB 3VH0A 4NSXA 2I0TA 2CN3A 3F3GA 3MKSB 5TDHB 3JROA 4GQBB 4QT8A 2OK6A 1QNIA 4A0BA 4K3ID
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B4E A;  2Z2N A;  4JD2 C;  3KRW B;  3OKY A;  3ODT A;  2IAA A;  5H14 A;  2W18 A;  2J56 H;  4E54 A;  2H3X A;  3SWS D;  5EAM A;  1ERJ A;  1K8K C;  4PXW A;  5SXM A;  3B7F A;  4Y7R A;  4AOW A;  2IUP A;  3C75 H;  4CY3 A;  4ZOZ A;  5C9Z B;  1PGU A;  4JT6 C;  4GM9 A;  2H9L A;  2PM7 B;  2OVQ B;  2HES X;  5IC7 A;  2H68 A;  3UVN A;  3UKR C;  5HE1 B;  5H17 A;  3VA6 A;  3AL8 A;  1VYH C;  5THA A;  4JSP C;  2CE8 A;  3K26 A;  3OW8 A;  4CZX A;  4BUJ C;  4PBY A;  4E5Z B;  4A0A B;  1SQ9 A;  3RFG A;  5KDO B;  3RSE C;  1Q47 A;  3SHF A;  3MKQ A;  3SN6 B;  1R5M A;  2P9S C;  3F3F A;  4L9O A;  4BH6 A;  4O3T B;  4A11 B;  5I5M A;  2OVR B;  4A08 A;  3GRE A;  4MK0 B;  4L3H D;  4A2M A;  2HXC A;  3JB9 L;  4OZU A;  3ORV D;  4YVD A;  5EMK B;  3I7N A;  4E5Z A;  5FKS A;  4A0A A;  3EU7 A;  5IT9 g;  4XEI C;  5AJA A;  1N6F A;  3EI2 A;  3CFV A;  3PVW B;  2AH1 A;  4QRJ A;  4A11 A;  5CXC B;  4J87 A;  2HJ4 A;  2GC7 A;  4J86 A;  4J8B A;  4AEZ A;  2HYE A;  5JWZ A;  2P9P C;  4CZY A;  2H9N A;  3C99 A;  3C5M A;  2IWK A;  5K19 A;  3W15 A;  1SQJ A;  5EAL A;  3NVX A;  3I7L A;  4A7J A;  3F3P A;  5CYK B;  5HE2 B;  3GFC A;  3V5W B;  2YNN A;  2G99 A;  5K1C C;  3I7H A;  1K32 A;  2P9L C;  4XYI A;  4ERQ A;  5AMS A;  3IJ0 A;  1JMX B;  4CZV A;  4J77 A;  3L4M D;  5GXH A;  4LG9 A;  4A0B B;  5EAR A;  5TEF A;  4FA4 D;  2H6Q A;  5EMJ B;  5H1M A;  4ES0 A;  3PSC B;  3PE7 A;  3OTT A;  5IGQ A;  3EG6 A;  2IUQ A;  3I89 A;  4PSX B;  3IJ1 A;  3CFS B;  1S4U X;  4CY1 A;  1A0R B;  2XU7 A;  3SXT D;  2G9A A;  3DXM C;  5GMK n;  3SCY A;  3AL8 B;  5FQD A;  4CI1 A;  3BG1 A;  2I0S A;  4GMB A;  1XIP A;  1FWX A;  4QQE A;  4H5J A;  2H13 A;  4GZ8 A;  3PXT D;  2Z2P A;  3SBQ A;  2CO0 C;  2O9K A;  4CC9 A;  5I5I A;  4D6V A;  4J78 A;  4FWW A;  2XYI A;  4J8G A;  3V7D B;  3HFQ A;  1JOF A;  4PC0 A;  3RFH A;  4A08 B;  2P9U C;  4O1Q D;  2AGW A;  2YNP A;  3JAM g;  4PNK B;  2AGY A;  3E0C A;  4QL1 A;  3RN0 D;  4FAN D;  4GQ1 A;  4X61 B;  3FM0 A;  5HE3 B;  3RLM D;  4FA5 D;  3I2N A;  4JSX C;  1NEX B;  1B9X A;  3I7P A;  5AFU 3;  3EI1 B;  1XHM A;  2I0R A;  3EI2 B;  4J79 A;  3SBP A;  2EBS A;  1PI6 A;  2MTA H;  3AH8 B;  3MMY A;  2BBK H;  2H47 A;  3OL2 B;  4J81 A;  2YMU A;  4FHL A;  5HE0 B;  3SVW D;  5FKT A;  3SLE D;  4X60 B;  4HDJ A;  5FKQ A;  5HYN B;  2HJB A;  4L3G D;  5TEE A;  5IJ7 E;  3EI1 A;  2Q7Q A;  2CO0 A;  4GGC A;  3AL9 A;  3N0D A;  1MDA H;  2OVP B;  2YBA A;  2TRC B;  3OL2 A;  1GXR A;  2AGL A;  2H14 A;  4CI3 A;  1YFQ A;  4O45 A;  4D0K A;  1XKS A;  1B9Y A;  2J55 H;  2AGZ A;  2I3T A;  3PXS D;  3NVQ A;  3ZWL B;  1PEV A;  4G56 B;  1RI6 A;  2AGX A;  4A2L A;  2UZX B;  2PBI B;  2H6K A;  3JRP A;  3SFZ A;  3EMH A;  2HKM A;  4JSN C;  4X3E A;  4ERY A;  4ERZ A;  2QXV A;  3I8E A;  4CI2 A;  3UVK A;  3IKO A;  2XL2 A;  3C9C A;  1SHY B;  3RMZ D;  2BCJ B;  5C2W B;  3JZH A;  3P4F A;  3EWE A;  1N6E A;  4OWR A;  5IGO A;  4Y5R D;  3J81 g;  3FRX A;  3MZL A;  2AQ5 A;  4BL0 A;  2AH0 A;  2YNO A;  4X63 B;  4Z8L A;  3L4O D;  4GQ2 P;  1N6D A;  4FB1 D;  3NVN A;  4L1Q D;  5FLX g;  4JT5 C;  3MZK A;  4GGD A;  3EI3 B;  3IJC A;  3UR4 A;  4CY2 A;  3UKU C;  3V9F A;  3EI4 A;  4PBZ A;  4ZOY A;  3VGZ A;  2P9N C;  4GM3 A;  3FGB A;  5I5J A;  4A09 A;  4JXM A;  3UVL A;  3RRM C;  1MG2 A;  2Z2O A;  3DM0 A;  1MG3 A;  3I7K A;  2OIZ A;  4J84 A;  5EML B;  3EI3 A;  3PSL A;  4LGN A;  2OK4 A;  3AFC A;  3I7O A;  5HQG A;  5GXI A;  5EM2 B;  3U4Y A;  4FA1 D;  2I3S A;  5EMM B;  2CE9 A;  4EWR A;  2GC4 A;  5CXB B;  5GSA A;  2B5L A;  2J57 G;  4N14 A;  2P9I C;  4FA9 D;  1L0Q A;  1JJU B;  5A2Q g;  4ZOV A;  5EM2 A;  4CY5 A;  2YB8 B;  3KRX B;  4LG8 A;  3SMR A;  1TBG A;  5B4W A;  2PM6 B;  4R7A B;  4FAV D;  3PXW D;  5CXB A;  3IIY A;  3I8C A;  1PBY B;  2GNQ A;  4O9D A;  4K3J B;  3DXK C;  4GM8 A;  3BWS A;  3ULE C;  4U1E I;  4TZ4 A;  2H6N A;  4GGA A;  4J0W A;  3PVU B;  2P9K C;  2IWF A;  4J0X A;  3CIK B;  3SJL D;  3MXX A;  4IMM A;  5TF2 A;  1GP2 B;  1P22 A;  3UVM A;  3JZN A;  4PSW B;  4J82 A;  4CI8 A;  3N0E A;  5FA5 B;  2B5M A;  5IJ8 E;  4ZN4 A;  2CN2 A;  5EAP A;  4U7A A;  4H5I A;  1GOT B;  3SBR A;  2PM9 B;  3A0F A;  2H9M A;  3BG0 A;  3DSM A;  2H9P A;  4O3U B;  4ESG A;  4ZOX A;  3EI4 B;  1TYQ C;  1OLZ A;  3IIW A;  2HKR A;  1NR0 A;  2IUV A;  5CXC A;  2CNX A;  5C2V B;  3DWL C;  4JSV C;  4A09 B;  3JZG A;  3J80 g;  3JPX A;  3OKW A;  4J73 A;  2PM9 A;  4I79 A;  3RN1 D;  3UVO A;  2UZY B;  2XL3 A;  3OKT A;  4KFM B;  5FXY A;  3K27 A;  2IUR A;  3OKY B;  2QC5 A;  1U4C A;  5FKR A;  2B5N A;  1GG2 B;  4IA9 A;  2OJY A;  1JMZ B;  5CYK A;  4E54 B;  4UI9 R;  1U2V C;  4XYH A;  1OMW B;  3VH0 A;  4NSX A;  2I0T A;  2CN3 A;  3F3G A;  3MKS B;  5TDH B;  3JRO A;  4GQB B;  4QT8 A;  2OK6 A;  1QNI A;  4A0B A;  4K3I D; 
#chains in the Genus database with same CATH topology
 3ZE2 A;  2B4E A;  2Z2N A;  4JD2 C;  3KRW B;  3OKY A;  3ODT A;  2IAA A;  4WJK A;  5H14 A;  2W18 A;  2J56 H;  4E54 A;  4DNW A;  2H3X A;  3SWS D;  5EAM A;  1ERJ A;  1K8K C;  2VC2 A;  4PXW A;  5SXM A;  3B7F A;  4Y7R A;  4AOW A;  2IUP A;  3C75 H;  4CY3 A;  4ZOZ A;  5C9Z B;  1PGU A;  1K3I A;  4JT6 C;  4GM9 A;  2H9L A;  2PM7 B;  2OVQ B;  2HES X;  5IC7 A;  2H68 A;  3UVN A;  3UKR C;  4WK0 A;  5H17 A;  5HE1 B;  3VA6 A;  3AL8 A;  1VYH C;  3IUL A;  4L1M A;  5THA A;  4D9S A;  2VDK A;  4JSP C;  3O4G A;  2CE8 A;  3K26 A;  3OW8 A;  4CZX A;  4BUJ C;  4PBY A;  4E5Z B;  4A0A B;  1SQ9 A;  3NIG A;  3IUR A;  3RFG A;  5KDO B;  3T3M A;  3RSE C;  1JV2 A;  1Q47 A;  3VI4 A;  3SHF A;  3MKQ A;  3SN6 B;  1R5M A;  5E6U A;  2P9S C;  3F3F A;  4L9O A;  4BH6 A;  4O3T B;  4A11 B;  1L5G A;  5I5M A;  2OVR B;  4A08 A;  3GRE A;  3V4V A;  4MK0 B;  4L3H D;  4A2M A;  4DNV A;  2HXC A;  3JB9 L;  4OZU A;  3ORV D;  4YVD A;  5EMK B;  1UOP A;  3I7N A;  4E5Z A;  5FKS A;  4A0A A;  3EU7 A;  5IT9 g;  3MUN A;  3NIF A;  4XEI C;  4BCD A;  1O6F A;  5AJA A;  1N6F A;  5FFG A;  3EI2 A;  3CFV A;  3PVW B;  2AH1 A;  4QRJ A;  4A11 A;  2BKL A;  5CXC B;  4J87 A;  2HJ4 A;  2GC7 A;  4J86 A;  4J8B A;  3IJE A;  4AEZ A;  2HYE A;  5JWZ A;  2P9P C;  1TYE A;  4CZY A;  2H9N A;  4BP8 A;  3QHY B;  3C99 A;  3MVD K;  3C5M A;  2IWK A;  5K19 A;  5C92 A;  3W15 A;  2XE4 A;  1SQJ A;  5EAL A;  1H2X A;  3NVX A;  3I7L A;  4A7J A;  3F3P A;  5CYK B;  5HE2 B;  3GFC A;  3V5W B;  2YNN A;  2G99 A;  4Z7Q A;  3VI3 A;  1QFM A;  5K1C C;  3I7H A;  1K32 A;  2P9L C;  4XYI A;  4ERQ A;  3V4P A;  5AMS A;  3IJ0 A;  1JMX B;  4CZV A;  4J77 A;  3L4M D;  5GXH A;  3EQ8 A;  4LG9 A;  4A0B B;  5EAR A;  5TEF A;  4FA4 D;  2H6Q A;  5EMJ B;  1BPO A;  5H1M A;  5E6S A;  4ES0 A;  3PSC B;  3PE7 A;  3OTT A;  2VZ3 A;  5IGQ A;  1E8N A;  3EG6 A;  2IUQ A;  3I89 A;  5C86 A;  4PSX B;  3IJ1 A;  3CFS B;  1I2M B;  1S4U X;  4CY1 A;  1A0R B;  2XU7 A;  3SXT D;  2G9A A;  3DXM C;  5GMK n;  3SCY A;  2EIE A;  3AL8 B;  5FQD A;  4CI1 A;  2VDL A;  3BG1 A;  2I0S A;  4GMB A;  1XIP A;  1FWX A;  4QQE A;  4H5J A;  3MUO A;  2EID A;  4NC4 A;  4AX4 A;  2H13 A;  4G1E A;  4BCB A;  4GZ8 A;  3PXT D;  2Z2P A;  3SBQ A;  4NAA A;  2CO0 C;  2O9K A;  4CC9 A;  5I5I A;  4D6V A;  3O4I A;  4J78 A;  4FWW A;  2XYI A;  4J8G A;  3V7D B;  3HFQ A;  3O4J A;  1JOF A;  4NEN A;  4PC0 A;  3RFH A;  4A08 B;  2P9U C;  4O1Q D;  2AGW A;  2YNP A;  3JAM g;  4PNK B;  2AGY A;  4NBM A;  2VZ1 A;  3E0C A;  4QL1 A;  3RN0 D;  4FAN D;  4GQ1 A;  4X61 B;  3FM0 A;  5HE3 B;  3RLM D;  4FA5 D;  1T2X A;  3FCS A;  4AN1 A;  3I2N A;  4JSX C;  1NEX B;  1B9X A;  3I7P A;  5AFU 3;  1GOH A;  3EI1 B;  5FFO A;  1XHM A;  2I0R A;  3EI2 B;  4J79 A;  3SBP A;  2EBS A;  1PI6 A;  2MTA H;  3AH8 B;  4G1M A;  3MMY A;  3NID A;  2BBK H;  4JHN A;  2H47 A;  1GOG A;  3OL2 B;  4J81 A;  1H2Y A;  2YMU A;  1H2W A;  4FHL A;  5HE0 B;  1VZ2 A;  3SVW D;  5FKT A;  3SLE D;  4X60 B;  4HDJ A;  2VDR A;  5FKQ A;  1C9I A;  5HYN B;  2HU7 A;  2HJB A;  4L3G D;  5TEE A;  5IJ7 E;  1M1X A;  5M5T A;  1U8C A;  3EI1 A;  5M61 A;  3DDU A;  2Q7Q A;  2CO0 A;  4GGC A;  3AL9 A;  3N0D A;  1MDA H;  2OVP B;  2YBA A;  5HDB A;  2TRC B;  3OL2 A;  1GXR A;  2AGL A;  5M5R A;  2H14 A;  4CI3 A;  1YFQ A;  4O45 A;  4D0K A;  1XKS A;  1B9Y A;  2J55 H;  2AGZ A;  2I3T A;  3PXS D;  3NVQ A;  3ZWL B;  1PEV A;  4G56 B;  1RI6 A;  2AGX A;  4A2L A;  2UZX B;  2PBI B;  2H6K A;  3T3P A;  3JRP A;  3SFZ A;  3EMH A;  2HKM A;  4JSN C;  4X3E A;  2HU5 A;  5M5S A;  4ERY A;  4ERZ A;  2QXV A;  3IUQ A;  3I8E A;  4CI2 A;  3UVK A;  3IKO A;  2XL2 A;  3C9C A;  1SHY B;  4G55 A;  3RMZ D;  2VDO A;  2BCJ B;  5C2W B;  2QR5 A;  3JZH A;  3P4F A;  3K72 A;  3EWE A;  1N6E A;  4OWR A;  3EQ9 A;  4Y5R D;  5IGO A;  3J81 g;  3FRX A;  3MZL A;  2AQ5 A;  3IVM A;  2VDM A;  4BL0 A;  2AH0 A;  2YNO A;  4AMY A;  4X63 B;  4Z8L A;  3ZE1 A;  3L4O D;  4GQ2 P;  1N6D A;  4FB1 D;  3NVN A;  4L1Q D;  5FLX g;  4MMX A;  4JT5 C;  5M5U A;  3MZK A;  4GGD A;  3EI3 B;  3IJC A;  3UR4 A;  4CY2 A;  4MMZ A;  3UKU C;  4WK4 A;  1QFS A;  3V9F A;  3EI4 A;  2XZG A;  4PBZ A;  4ZOY A;  3VGZ A;  2P9N C;  3GD1 I;  4GM3 A;  3FGB A;  3ZDY A;  5I5J A;  4A09 A;  4JXM A;  3UVL A;  3RRM C;  1H2Z A;  1MG2 A;  1VZ3 A;  2Z2O A;  4UM9 A;  3DM0 A;  2EIB A;  1MG3 A;  3I7K A;  5E6R A;  2OIZ A;  4J84 A;  1O6G A;  5EML B;  1UOO A;  3EI3 A;  3PSL A;  2XDW A;  2VDQ A;  4LGN A;  2OK4 A;  3AFC A;  3I7O A;  5HQG A;  5GXI A;  4Z7N A;  5EM2 B;  3U4Y A;  3GC3 B;  4FA1 D;  2I3S A;  3IUM A;  5EMM B;  3EQ7 A;  4BP9 A;  2CE9 A;  4EWR A;  2GC4 A;  3K6S A;  5CXB B;  5GSA A;  4AMZ A;  2B5L A;  2J57 G;  4N14 A;  2P9I C;  4FA9 D;  1L0Q A;  1JJU B;  5A2Q g;  4ZOV A;  1UTC A;  5EM2 A;  4CY5 A;  2YB8 B;  3KRX B;  4LG8 A;  4MMY A;  1TBG A;  3SMR A;  5B4W A;  2PM6 B;  4R7A B;  4FAV D;  3FCU A;  3PXW D;  4O02 A;  1JTD B;  5CXB A;  3ZDZ A;  3IIY A;  3I8C A;  4WK2 A;  1PBY B;  2VDN A;  3O4H A;  2GNQ A;  4O9D A;  4K3J B;  3K71 A;  3DXK C;  4GM8 A;  3BWS A;  3IUN A;  4U1E I;  3ULE C;  4TZ4 A;  2H6N A;  4GGA A;  4J0W A;  2HU8 A;  2WQ8 A;  3PVU B;  2P9K C;  4JHP C;  2IWF A;  1VE6 A;  4J0X A;  1YR2 A;  3CIK B;  3SJL D;  3MXX A;  4IMM A;  1A12 A;  3QI0 A;  4UM8 A;  5TF2 A;  1GP2 B;  1P22 A;  4Z7O A;  3UVM A;  3JZN A;  4PSW B;  4J82 A;  4CI8 A;  3N0E A;  5FA5 B;  2B5M A;  2JKX A;  5IJ8 E;  3IUJ A;  4ZN4 A;  2CN2 A;  5EAP A;  4U7A A;  4H5I A;  1GOT B;  4O2W A;  2PM9 B;  3SBR A;  3A0F A;  2H9M A;  3BG0 A;  3DSM A;  4DNU A;  4RE6 A;  2H9P A;  4O3U B;  4ESG A;  4ZOX A;  4IRZ A;  1UOQ A;  3EI4 B;  1TYQ C;  1OLZ A;  3IIW A;  2HKR A;  1NR0 A;  2IUV A;  5CXC A;  2CNX A;  5C2V B;  3DWL C;  3KCI A;  4JSV C;  1C9L A;  4A09 B;  3JZG A;  3J80 g;  3JPX A;  3ZDX A;  2QZP A;  1VE7 A;  5M5V A;  3OKW A;  4J73 A;  2VDP A;  2PM9 A;  4I79 A;  3RN1 D;  3UVO A;  2UZY B;  2XL3 A;  3OKT A;  4KFM B;  5FXY A;  3K27 A;  2IUR A;  3OKY B;  2QC5 A;  4BCC A;  1E8M A;  1U4C A;  2EIC A;  5FKR A;  2B5N A;  1GG2 B;  4IA9 A;  1GOF A;  2OJY A;  1JMZ B;  5CYK A;  4E54 B;  4UI9 R;  1U2V C;  3OF7 A;  4QAM A;  4XYH A;  1OMW B;  3VH0 A;  1E5T A;  4AN0 A;  4NSX A;  3ZE0 A;  2I0T A;  2CN3 A;  3F3G A;  3MKS B;  5TDH B;  4RE5 A;  3JRO A;  4GQB B;  4QT8 A;  2OK6 A;  1QNI A;  4A0B A;  4K3I D; 
#chains in the Genus database with same CATH homology
 2B4E A;  2Z2N A;  4JD2 C;  3KRW B;  3OKY A;  3ODT A;  2IAA A;  5H14 A;  2W18 A;  2J56 H;  4E54 A;  2H3X A;  3SWS D;  5EAM A;  1ERJ A;  1K8K C;  4PXW A;  5SXM A;  3B7F A;  4Y7R A;  4AOW A;  2IUP A;  3C75 H;  4CY3 A;  4ZOZ A;  5C9Z B;  1PGU A;  4JT6 C;  4GM9 A;  2H9L A;  2PM7 B;  2OVQ B;  2HES X;  5IC7 A;  2H68 A;  3UVN A;  3UKR C;  5HE1 B;  5H17 A;  3VA6 A;  3AL8 A;  1VYH C;  5THA A;  4JSP C;  2CE8 A;  3K26 A;  3OW8 A;  4CZX A;  4BUJ C;  4PBY A;  4E5Z B;  4A0A B;  1SQ9 A;  3RFG A;  5KDO B;  3RSE C;  1Q47 A;  3SHF A;  3MKQ A;  3SN6 B;  1R5M A;  2P9S C;  3F3F A;  4L9O A;  4BH6 A;  4O3T B;  4A11 B;  5I5M A;  2OVR B;  4A08 A;  3GRE A;  4MK0 B;  4L3H D;  4A2M A;  2HXC A;  3JB9 L;  4OZU A;  3ORV D;  4YVD A;  5EMK B;  3I7N A;  4E5Z A;  5FKS A;  4A0A A;  3EU7 A;  5IT9 g;  4XEI C;  5AJA A;  1N6F A;  3EI2 A;  3CFV A;  3PVW B;  2AH1 A;  4QRJ A;  4A11 A;  5CXC B;  4J87 A;  2HJ4 A;  2GC7 A;  4J86 A;  4J8B A;  4AEZ A;  2HYE A;  5JWZ A;  2P9P C;  4CZY A;  2H9N A;  3C99 A;  3C5M A;  2IWK A;  5K19 A;  3W15 A;  1SQJ A;  5EAL A;  3NVX A;  3I7L A;  4A7J A;  3F3P A;  5CYK B;  5HE2 B;  3GFC A;  3V5W B;  2YNN A;  2G99 A;  5K1C C;  3I7H A;  1K32 A;  2P9L C;  4XYI A;  4ERQ A;  5AMS A;  3IJ0 A;  1JMX B;  4CZV A;  4J77 A;  3L4M D;  5GXH A;  4LG9 A;  4A0B B;  5EAR A;  5TEF A;  4FA4 D;  2H6Q A;  5EMJ B;  5H1M A;  4ES0 A;  3PSC B;  3PE7 A;  3OTT A;  5IGQ A;  3EG6 A;  2IUQ A;  3I89 A;  4PSX B;  3IJ1 A;  3CFS B;  1S4U X;  4CY1 A;  1A0R B;  2XU7 A;  3SXT D;  2G9A A;  3DXM C;  5GMK n;  3SCY A;  3AL8 B;  5FQD A;  4CI1 A;  3BG1 A;  2I0S A;  4GMB A;  1XIP A;  1FWX A;  4QQE A;  4H5J A;  2H13 A;  4GZ8 A;  3PXT D;  2Z2P A;  3SBQ A;  2CO0 C;  2O9K A;  4CC9 A;  5I5I A;  4D6V A;  4J78 A;  4FWW A;  2XYI A;  4J8G A;  3V7D B;  3HFQ A;  1JOF A;  4PC0 A;  3RFH A;  4A08 B;  2P9U C;  4O1Q D;  2AGW A;  2YNP A;  3JAM g;  4PNK B;  2AGY A;  3E0C A;  4QL1 A;  3RN0 D;  4FAN D;  4GQ1 A;  4X61 B;  3FM0 A;  5HE3 B;  3RLM D;  4FA5 D;  3I2N A;  4JSX C;  1NEX B;  1B9X A;  3I7P A;  5AFU 3;  3EI1 B;  1XHM A;  2I0R A;  3EI2 B;  4J79 A;  3SBP A;  2EBS A;  1PI6 A;  2MTA H;  3AH8 B;  3MMY A;  2BBK H;  2H47 A;  3OL2 B;  4J81 A;  2YMU A;  4FHL A;  5HE0 B;  3SVW D;  5FKT A;  3SLE D;  4X60 B;  4HDJ A;  5FKQ A;  5HYN B;  2HJB A;  4L3G D;  5TEE A;  5IJ7 E;  3EI1 A;  2Q7Q A;  2CO0 A;  4GGC A;  3AL9 A;  3N0D A;  1MDA H;  2OVP B;  2YBA A;  2TRC B;  3OL2 A;  1GXR A;  2AGL A;  2H14 A;  4CI3 A;  1YFQ A;  4O45 A;  4D0K A;  1XKS A;  1B9Y A;  2J55 H;  2AGZ A;  2I3T A;  3PXS D;  3NVQ A;  3ZWL B;  1PEV A;  4G56 B;  1RI6 A;  2AGX A;  4A2L A;  2UZX B;  2PBI B;  2H6K A;  3JRP A;  3SFZ A;  3EMH A;  2HKM A;  4JSN C;  4X3E A;  4ERY A;  4ERZ A;  2QXV A;  3I8E A;  4CI2 A;  3UVK A;  3IKO A;  2XL2 A;  3C9C A;  1SHY B;  3RMZ D;  2BCJ B;  5C2W B;  3JZH A;  3P4F A;  3EWE A;  1N6E A;  4OWR A;  5IGO A;  4Y5R D;  3J81 g;  3FRX A;  3MZL A;  2AQ5 A;  4BL0 A;  2AH0 A;  2YNO A;  4X63 B;  4Z8L A;  3L4O D;  4GQ2 P;  1N6D A;  4FB1 D;  3NVN A;  4L1Q D;  5FLX g;  4JT5 C;  3MZK A;  4GGD A;  3EI3 B;  3IJC A;  3UR4 A;  4CY2 A;  3UKU C;  3V9F A;  3EI4 A;  4PBZ A;  4ZOY A;  3VGZ A;  2P9N C;  4GM3 A;  3FGB A;  5I5J A;  4A09 A;  4JXM A;  3UVL A;  3RRM C;  1MG2 A;  2Z2O A;  3DM0 A;  1MG3 A;  3I7K A;  2OIZ A;  4J84 A;  5EML B;  3EI3 A;  3PSL A;  4LGN A;  2OK4 A;  3AFC A;  3I7O A;  5HQG A;  5GXI A;  5EM2 B;  3U4Y A;  4FA1 D;  2I3S A;  5EMM B;  2CE9 A;  4EWR A;  2GC4 A;  5CXB B;  5GSA A;  2B5L A;  2J57 G;  4N14 A;  2P9I C;  4FA9 D;  1L0Q A;  1JJU B;  5A2Q g;  4ZOV A;  5EM2 A;  4CY5 A;  2YB8 B;  3KRX B;  4LG8 A;  3SMR A;  1TBG A;  5B4W A;  2PM6 B;  4R7A B;  4FAV D;  3PXW D;  5CXB A;  3IIY A;  3I8C A;  1PBY B;  2GNQ A;  4O9D A;  4K3J B;  3DXK C;  4GM8 A;  3BWS A;  3ULE C;  4U1E I;  4TZ4 A;  2H6N A;  4GGA A;  4J0W A;  3PVU B;  2P9K C;  2IWF A;  4J0X A;  3CIK B;  3SJL D;  3MXX A;  4IMM A;  5TF2 A;  1GP2 B;  1P22 A;  3UVM A;  3JZN A;  4PSW B;  4J82 A;  4CI8 A;  3N0E A;  5FA5 B;  2B5M A;  5IJ8 E;  4ZN4 A;  2CN2 A;  5EAP A;  4U7A A;  4H5I A;  1GOT B;  3SBR A;  2PM9 B;  3A0F A;  2H9M A;  3BG0 A;  3DSM A;  2H9P A;  4O3U B;  4ESG A;  4ZOX A;  3EI4 B;  1TYQ C;  1OLZ A;  3IIW A;  2HKR A;  1NR0 A;  2IUV A;  5CXC A;  2CNX A;  5C2V B;  3DWL C;  4JSV C;  4A09 B;  3JZG A;  3J80 g;  3JPX A;  3OKW A;  4J73 A;  2PM9 A;  4I79 A;  3RN1 D;  3UVO A;  2UZY B;  2XL3 A;  3OKT A;  4KFM B;  5FXY A;  3K27 A;  2IUR A;  3OKY B;  2QC5 A;  1U4C A;  5FKR A;  2B5N A;  1GG2 B;  4IA9 A;  2OJY A;  1JMZ B;  5CYK A;  4E54 B;  4UI9 R;  1U2V C;  4XYH A;  1OMW B;  3VH0 A;  4NSX A;  2I0T A;  2CN3 A;  3F3G A;  3MKS B;  5TDH B;  3JRO A;  4GQB B;  4QT8 A;  2OK6 A;  1QNI A;  4A0B A;  4K3I D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...