3F3GA

Crystal structure of the nucleoporin pair nup85-seh1, space group p212121
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
347
structure length
300
Chain Sequence
b'MQPFDSGHDDLVHDVVYDFYGRHVATCSSDQHIKVFKLDKDTSNWELSDSWRAHDSSIVAIDWASPEYGRIIASASYDKTVKLWEEDPDQEECSGRRWNKLCTLNDSKGSLYSVKFAPAHLGLKLACLGNDGILRLYDALEPSDLRSWTLTSEMKVLSIPSDFCLSWCPSRFSPEKLAVSALEQAIIYQRGKDGKLHVAAKLPGHKSLIRSISWAPSIGRWYQLIATGCKDGRIRIFKITEKSNLQVELLSEHDDHNGEVWSVSWNLTGTILSSAGDDGKVRLWKATYSNEFKCMSVITA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleoporin SEH1
publication title A fence-like coat for the nuclear pore membrane.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural protein
total genus 59
structure length 300
sequence length 347
chains with identical sequence B, E, F
ec nomenclature
pdb deposition date 2008-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3f3gA01
1B9XA 3KRWB 3UVNA 5IGQA 4H5IA 3UVLA 3RSEC 4A2MA 4J0XA 3IJ0A 3BWSA 3PSCB 5EMKB 2Z2NA 3VGZA 4K3ID 5FLXg 2OK4A 2XYIA 3JPXA 5I5JA 4CI3A 4J8GA 2PM7B 4QRJA 4L1QD 2HYEA 4YVDA 4D0KA 3W15A 5FQDA 2UZXB 4CZVA 4FWWA 4HDJA 1JJUB 4CY1A 1XKSA 5JWZA 1N6EA 1MG2A 4GGAA 4Y7RA 1N6DA 4A7JA 2PM6B 4JD2C 2H13A 5IT9g 4A2LA 2G99A 3AL8B 3SWSD 4O1QD 3PSLA 5GMKn 1PBYB 1XHMA 1Q47A 1RI6A 3MKSB 2I3TA 5FKTA 1GG2B 2I0TA 2IURA 3VH0A 4JSXC 2AGZA 2CN3A 3JZHA 3MXXA 4J79A 3F3GA 3IJ1A 5H14A 3K27A 4QL1A 2HESX 5A2Qg 4O3UB 2TRCB 4NSXA 1TBGA 2AQ5A 2CO0C 2OVRB 2Q7QA 4FA4D 5FKQA 1OLZA 3JROA 3RMZD 2AGXA 2B4EA 2HKRA 2P9SC 4IMMA 4A0BA 3UKRC 5AFU3 3V7DB 3EI2B 4ESGA 2HJ4A 3OKYB 3I2NA 2P9KC 3E0CA 1JMXB 4LGNA 1GOTB 3OL2A 4XEIC 4AOWA 1SQ9A 3K26A 3NVNA 2O9KA 3SMRA 4CY5A 5CYKB 3V5WB 4CY3A 3DM0A 3NVQA 3ZWLB 5EMMB 4A11B 4A08B 3PE7A 4J84A 5TF2A 5C2WB 5GXHA 4E5ZA 3I8CA 3EI3B 3SBQA 4GM3A 1A0RB 4FAVD 4TZ4A 4BH6A 4O3TB 4PBYA 2H9PA 3EWEA 4PBZA 2HJBA 2AH0A 5HE2B 1U2VC 3RFGA 2Z2OA 5AJAA 4L9OA 1TYQC 3OKTA 3OTTA 4FA9D 3N0EA 4ZN4A 4I79A 1OMWB 4FB1D 4A0AA 3IIWA 5H17A 4ES0A 3PXSD 4O9DA 3AH8B 1JMZB 3MZKA 3UVKA 5IJ7E 4KFMB 3MKQA 2CN2A 3DSMA 3EI1A 4J87A 4L3GD 4FHLA 2IUVA 4GZ8A 2PM9B 2P9NC 3I7HA 2IWKA 2J57G 4A09A 2GNQA 1SQJA 2IUPA 5B4WA 5EMLB 4JT5C 1ERJA 5IGOA 4QT8A 5EALA 3SBRA 2YNNA 1K8KC 3SFZA 3V9FA 3JAMg 2XL3A 1B9YA 3SHFA 5THAA 3JZGA 2I0RA 4GQ2P 3EU7A 4Z8LA 4GGCA 5CXBA 4X63B 5TEEA 2AGWA 5CXCB 4E54B 1MG3A 3ORVD 4R7AB 4UI9R 4LG8A 1NR0A 3C75H 3SVWD 2AGLA 3PXWD 4E5ZB 5EM2B 2Z2PA 3NVXA 4GGDA 2YNOA 4FA1D 4X3EA 1FWXA 4X60B 4K3JB 3MMYA 3C9CA 2PBIB 5K19A 3F3PA 2YBAA 3L4MD 3JRPA 2H9NA 4ZOZA 4J73A 2MTAH 4XYIA 5C9ZB 3PXTD 2I0SA 4U7AA 5FKSA 5I5MA 4ZOVA 2YMUA 3CFVA 4XYHA 4GM9A 4PSWB 4CI2A 2HKMA 4PXWA 2J55H 4U1EI 3F3FA 4H5JA 4L3HD 4JSVC 3I7KA 2I3SA 4MK0B 3I8EA 5I5IA 3UVMA 3BG1A 5H1MA 3SLED 4BUJC 5HYNB 4O45A 4GMBA 2CE9A 1N6FA 2QC5A 4FAND 4GM8A 3EMHA 1QNIA 1GXRA 3JB9L 2GC4A 3C99A 3J81g 2P9UC 3VA6A 5GSAA 2CNXA 2H9LA 3FM0A 1P22A 1K32A 3UVOA 3I7PA 5CXBB 2B5NA 4Y5RD 5K1CC 4BL0A 4OZUA 2G9AA 3AFCA 3N0DA 5C2VB 5HQGA 5IJ8E 4ZOXA 3EG6A 3RN0D 4IA9A 2H14A 2H68A 3RFHA 5EMJB 3GFCA 2BBKH 3ODTA 5GXIA 2B5LA 3EI2A 3CFSB 3RLMD 5IC7A 3EI4A 2B5MA 2P9PC 4PSXB 1XIPA 4ERQA 1YFQA 3OKYA 3SN6B 4EWRA 1SHYB 4A0BB 1NEXB 2CE8A 3I7NA 3IKOA 3U4YA 2W18A 3IIYA 4FA5D 4J0WA 5CYKA 3PVWB 2XU7A 2CO0A 3SCYA 4ERYA 3GREA 5EAPA 3OL2B 2QXVA 1S4UX 5HE0B 3HFQA 1L0QA 4A11A 4CC9A 2AGYA 4A08A 2OJYA 5HE3B 3DWLC 4D6VA 4GQBB 2J56H 2EBSA 3EI3A 3SXTD 4PNKB 3OW8A 5KDOB 3MZLA 2HXCA 3L4OD 3C5MA 3FGBA 5FKRA 5FXYA 2H9MA 3RRMC 1R5MA 4CY2A 2OK6A 3BG0A 4G56B 4ZOYA 3UR4A 3P4FA 4CI1A 4CZYA 2P9LC 4J8BA 4ERZA 2OIZA 3DXKC 4JXMA 4LG9A 3UKUC 1VYHC 3IJCA 1PGUA 3RN1D 3I7OA 4JT6C 3DXMC 2IAAA 2OVPB 1PI6A 3B7FA 2IUQA 3ULEC 3KRXB 4A0AB 4J77A 1MDAH 2IWFA 2PM9A 4JSPC 3CIKB 3A0FA 1JOFA 4OWRA 4PC0A 5HE1B 2H47A 4N14A 2OVQB 3FRXA 3EI1B 3SBPA 5EAMA 4CI8A 3I89A 3EI4B 4JSNC 3AL8A 2GC7A 4A09B 2H6QA 4J78A 2BCJB 5EARA 4CZXA 4J81A 4J86A 5FA5B 1GP2B 3SJLD 5TDHB 2P9IC 2H6NA 2XL2A 4J82A 4AEZA 1U4CA 3JZNA 3I7LA 5SXMA 2UZYB 5TEFA 5CXCA 2YNPA 2YB8B 3J80g 2H3XA 4E54A 5AMSA 3AL9A 4QQEA 4GQ1A 2H6KA 2AH1A 3OKWA 3PVUB 4X61B 1PEVA 5EM2A
chains in the Genus database with same CATH superfamily
1B9XA 3KRWB 3UVNA 5IGQA 4MMZA 4H5IA 3IULA 3UVLA 3O4GA 3RSEC 2QR5A 4A2MA 4J0XA 1M1XA 4DNVA 1H2ZA 3IJ0A 3BWSA 3PSCB 5EMKB 4Z7NA 2Z2NA 3ZDYA 3GD1I 3VGZA 4K3ID 5FLXg 2OK4A 2XYIA 3JPXA 5I5JA 4CI3A 4DNWA 2VDRA 4NBMA 4J8GA 2PM7B 4QRJA 4L1QD 5FFGA 2HYEA 4YVDA 4D0KA 3W15A 5FQDA 5FFOA 2UZXB 4CZVA 3OF7A 4FWWA 3IURA 4HDJA 1JJUB 4CY1A 1XKSA 5JWZA 1N6EA 1MG2A 4GGAA 3ZDXA 4Y7RA 1N6DA 4A7JA 2PM6B 4JD2C 2H13A 5IT9g 4A2LA 4NENA 2G99A 3AL8B 3IJEA 3SWSD 4O2WA 4O1QD 1E8MA 3PSLA 5GMKn 1PBYB 1XHMA 1Q47A 1RI6A 3MKSB 2I3TA 5FKTA 3ZE0A 1GG2B 2I0TA 2IURA 3VH0A 4JSXC 2AGZA 2CN3A 3JZHA 3MXXA 3T3MA 4DNUA 4J79A 3F3GA 3IJ1A 1BPOA 5H14A 3K27A 4QL1A 2HU5A 2HESX 5A2Qg 4O3UB 2TRCB 4NSXA 4AMZA 1TBGA 2AQ5A 2CO0C 2OVRB 2Q7QA 4FA4D 5FKQA 1OLZA 3FCSA 1QFMA 3JROA 3RMZD 2AGXA 1GOGA 4MMYA 2B4EA 1GOFA 2HKRA 2P9SC 4IMMA 4A0BA 2VZ3A 3UKRC 5AFU3 2VDNA 3V7DB 3EI2B 3QI0A 3IVMA 4ESGA 1A12A 2HJ4A 3OKYB 3I2NA 2P9KC 3E0CA 1JMXB 4LGNA 1GOTB 3OL2A 4XEIC 4AOWA 1SQ9A 3K26A 3NVNA 2O9KA 3SMRA 4CY5A 3IUJA 3KCIA 5CYKB 4AX4A 1VE7A 3V5WB 2EIDA 4CY3A 3DM0A 1T2XA 5M61A 3NVQA 3QHYB 5E6SA 3ZWLB 5EMMB 4A11B 4A08B 3PE7A 1YR2A 4J84A 4BP8A 4BCBA 5TF2A 5C2WB 5GXHA 4E5ZA 3I8CA 3EI3B 4WK0A 3SBQA 4GM3A 2HU8A 3O4JA 1A0RB 4FAVD 1UOOA 4TZ4A 4BH6A 3DDUA 4O3TB 4PBYA 2H9PA 3EWEA 4PBZA 2HJBA 2AH0A 5HE2B 1U2VC 3RFGA 2Z2OA 5AJAA 4L9OA 1TYQC 3OKTA 3OTTA 4FA9D 3N0EA 4ZN4A 4I79A 3MVDK 1OMWB 4FB1D 4AN0A 1I2MB 4G55A 4BP9A 4A0AA 3IIWA 5H17A 4ES0A 3PXSD 4O9DA 3VI4A 3AH8B 2BKLA 3K72A 1JMZB 3MZKA 3UVKA 4IRZA 5IJ7E 4KFMB 3MKQA 1UTCA 2CN2A 3DSMA 3EI1A 4J87A 4L3GD 2HU7A 4FHLA 1JTDB 2IUVA 3O4HA 4GZ8A 2PM9B 2VDPA 5E6UA 2P9NC 3I7HA 2IWKA 2J57G 4A09A 2GNQA 1SQJA 2IUPA 5B4WA 5EMLB 4JT5C 4RE6A 3T3PA 1ERJA 2QZPA 5IGOA 4QT8A 1JV2A 5EALA 3SBRA 2YNNA 1K3IA 1K8KC 1L5GA 3SFZA 3IUNA 3V9FA 4BCDA 3JAMg 2XL3A 1B9YA 3MUNA 3SHFA 4NAAA 5THAA 3JZGA 2I0RA 4GQ2P 3EU7A 5M5VA 4Z8LA 4GGCA 5CXBA 4X63B 1U8CA 5TEEA 2AGWA 4UM9A 5CXCB 4WJKA 4E54B 1MG3A 3ORVD 4R7AB 4UI9R 4LG8A 5C86A 1NR0A 3C75H 3SVWD 3MUOA 2AGLA 3PXWD 4E5ZB 5C92A 4O02A 5EM2B 2Z2PA 3NVXA 4GGDA 2YNOA 4FA1D 4X3EA 3V4PA 1FWXA 4X60B 4K3JB 3MMYA 1VZ2A 3C9CA 3NIFA 2PBIB 3EQ8A 5K19A 4G1MA 3F3PA 2YBAA 3L4MD 3JRPA 2H9NA 4ZOZA 4J73A 3ZE2A 2MTAH 4XYIA 4AN1A 5C9ZB 3PXTD 2I0SA 4U7AA 5FKSA 1O6FA 5M5UA 5I5MA 2WQ8A 5HDBA 4ZOVA 3V4VA 2VDQA 2YMUA 3CFVA 4XYHA 4GM9A 4G1EA 4PSWB 4WK4A 4CI2A 2HKMA 4PXWA 2J55H 2XZGA 3F3FA 4U1EI 4H5JA 4L3HD 5E6RA 5M5RA 4JSVC 3NIGA 3I7KA 2I3SA 4MK0B 3I8EA 5I5IA 1UOPA 3UVMA 1H2XA 3BG1A 5H1MA 3SLED 4BUJC 5HYNB 4O45A 4GMBA 2CE9A 1N6FA 1UOQA 4AMYA 2QC5A 2EIEA 4GM8A 4FAND 1C9IA 2VDMA 3EMHA 1QNIA 1GXRA 3JB9L 2GC4A 3C99A 2JKXA 3J81g 2P9UC 3EQ7A 3VA6A 5GSAA 2CNXA 2XDWA 2H9LA 3FM0A 1P22A 3VI3A 1K32A 3ZE1A 3UVOA 3I7PA 5CXBB 2B5NA 4Y5RD 5K1CC 1H2WA 4BL0A 4OZUA 2G9AA 3AFCA 3N0DA 5C2VB 5HQGA 5IJ8E 1C9LA 4ZOXA 4Z7OA 3EG6A 4JHPC 3RN0D 4IA9A 2VDKA 2H14A 2H68A 3RFHA 5EMJB 4JHNA 3GFCA 2BBKH 2VC2A 3ODTA 5GXIA 2B5LA 2EIBA 3CFSB 3EI2A 1H2YA 3RLMD 5IC7A 4NC4A 3EI4A 2B5MA 2P9PC 3K71A 4PSXB 1XIPA 4ERQA 1YFQA 3OKYA 3SN6B 4EWRA 3O4IA 1SHYB 4A0BB 1NEXB 2CE8A 4QAMA 3I7NA 3IKOA 3U4YA 2W18A 3IIYA 4FA5D 4J0WA 5CYKA 3PVWB 2XU7A 2CO0A 3SCYA 3ZDZA 4ERYA 3GREA 5EAPA 3OL2B 3EQ9A 2QXVA 1S4UX 4WK2A 5HE0B 5M5SA 2VZ1A 3HFQA 1L0QA 4A11A 4CC9A 2AGYA 4A08A 2VDOA 2OJYA 5HE3B 4L1MA 3DWLC 4D6VA 2XE4A 4GQBB 2J56H 2EBSA 3EI3A 4RE5A 3SXTD 4PNKB 3OW8A 5KDOB 1GOHA 3MZLA 2HXCA 3L4OD 3C5MA 3FGBA 5FKRA 5FXYA 2H9MA 3RRMC 1R5MA 4CY2A 2OK6A 3BG0A 4G56B 4ZOYA 3UR4A 3P4FA 4CI1A 4CZYA 2P9LC 4J8BA 4ERZA 2OIZA 3DXKC 4JXMA 3GC3B 4LG9A 3UKUC 1VYHC 4MMXA 4BCCA 3IJCA 1PGUA 3RN1D 3I7OA 4JT6C 3DXMC 2IAAA 2OVPB 1PI6A 3B7FA 2IUQA 3ULEC 3KRXB 4A0AB 4J77A 1MDAH 2IWFA 3K6SA 2PM9A 4JSPC 3CIKB 3A0FA 5M5TA 3IUMA 1QFSA 1O6GA 1JOFA 4OWRA 4PC0A 5HE1B 2H47A 4N14A 2OVQB 3FRXA 3EI1B 3SBPA 5EAMA 4CI8A 3FCUA 3I89A 3EI4B 4JSNC 3IUQA 3AL8A 2GC7A 4A09B 1VE6A 2H6QA 5EM2A 4J78A 2BCJB 5EARA 2EICA 1E5TA 4CZXA 4J81A 4J86A 5FA5B 1GP2B 3SJLD 4D9SA 5TDHB 2P9IC 1E8NA 2H6NA 2XL2A 4J82A 4AEZA 1U4CA 3JZNA 3I7LA 5SXMA 4UM8A 2UZYB 5TEFA 4Z7QA 5CXCA 2YNPA 2YB8B 3J80g 2H3XA 4E54A 3NIDA 5AMSA 3AL9A 4QQEA 2H6KA 2AH1A 3OKWA 4GQ1A 1TYEA 3PVUB 1VZ3A 4X61B 1PEVA 2VDLA
chains in the Genus database with same CATH topology
1B9XA 3KRWB 3UVNA 5IGQA 4H5IA 3UVLA 3RSEC 4A2MA 4J0XA 3IJ0A 3BWSA 3PSCB 5EMKB 2Z2NA 3VGZA 4K3ID 5FLXg 2OK4A 2XYIA 3JPXA 5I5JA 4CI3A 4J8GA 2PM7B 4QRJA 4L1QD 2HYEA 4YVDA 4D0KA 3W15A 5FQDA 2UZXB 4CZVA 4FWWA 4HDJA 1JJUB 4CY1A 1XKSA 5JWZA 1N6EA 1MG2A 4GGAA 4Y7RA 1N6DA 4A7JA 2PM6B 4JD2C 2H13A 5IT9g 4A2LA 2G99A 3AL8B 3SWSD 4O1QD 3PSLA 5GMKn 1PBYB 1XHMA 1Q47A 1RI6A 3MKSB 2I3TA 5FKTA 1GG2B 2I0TA 2IURA 3VH0A 4JSXC 2AGZA 2CN3A 3JZHA 3MXXA 4J79A 3F3GA 3IJ1A 5H14A 3K27A 4QL1A 2HESX 5A2Qg 4O3UB 2TRCB 4NSXA 1TBGA 2AQ5A 2CO0C 2OVRB 2Q7QA 4FA4D 5FKQA 1OLZA 3JROA 3RMZD 2AGXA 2B4EA 2HKRA 2P9SC 4IMMA 4A0BA 3UKRC 5AFU3 3V7DB 3EI2B 4ESGA 2HJ4A 3OKYB 3I2NA 2P9KC 3E0CA 1JMXB 4LGNA 1GOTB 3OL2A 4XEIC 4AOWA 1SQ9A 3K26A 3NVNA 2O9KA 3SMRA 4CY5A 5CYKB 3V5WB 4CY3A 3DM0A 3NVQA 3ZWLB 5EMMB 4A11B 4A08B 3PE7A 4J84A 5TF2A 5C2WB 5GXHA 4E5ZA 3I8CA 3EI3B 3SBQA 4GM3A 1A0RB 4FAVD 4TZ4A 4BH6A 4O3TB 4PBYA 2H9PA 3EWEA 4PBZA 2HJBA 2AH0A 5HE2B 1U2VC 3RFGA 2Z2OA 5AJAA 4L9OA 1TYQC 3OKTA 3OTTA 4FA9D 3N0EA 4ZN4A 4I79A 1OMWB 4FB1D 4A0AA 3IIWA 5H17A 4ES0A 3PXSD 4O9DA 3AH8B 1JMZB 3MZKA 3UVKA 5IJ7E 4KFMB 3MKQA 2CN2A 3DSMA 3EI1A 4J87A 4L3GD 4FHLA 2IUVA 4GZ8A 2PM9B 2P9NC 3I7HA 2IWKA 2J57G 4A09A 2GNQA 1SQJA 2IUPA 5B4WA 5EMLB 4JT5C 1ERJA 5IGOA 4QT8A 5EALA 3SBRA 2YNNA 1K8KC 3SFZA 3V9FA 3JAMg 2XL3A 1B9YA 3SHFA 5THAA 3JZGA 2I0RA 4GQ2P 3EU7A 4Z8LA 4GGCA 5CXBA 4X63B 5TEEA 2AGWA 5CXCB 4E54B 1MG3A 3ORVD 4R7AB 4UI9R 4LG8A 1NR0A 3C75H 3SVWD 2AGLA 3PXWD 4E5ZB 5EM2B 2Z2PA 3NVXA 4GGDA 2YNOA 4FA1D 4X3EA 1FWXA 4X60B 4K3JB 3MMYA 3C9CA 2PBIB 5K19A 3F3PA 2YBAA 3L4MD 3JRPA 2H9NA 4ZOZA 4J73A 2MTAH 4XYIA 5C9ZB 3PXTD 2I0SA 4U7AA 5FKSA 5I5MA 4ZOVA 2YMUA 3CFVA 4XYHA 4GM9A 4PSWB 4CI2A 2HKMA 4PXWA 2J55H 4U1EI 3F3FA 4H5JA 4L3HD 4JSVC 3I7KA 2I3SA 4MK0B 3I8EA 5I5IA 3UVMA 3BG1A 5H1MA 3SLED 4BUJC 5HYNB 4O45A 4GMBA 2CE9A 1N6FA 2QC5A 4FAND 4GM8A 3EMHA 1QNIA 1GXRA 3JB9L 2GC4A 3C99A 3J81g 2P9UC 3VA6A 5GSAA 2CNXA 2H9LA 3FM0A 1P22A 1K32A 3UVOA 3I7PA 5CXBB 2B5NA 4Y5RD 5K1CC 4BL0A 4OZUA 2G9AA 3AFCA 3N0DA 5C2VB 5HQGA 5IJ8E 4ZOXA 3EG6A 3RN0D 4IA9A 2H14A 2H68A 3RFHA 5EMJB 3GFCA 2BBKH 3ODTA 5GXIA 2B5LA 3EI2A 3CFSB 3RLMD 5IC7A 3EI4A 2B5MA 2P9PC 4PSXB 1XIPA 4ERQA 1YFQA 3OKYA 3SN6B 4EWRA 1SHYB 4A0BB 1NEXB 2CE8A 3I7NA 3IKOA 3U4YA 2W18A 3IIYA 4FA5D 4J0WA 5CYKA 3PVWB 2XU7A 2CO0A 3SCYA 4ERYA 3GREA 5EAPA 3OL2B 2QXVA 1S4UX 5HE0B 3HFQA 1L0QA 4A11A 4CC9A 2AGYA 4A08A 2OJYA 5HE3B 3DWLC 4D6VA 4GQBB 2J56H 2EBSA 3EI3A 3SXTD 4PNKB 3OW8A 5KDOB 3MZLA 2HXCA 3L4OD 3C5MA 3FGBA 5FKRA 5FXYA 2H9MA 3RRMC 1R5MA 4CY2A 2OK6A 3BG0A 4G56B 4ZOYA 3UR4A 3P4FA 4CI1A 4CZYA 2P9LC 4J8BA 4ERZA 2OIZA 3DXKC 4JXMA 4LG9A 3UKUC 1VYHC 3IJCA 1PGUA 3RN1D 3I7OA 4JT6C 3DXMC 2IAAA 2OVPB 1PI6A 3B7FA 2IUQA 3ULEC 3KRXB 4A0AB 4J77A 1MDAH 2IWFA 2PM9A 4JSPC 3CIKB 3A0FA 1JOFA 4OWRA 4PC0A 5HE1B 2H47A 4N14A 2OVQB 3FRXA 3EI1B 3SBPA 5EAMA 4CI8A 3I89A 3EI4B 4JSNC 3AL8A 2GC7A 4A09B 2H6QA 4J78A 2BCJB 5EARA 4CZXA 4J81A 4J86A 5FA5B 1GP2B 3SJLD 5TDHB 2P9IC 2H6NA 2XL2A 4J82A 4AEZA 1U4CA 3JZNA 3I7LA 5SXMA 2UZYB 5TEFA 5CXCA 2YNPA 2YB8B 3J80g 2H3XA 4E54A 5AMSA 3AL9A 4QQEA 4GQ1A 2H6KA 2AH1A 3OKWA 3PVUB 4X61B 1PEVA 5EM2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B9X A;  3KRW B;  3UVN A;  5IGQ A;  4H5I A;  3UVL A;  3RSE C;  4A2M A;  4J0X A;  3IJ0 A;  3BWS A;  3PSC B;  5EMK B;  2Z2N A;  3VGZ A;  4K3I D;  5FLX g;  2OK4 A;  2XYI A;  3JPX A;  5I5J A;  4CI3 A;  4J8G A;  2PM7 B;  4QRJ A;  4L1Q D;  2HYE A;  4YVD A;  4D0K A;  3W15 A;  5FQD A;  2UZX B;  4CZV A;  4FWW A;  4HDJ A;  1JJU B;  4CY1 A;  1XKS A;  5JWZ A;  1N6E A;  1MG2 A;  4GGA A;  4Y7R A;  1N6D A;  4A7J A;  2PM6 B;  4JD2 C;  2H13 A;  5IT9 g;  4A2L A;  2G99 A;  3AL8 B;  3SWS D;  4O1Q D;  3PSL A;  5GMK n;  1PBY B;  1XHM A;  1Q47 A;  1RI6 A;  3MKS B;  2I3T A;  5FKT A;  1GG2 B;  2I0T A;  2IUR A;  3VH0 A;  4JSX C;  2AGZ A;  2CN3 A;  3JZH A;  3MXX A;  4J79 A;  3F3G A;  3IJ1 A;  5H14 A;  3K27 A;  4QL1 A;  2HES X;  5A2Q g;  4O3U B;  2TRC B;  4NSX A;  1TBG A;  2AQ5 A;  2CO0 C;  2OVR B;  2Q7Q A;  4FA4 D;  5FKQ A;  1OLZ A;  3JRO A;  3RMZ D;  2AGX A;  2B4E A;  2HKR A;  2P9S C;  4IMM A;  4A0B A;  3UKR C;  5AFU 3;  3V7D B;  3EI2 B;  4ESG A;  2HJ4 A;  3OKY B;  3I2N A;  2P9K C;  3E0C A;  1JMX B;  4LGN A;  1GOT B;  3OL2 A;  4XEI C;  4AOW A;  1SQ9 A;  3K26 A;  3NVN A;  2O9K A;  3SMR A;  4CY5 A;  5CYK B;  3V5W B;  4CY3 A;  3DM0 A;  3NVQ A;  3ZWL B;  5EMM B;  4A11 B;  4A08 B;  3PE7 A;  4J84 A;  5TF2 A;  5C2W B;  5GXH A;  4E5Z A;  3I8C A;  3EI3 B;  3SBQ A;  4GM3 A;  1A0R B;  4FAV D;  4TZ4 A;  4BH6 A;  4O3T B;  4PBY A;  2H9P A;  3EWE A;  4PBZ A;  2HJB A;  2AH0 A;  5HE2 B;  1U2V C;  3RFG A;  2Z2O A;  5AJA A;  4L9O A;  1TYQ C;  3OKT A;  3OTT A;  4FA9 D;  3N0E A;  4ZN4 A;  4I79 A;  1OMW B;  4FB1 D;  4A0A A;  3IIW A;  5H17 A;  4ES0 A;  3PXS D;  4O9D A;  3AH8 B;  1JMZ B;  3MZK A;  3UVK A;  5IJ7 E;  4KFM B;  3MKQ A;  2CN2 A;  3DSM A;  3EI1 A;  4J87 A;  4L3G D;  4FHL A;  2IUV A;  4GZ8 A;  2PM9 B;  2P9N C;  3I7H A;  2IWK A;  2J57 G;  4A09 A;  2GNQ A;  1SQJ A;  2IUP A;  5B4W A;  5EML B;  4JT5 C;  1ERJ A;  5IGO A;  4QT8 A;  5EAL A;  3SBR A;  2YNN A;  1K8K C;  3SFZ A;  3V9F A;  3JAM g;  2XL3 A;  1B9Y A;  3SHF A;  5THA A;  3JZG A;  2I0R A;  4GQ2 P;  3EU7 A;  4Z8L A;  4GGC A;  5CXB A;  4X63 B;  5TEE A;  2AGW A;  5CXC B;  4E54 B;  1MG3 A;  3ORV D;  4R7A B;  4UI9 R;  4LG8 A;  1NR0 A;  3C75 H;  3SVW D;  2AGL A;  3PXW D;  4E5Z B;  5EM2 B;  2Z2P A;  3NVX A;  4GGD A;  2YNO A;  4FA1 D;  4X3E A;  1FWX A;  4X60 B;  4K3J B;  3MMY A;  3C9C A;  2PBI B;  5K19 A;  3F3P A;  2YBA A;  3L4M D;  3JRP A;  2H9N A;  4ZOZ A;  4J73 A;  2MTA H;  4XYI A;  5C9Z B;  3PXT D;  2I0S A;  4U7A A;  5FKS A;  5I5M A;  4ZOV A;  2YMU A;  3CFV A;  4XYH A;  4GM9 A;  4PSW B;  4CI2 A;  2HKM A;  4PXW A;  2J55 H;  4U1E I;  3F3F A;  4H5J A;  4L3H D;  4JSV C;  3I7K A;  2I3S A;  4MK0 B;  3I8E A;  5I5I A;  3UVM A;  3BG1 A;  5H1M A;  3SLE D;  4BUJ C;  5HYN B;  4O45 A;  4GMB A;  2CE9 A;  1N6F A;  2QC5 A;  4FAN D;  4GM8 A;  3EMH A;  1QNI A;  1GXR A;  3JB9 L;  2GC4 A;  3C99 A;  3J81 g;  2P9U C;  3VA6 A;  5GSA A;  2CNX A;  2H9L A;  3FM0 A;  1P22 A;  1K32 A;  3UVO A;  3I7P A;  5CXB B;  2B5N A;  4Y5R D;  5K1C C;  4BL0 A;  4OZU A;  2G9A A;  3AFC A;  3N0D A;  5C2V B;  5HQG A;  5IJ8 E;  4ZOX A;  3EG6 A;  3RN0 D;  4IA9 A;  2H14 A;  2H68 A;  3RFH A;  5EMJ B;  3GFC A;  2BBK H;  3ODT A;  5GXI A;  2B5L A;  3EI2 A;  3CFS B;  3RLM D;  5IC7 A;  3EI4 A;  2B5M A;  2P9P C;  4PSX B;  1XIP A;  4ERQ A;  1YFQ A;  3OKY A;  3SN6 B;  4EWR A;  1SHY B;  4A0B B;  1NEX B;  2CE8 A;  3I7N A;  3IKO A;  3U4Y A;  2W18 A;  3IIY A;  4FA5 D;  4J0W A;  5CYK A;  3PVW B;  2XU7 A;  2CO0 A;  3SCY A;  4ERY A;  3GRE A;  5EAP A;  3OL2 B;  2QXV A;  1S4U X;  5HE0 B;  3HFQ A;  1L0Q A;  4A11 A;  4CC9 A;  2AGY A;  4A08 A;  2OJY A;  5HE3 B;  3DWL C;  4D6V A;  4GQB B;  2J56 H;  2EBS A;  3EI3 A;  3SXT D;  4PNK B;  3OW8 A;  5KDO B;  3MZL A;  2HXC A;  3L4O D;  3C5M A;  3FGB A;  5FKR A;  5FXY A;  2H9M A;  3RRM C;  1R5M A;  4CY2 A;  2OK6 A;  3BG0 A;  4G56 B;  4ZOY A;  3UR4 A;  3P4F A;  4CI1 A;  4CZY A;  2P9L C;  4J8B A;  4ERZ A;  2OIZ A;  3DXK C;  4JXM A;  4LG9 A;  3UKU C;  1VYH C;  3IJC A;  1PGU A;  3RN1 D;  3I7O A;  4JT6 C;  3DXM C;  2IAA A;  2OVP B;  1PI6 A;  3B7F A;  2IUQ A;  3ULE C;  3KRX B;  4A0A B;  4J77 A;  1MDA H;  2IWF A;  2PM9 A;  4JSP C;  3CIK B;  3A0F A;  1JOF A;  4OWR A;  4PC0 A;  5HE1 B;  2H47 A;  4N14 A;  2OVQ B;  3FRX A;  3EI1 B;  3SBP A;  5EAM A;  4CI8 A;  3I89 A;  3EI4 B;  4JSN C;  3AL8 A;  2GC7 A;  4A09 B;  2H6Q A;  4J78 A;  2BCJ B;  5EAR A;  4CZX A;  4J81 A;  4J86 A;  5FA5 B;  1GP2 B;  3SJL D;  5TDH B;  2P9I C;  2H6N A;  2XL2 A;  4J82 A;  4AEZ A;  1U4C A;  3JZN A;  3I7L A;  5SXM A;  2UZY B;  5TEF A;  5CXC A;  2YNP A;  2YB8 B;  3J80 g;  2H3X A;  4E54 A;  5AMS A;  3AL9 A;  4QQE A;  4GQ1 A;  2H6K A;  2AH1 A;  3OKW A;  3PVU B;  4X61 B;  1PEV A;  5EM2 A; 
#chains in the Genus database with same CATH topology
 1B9X A;  3KRW B;  3UVN A;  5IGQ A;  4MMZ A;  4H5I A;  3IUL A;  3UVL A;  3O4G A;  3RSE C;  2QR5 A;  4A2M A;  4J0X A;  1M1X A;  4DNV A;  1H2Z A;  3IJ0 A;  3BWS A;  3PSC B;  5EMK B;  4Z7N A;  2Z2N A;  3ZDY A;  3GD1 I;  3VGZ A;  4K3I D;  5FLX g;  2OK4 A;  2XYI A;  3JPX A;  5I5J A;  4CI3 A;  4DNW A;  2VDR A;  4NBM A;  4J8G A;  2PM7 B;  4QRJ A;  4L1Q D;  5FFG A;  2HYE A;  4YVD A;  4D0K A;  3W15 A;  5FQD A;  5FFO A;  2UZX B;  4CZV A;  3OF7 A;  4FWW A;  3IUR A;  4HDJ A;  1JJU B;  4CY1 A;  1XKS A;  5JWZ A;  1N6E A;  1MG2 A;  4GGA A;  3ZDX A;  4Y7R A;  1N6D A;  4A7J A;  2PM6 B;  4JD2 C;  2H13 A;  5IT9 g;  4A2L A;  4NEN A;  2G99 A;  3AL8 B;  3IJE A;  3SWS D;  4O2W A;  4O1Q D;  1E8M A;  3PSL A;  5GMK n;  1PBY B;  1XHM A;  1Q47 A;  1RI6 A;  3MKS B;  2I3T A;  5FKT A;  3ZE0 A;  1GG2 B;  2I0T A;  2IUR A;  3VH0 A;  4JSX C;  2AGZ A;  2CN3 A;  3JZH A;  3MXX A;  3T3M A;  4DNU A;  4J79 A;  3F3G A;  3IJ1 A;  1BPO A;  5H14 A;  3K27 A;  4QL1 A;  2HU5 A;  2HES X;  5A2Q g;  4O3U B;  2TRC B;  4NSX A;  4AMZ A;  1TBG A;  2AQ5 A;  2CO0 C;  2OVR B;  2Q7Q A;  4FA4 D;  5FKQ A;  1OLZ A;  3FCS A;  1QFM A;  3JRO A;  3RMZ D;  2AGX A;  1GOG A;  4MMY A;  2B4E A;  1GOF A;  2HKR A;  2P9S C;  4IMM A;  4A0B A;  2VZ3 A;  3UKR C;  5AFU 3;  2VDN A;  3V7D B;  3EI2 B;  3QI0 A;  3IVM A;  4ESG A;  1A12 A;  2HJ4 A;  3OKY B;  3I2N A;  2P9K C;  3E0C A;  1JMX B;  4LGN A;  1GOT B;  3OL2 A;  4XEI C;  4AOW A;  1SQ9 A;  3K26 A;  3NVN A;  2O9K A;  3SMR A;  4CY5 A;  3IUJ A;  3KCI A;  5CYK B;  4AX4 A;  1VE7 A;  3V5W B;  2EID A;  4CY3 A;  3DM0 A;  1T2X A;  5M61 A;  3NVQ A;  3QHY B;  5E6S A;  3ZWL B;  5EMM B;  4A11 B;  4A08 B;  3PE7 A;  1YR2 A;  4J84 A;  4BP8 A;  4BCB A;  5TF2 A;  5C2W B;  5GXH A;  4E5Z A;  3I8C A;  3EI3 B;  4WK0 A;  3SBQ A;  4GM3 A;  2HU8 A;  3O4J A;  1A0R B;  4FAV D;  1UOO A;  4TZ4 A;  4BH6 A;  3DDU A;  4O3T B;  4PBY A;  2H9P A;  3EWE A;  4PBZ A;  2HJB A;  2AH0 A;  5HE2 B;  1U2V C;  3RFG A;  2Z2O A;  5AJA A;  4L9O A;  1TYQ C;  3OKT A;  3OTT A;  4FA9 D;  3N0E A;  4ZN4 A;  4I79 A;  3MVD K;  1OMW B;  4FB1 D;  4AN0 A;  1I2M B;  4G55 A;  4BP9 A;  4A0A A;  3IIW A;  5H17 A;  4ES0 A;  3PXS D;  4O9D A;  3VI4 A;  3AH8 B;  2BKL A;  3K72 A;  1JMZ B;  3MZK A;  3UVK A;  4IRZ A;  5IJ7 E;  4KFM B;  3MKQ A;  1UTC A;  2CN2 A;  3DSM A;  3EI1 A;  4J87 A;  4L3G D;  2HU7 A;  4FHL A;  1JTD B;  2IUV A;  3O4H A;  4GZ8 A;  2PM9 B;  2VDP A;  5E6U A;  2P9N C;  3I7H A;  2IWK A;  2J57 G;  4A09 A;  2GNQ A;  1SQJ A;  2IUP A;  5B4W A;  5EML B;  4JT5 C;  4RE6 A;  3T3P A;  1ERJ A;  2QZP A;  5IGO A;  4QT8 A;  1JV2 A;  5EAL A;  3SBR A;  2YNN A;  1K3I A;  1K8K C;  1L5G A;  3SFZ A;  3IUN A;  3V9F A;  4BCD A;  3JAM g;  2XL3 A;  1B9Y A;  3MUN A;  3SHF A;  4NAA A;  5THA A;  3JZG A;  2I0R A;  4GQ2 P;  3EU7 A;  5M5V A;  4Z8L A;  4GGC A;  5CXB A;  4X63 B;  1U8C A;  5TEE A;  2AGW A;  4UM9 A;  5CXC B;  4WJK A;  4E54 B;  1MG3 A;  3ORV D;  4R7A B;  4UI9 R;  4LG8 A;  5C86 A;  1NR0 A;  3C75 H;  3SVW D;  3MUO A;  2AGL A;  3PXW D;  4E5Z B;  5C92 A;  4O02 A;  5EM2 B;  2Z2P A;  3NVX A;  4GGD A;  2YNO A;  4FA1 D;  4X3E A;  3V4P A;  1FWX A;  4X60 B;  4K3J B;  3MMY A;  1VZ2 A;  3C9C A;  3NIF A;  2PBI B;  3EQ8 A;  5K19 A;  4G1M A;  3F3P A;  2YBA A;  3L4M D;  3JRP A;  2H9N A;  4ZOZ A;  4J73 A;  3ZE2 A;  2MTA H;  4XYI A;  4AN1 A;  5C9Z B;  3PXT D;  2I0S A;  4U7A A;  5FKS A;  1O6F A;  5M5U A;  5I5M A;  2WQ8 A;  5HDB A;  4ZOV A;  3V4V A;  2VDQ A;  2YMU A;  3CFV A;  4XYH A;  4GM9 A;  4G1E A;  4PSW B;  4WK4 A;  4CI2 A;  2HKM A;  4PXW A;  2J55 H;  2XZG A;  3F3F A;  4U1E I;  4H5J A;  4L3H D;  5E6R A;  5M5R A;  4JSV C;  3NIG A;  3I7K A;  2I3S A;  4MK0 B;  3I8E A;  5I5I A;  1UOP A;  3UVM A;  1H2X A;  3BG1 A;  5H1M A;  3SLE D;  4BUJ C;  5HYN B;  4O45 A;  4GMB A;  2CE9 A;  1N6F A;  1UOQ A;  4AMY A;  2QC5 A;  2EIE A;  4GM8 A;  4FAN D;  1C9I A;  2VDM A;  3EMH A;  1QNI A;  1GXR A;  3JB9 L;  2GC4 A;  3C99 A;  2JKX A;  3J81 g;  2P9U C;  3EQ7 A;  3VA6 A;  5GSA A;  2CNX A;  2XDW A;  2H9L A;  3FM0 A;  1P22 A;  3VI3 A;  1K32 A;  3ZE1 A;  3UVO A;  3I7P A;  5CXB B;  2B5N A;  4Y5R D;  5K1C C;  1H2W A;  4BL0 A;  4OZU A;  2G9A A;  3AFC A;  3N0D A;  5C2V B;  5HQG A;  5IJ8 E;  1C9L A;  4ZOX A;  4Z7O A;  3EG6 A;  4JHP C;  3RN0 D;  4IA9 A;  2VDK A;  2H14 A;  2H68 A;  3RFH A;  5EMJ B;  4JHN A;  3GFC A;  2BBK H;  2VC2 A;  3ODT A;  5GXI A;  2B5L A;  2EIB A;  3CFS B;  3EI2 A;  1H2Y A;  3RLM D;  5IC7 A;  4NC4 A;  3EI4 A;  2B5M A;  2P9P C;  3K71 A;  4PSX B;  1XIP A;  4ERQ A;  1YFQ A;  3OKY A;  3SN6 B;  4EWR A;  3O4I A;  1SHY B;  4A0B B;  1NEX B;  2CE8 A;  4QAM A;  3I7N A;  3IKO A;  3U4Y A;  2W18 A;  3IIY A;  4FA5 D;  4J0W A;  5CYK A;  3PVW B;  2XU7 A;  2CO0 A;  3SCY A;  3ZDZ A;  4ERY A;  3GRE A;  5EAP A;  3OL2 B;  3EQ9 A;  2QXV A;  1S4U X;  4WK2 A;  5HE0 B;  5M5S A;  2VZ1 A;  3HFQ A;  1L0Q A;  4A11 A;  4CC9 A;  2AGY A;  4A08 A;  2VDO A;  2OJY A;  5HE3 B;  4L1M A;  3DWL C;  4D6V A;  2XE4 A;  4GQB B;  2J56 H;  2EBS A;  3EI3 A;  4RE5 A;  3SXT D;  4PNK B;  3OW8 A;  5KDO B;  1GOH A;  3MZL A;  2HXC A;  3L4O D;  3C5M A;  3FGB A;  5FKR A;  5FXY A;  2H9M A;  3RRM C;  1R5M A;  4CY2 A;  2OK6 A;  3BG0 A;  4G56 B;  4ZOY A;  3UR4 A;  3P4F A;  4CI1 A;  4CZY A;  2P9L C;  4J8B A;  4ERZ A;  2OIZ A;  3DXK C;  4JXM A;  3GC3 B;  4LG9 A;  3UKU C;  1VYH C;  4MMX A;  4BCC A;  3IJC A;  1PGU A;  3RN1 D;  3I7O A;  4JT6 C;  3DXM C;  2IAA A;  2OVP B;  1PI6 A;  3B7F A;  2IUQ A;  3ULE C;  3KRX B;  4A0A B;  4J77 A;  1MDA H;  2IWF A;  3K6S A;  2PM9 A;  4JSP C;  3CIK B;  3A0F A;  5M5T A;  3IUM A;  1QFS A;  1O6G A;  1JOF A;  4OWR A;  4PC0 A;  5HE1 B;  2H47 A;  4N14 A;  2OVQ B;  3FRX A;  3EI1 B;  3SBP A;  5EAM A;  4CI8 A;  3FCU A;  3I89 A;  3EI4 B;  4JSN C;  3IUQ A;  3AL8 A;  2GC7 A;  4A09 B;  1VE6 A;  2H6Q A;  5EM2 A;  4J78 A;  2BCJ B;  5EAR A;  2EIC A;  1E5T A;  4CZX A;  4J81 A;  4J86 A;  5FA5 B;  1GP2 B;  3SJL D;  4D9S A;  5TDH B;  2P9I C;  1E8N A;  2H6N A;  2XL2 A;  4J82 A;  4AEZ A;  1U4C A;  3JZN A;  3I7L A;  5SXM A;  4UM8 A;  2UZY B;  5TEF A;  4Z7Q A;  5CXC A;  2YNP A;  2YB8 B;  3J80 g;  2H3X A;  4E54 A;  3NID A;  5AMS A;  3AL9 A;  4QQE A;  2H6K A;  2AH1 A;  3OKW A;  4GQ1 A;  1TYE A;  3PVU B;  1VZ3 A;  4X61 B;  1PEV A;  2VDL A; 
#chains in the Genus database with same CATH homology
 1B9X A;  3KRW B;  3UVN A;  5IGQ A;  4H5I A;  3UVL A;  3RSE C;  4A2M A;  4J0X A;  3IJ0 A;  3BWS A;  3PSC B;  5EMK B;  2Z2N A;  3VGZ A;  4K3I D;  5FLX g;  2OK4 A;  2XYI A;  3JPX A;  5I5J A;  4CI3 A;  4J8G A;  2PM7 B;  4QRJ A;  4L1Q D;  2HYE A;  4YVD A;  4D0K A;  3W15 A;  5FQD A;  2UZX B;  4CZV A;  4FWW A;  4HDJ A;  1JJU B;  4CY1 A;  1XKS A;  5JWZ A;  1N6E A;  1MG2 A;  4GGA A;  4Y7R A;  1N6D A;  4A7J A;  2PM6 B;  4JD2 C;  2H13 A;  5IT9 g;  4A2L A;  2G99 A;  3AL8 B;  3SWS D;  4O1Q D;  3PSL A;  5GMK n;  1PBY B;  1XHM A;  1Q47 A;  1RI6 A;  3MKS B;  2I3T A;  5FKT A;  1GG2 B;  2I0T A;  2IUR A;  3VH0 A;  4JSX C;  2AGZ A;  2CN3 A;  3JZH A;  3MXX A;  4J79 A;  3F3G A;  3IJ1 A;  5H14 A;  3K27 A;  4QL1 A;  2HES X;  5A2Q g;  4O3U B;  2TRC B;  4NSX A;  1TBG A;  2AQ5 A;  2CO0 C;  2OVR B;  2Q7Q A;  4FA4 D;  5FKQ A;  1OLZ A;  3JRO A;  3RMZ D;  2AGX A;  2B4E A;  2HKR A;  2P9S C;  4IMM A;  4A0B A;  3UKR C;  5AFU 3;  3V7D B;  3EI2 B;  4ESG A;  2HJ4 A;  3OKY B;  3I2N A;  2P9K C;  3E0C A;  1JMX B;  4LGN A;  1GOT B;  3OL2 A;  4XEI C;  4AOW A;  1SQ9 A;  3K26 A;  3NVN A;  2O9K A;  3SMR A;  4CY5 A;  5CYK B;  3V5W B;  4CY3 A;  3DM0 A;  3NVQ A;  3ZWL B;  5EMM B;  4A11 B;  4A08 B;  3PE7 A;  4J84 A;  5TF2 A;  5C2W B;  5GXH A;  4E5Z A;  3I8C A;  3EI3 B;  3SBQ A;  4GM3 A;  1A0R B;  4FAV D;  4TZ4 A;  4BH6 A;  4O3T B;  4PBY A;  2H9P A;  3EWE A;  4PBZ A;  2HJB A;  2AH0 A;  5HE2 B;  1U2V C;  3RFG A;  2Z2O A;  5AJA A;  4L9O A;  1TYQ C;  3OKT A;  3OTT A;  4FA9 D;  3N0E A;  4ZN4 A;  4I79 A;  1OMW B;  4FB1 D;  4A0A A;  3IIW A;  5H17 A;  4ES0 A;  3PXS D;  4O9D A;  3AH8 B;  1JMZ B;  3MZK A;  3UVK A;  5IJ7 E;  4KFM B;  3MKQ A;  2CN2 A;  3DSM A;  3EI1 A;  4J87 A;  4L3G D;  4FHL A;  2IUV A;  4GZ8 A;  2PM9 B;  2P9N C;  3I7H A;  2IWK A;  2J57 G;  4A09 A;  2GNQ A;  1SQJ A;  2IUP A;  5B4W A;  5EML B;  4JT5 C;  1ERJ A;  5IGO A;  4QT8 A;  5EAL A;  3SBR A;  2YNN A;  1K8K C;  3SFZ A;  3V9F A;  3JAM g;  2XL3 A;  1B9Y A;  3SHF A;  5THA A;  3JZG A;  2I0R A;  4GQ2 P;  3EU7 A;  4Z8L A;  4GGC A;  5CXB A;  4X63 B;  5TEE A;  2AGW A;  5CXC B;  4E54 B;  1MG3 A;  3ORV D;  4R7A B;  4UI9 R;  4LG8 A;  1NR0 A;  3C75 H;  3SVW D;  2AGL A;  3PXW D;  4E5Z B;  5EM2 B;  2Z2P A;  3NVX A;  4GGD A;  2YNO A;  4FA1 D;  4X3E A;  1FWX A;  4X60 B;  4K3J B;  3MMY A;  3C9C A;  2PBI B;  5K19 A;  3F3P A;  2YBA A;  3L4M D;  3JRP A;  2H9N A;  4ZOZ A;  4J73 A;  2MTA H;  4XYI A;  5C9Z B;  3PXT D;  2I0S A;  4U7A A;  5FKS A;  5I5M A;  4ZOV A;  2YMU A;  3CFV A;  4XYH A;  4GM9 A;  4PSW B;  4CI2 A;  2HKM A;  4PXW A;  2J55 H;  4U1E I;  3F3F A;  4H5J A;  4L3H D;  4JSV C;  3I7K A;  2I3S A;  4MK0 B;  3I8E A;  5I5I A;  3UVM A;  3BG1 A;  5H1M A;  3SLE D;  4BUJ C;  5HYN B;  4O45 A;  4GMB A;  2CE9 A;  1N6F A;  2QC5 A;  4FAN D;  4GM8 A;  3EMH A;  1QNI A;  1GXR A;  3JB9 L;  2GC4 A;  3C99 A;  3J81 g;  2P9U C;  3VA6 A;  5GSA A;  2CNX A;  2H9L A;  3FM0 A;  1P22 A;  1K32 A;  3UVO A;  3I7P A;  5CXB B;  2B5N A;  4Y5R D;  5K1C C;  4BL0 A;  4OZU A;  2G9A A;  3AFC A;  3N0D A;  5C2V B;  5HQG A;  5IJ8 E;  4ZOX A;  3EG6 A;  3RN0 D;  4IA9 A;  2H14 A;  2H68 A;  3RFH A;  5EMJ B;  3GFC A;  2BBK H;  3ODT A;  5GXI A;  2B5L A;  3EI2 A;  3CFS B;  3RLM D;  5IC7 A;  3EI4 A;  2B5M A;  2P9P C;  4PSX B;  1XIP A;  4ERQ A;  1YFQ A;  3OKY A;  3SN6 B;  4EWR A;  1SHY B;  4A0B B;  1NEX B;  2CE8 A;  3I7N A;  3IKO A;  3U4Y A;  2W18 A;  3IIY A;  4FA5 D;  4J0W A;  5CYK A;  3PVW B;  2XU7 A;  2CO0 A;  3SCY A;  4ERY A;  3GRE A;  5EAP A;  3OL2 B;  2QXV A;  1S4U X;  5HE0 B;  3HFQ A;  1L0Q A;  4A11 A;  4CC9 A;  2AGY A;  4A08 A;  2OJY A;  5HE3 B;  3DWL C;  4D6V A;  4GQB B;  2J56 H;  2EBS A;  3EI3 A;  3SXT D;  4PNK B;  3OW8 A;  5KDO B;  3MZL A;  2HXC A;  3L4O D;  3C5M A;  3FGB A;  5FKR A;  5FXY A;  2H9M A;  3RRM C;  1R5M A;  4CY2 A;  2OK6 A;  3BG0 A;  4G56 B;  4ZOY A;  3UR4 A;  3P4F A;  4CI1 A;  4CZY A;  2P9L C;  4J8B A;  4ERZ A;  2OIZ A;  3DXK C;  4JXM A;  4LG9 A;  3UKU C;  1VYH C;  3IJC A;  1PGU A;  3RN1 D;  3I7O A;  4JT6 C;  3DXM C;  2IAA A;  2OVP B;  1PI6 A;  3B7F A;  2IUQ A;  3ULE C;  3KRX B;  4A0A B;  4J77 A;  1MDA H;  2IWF A;  2PM9 A;  4JSP C;  3CIK B;  3A0F A;  1JOF A;  4OWR A;  4PC0 A;  5HE1 B;  2H47 A;  4N14 A;  2OVQ B;  3FRX A;  3EI1 B;  3SBP A;  5EAM A;  4CI8 A;  3I89 A;  3EI4 B;  4JSN C;  3AL8 A;  2GC7 A;  4A09 B;  2H6Q A;  4J78 A;  2BCJ B;  5EAR A;  4CZX A;  4J81 A;  4J86 A;  5FA5 B;  1GP2 B;  3SJL D;  5TDH B;  2P9I C;  2H6N A;  2XL2 A;  4J82 A;  4AEZ A;  1U4C A;  3JZN A;  3I7L A;  5SXM A;  2UZY B;  5TEF A;  5CXC A;  2YNP A;  2YB8 B;  3J80 g;  2H3X A;  4E54 A;  5AMS A;  3AL9 A;  4QQE A;  4GQ1 A;  2H6K A;  2AH1 A;  3OKW A;  3PVU B;  4X61 B;  1PEV A;  5EM2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...