3F3GA

Crystal structure of the nucleoporin pair nup85-seh1, space group p212121
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
347
structure length
300
Chain Sequence
MQPFDSGHDDLVHDVVYDFYGRHVATCSSDQHIKVFKLDKDTSNWELSDSWRAHDSSIVAIDWASPEYGRIIASASYDKTVKLWEEDPDQEECSGRRWNKLCTLNDSKGSLYSVKFAPAHLGLKLACLGNDGILRLYDALEPSDLRSWTLTSEMKVLSIPSDFCLSWCPSRFSPEKLAVSALEQAIIYQRGKDGKLHVAAKLPGHKSLIRSISWAPSIGRWYQLIATGCKDGRIRIFKITEKSNLQVELLSEHDDHNGEVWSVSWNLTGTILSSAGDDGKVRLWKATYSNEFKCMSVITA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Nucleoporin SEH1
publication title A fence-like coat for the nuclear pore membrane.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 59
structure length 300
sequence length 347
chains with identical sequence B, E, F
ec nomenclature
pdb deposition date 2008-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3f3gA01
5SXMA 3UVOA 1K32A 3I7HA 1Q47A 4FB1D 5GMKn 4A11B 2W18A 3PXWD 2J57G 2Z2PA 2XYIA 5I5IA 2IUQA 4HDJA 3UVLA 3V7DB 1N6DA 4TZ4A 2IUVA 3SXTD 3IJ0A 4J87A 3FRXA 1PBYB 3OKYA 4GM8A 1MG3A 4LG8A 4ERZA 2GC7A 5FKTA 3L4MD 4QQEA 5EMLB 2OJYA 4CC9A 1GOTB 3GREA 4E5ZA 5FA5B 5KDOB 4XYIA 2PM6B 4FA9D 2H9MA 3AL8A 3ZWLB 4JT6C 4ESGA 4ZOVA 2AH1A 5FLXg 3I8EA 3I7NA 3OL2A 2B5LA 3RN1D 3PE7A 3C75H 4J0XA 2PBIB 1U2VC 3RFGA 4J0WA 3I7OA 1B9YA 4ZOZA 5AMSA 2G9AA 2O9KA 3BWSA 4D6VA 2UZYB 3JZHA 2IAAA 2P9UC 4JSNC 4QRJA 5C9ZB 3EI4B 3C99A 4PBYA 3SN6B 4O9DA 4A09A 1MG2A 5HE2B 2BBKH 1QNIA 2HJ4A 3V5WB 2J55H 4PBZA 5IGQA 4FHLA 3DXKC 4A0AB 1XIPA 3JPXA 1K8KC 4O45A 4CI1A 4FAND 3V9FA 1GP2B 4CI3A 3F3FA 4X63B 5IJ8E 5K19A 5EAPA 3NVQA 3HFQA 2H13A 2P9SC 3OKWA 4CI2A 3RMZD 1JJUB 2PM9A 4GQBB 3SWSD 2HJBA 4A08B 2XL2A 2Q7QA 3PXTD 1NEXB 2OVRB 4X61B 2XU7A 3SLED 4J81A 3IKOA 3I7KA 2CN2A 3B7FA 5CXBA 2P9LC 3JZGA 3SFZA 3KRXB 3ULEC 5TF2A 2GC4A 1ERJA 4J84A 1PEVA 3ORVD 4OWRA 1L0QA 2QC5A 2H6KA 4A0BB 4N14A 4PSXB 2I0SA 2AH0A 3IJCA 2I0TA 4PXWA 5FKRA 5EM2A 3I7LA 2CN3A 1XKSA 2TRCB 5CXCB 5TEFA 2OIZA 3OTTA 1SQJA 1N6EA 4ES0A 3EI1B 3EI3B 3VGZA 2OVQB 4YVDA 3PXSD 2HKMA 2CO0C 3SBRA 5EMMB 3SCYA 3JB9L 1GXRA 1XHMA 4H5IA 3UVNA 2B5MA 3IJ1A 3SMRA 2AGYA 3IIWA 4O3UB 1B9XA 3SJLD 1S4UX 4J8GA 4U1EI 4AOWA 4U7AA 4FAVD 3BG1A 2H6NA 4GGDA 5EAMA 4J73A 4JSPC 2IWKA 4A2MA 2YNNA 2MTAH 2P9KC 2BCJB 2H14A 4QT8A 1FWXA 4XYHA 3VA6A 3AL8B 3N0EA 4KFMB 3JAMg 2AGZA 4CY2A 1PGUA 4PC0A 4J82A 5I5MA 1PI6A 2H6QA 5THAA 4AEZA 1RI6A 3MXXA 3EMHA 4L3GD 1VYHC 4GQ1A 2YB8B 3MZLA 5H17A 2J56H 3SVWD 5CYKB 2AGXA 4MK0B 4J77A 3EI2B 3EI4A 4UI9R 3CFSB 2H9PA 5GXIA 1OLZA 2CNXA 3A0FA 3CFVA 4L9OA 4FA4D 4A0AA 4OZUA 3DSMA 3AH8B 4GM9A 3BG0A 4BH6A 2I0RA 5IJ7E 3PSCB 3F3GA 5H14A 4ERQA 4CI8A 2AGWA 5IGOA 1TYQC 2I3SA 3DXMC 2XL3A 5EMKB 3UVMA 3PSLA 4ERYA 4X60B 5HE0B 4IMMA 2IUPA 3CIKB 3L4OD 5TEEA 1U4CA 2HKRA 4GGAA 2YNPA 3RN0D 1JMXB 4D0KA 2Z2NA 3PVWB 3U4YA 2I3TA 3EU7A 4A7JA 4A11A 5FKQA 4E54B 3RRMC 4LG9A 2HYEA 5AJAA 4R7AB 4FA5D 3SBPA 5AFU3 4A0BA 5CXBB 1N6FA 2CO0A 3EWEA 5CXCA 1GG2B 3IIYA 2B4EA 3RFHA 3EI1A 3EI3A 3AFCA 2OK6A 4CY3A 3DM0A 3MZKA 2AGLA 2YMUA 4JXMA 3FM0A 2H3XA 4O1QD 3OW8A 4A2LA 5EM2B 4PSWB 3I7PA 3E0CA 4ZOXA 3UKUC 4EWRA 5HYNB 2OVPB 3OKYB 2CE8A 3I2NA 3AL9A 5TDHB 1NR0A 2H9LA 5HE1B 4GZ8A 2Z2OA 3EG6A 1OMWB 4CZYA 4FA1D 4E5ZB 3PVUB 1SHYB 5GSAA 2CE9A 5GXHA 3J81g 1P22A 2IWFA 3C9CA 2EBSA 3I89A 2OK4A 5FXYA 4GM3A 2HXCA 4JSVC 3F3PA 3SBQA 5EARA 3DWLC 2P9NC 3K26A 4GQ2P 4CZVA 2AQ5A 3OL2B 5IC7A 4BL0A 3FGBA 3UR4A 3GFCA 3OKTA 2PM7B 5C2VB 4ZN4A 4K3JB 2H9NA 4J78A 1A0RB 5C2WB 3JROA 2GNQA 5CYKA 3UKRC 2YNOA 3EI2A 4CY1A 5I5JA 4XEIC 5FKSA 4JD2C 5K1CC 2B5NA 3K27A 1JOFA 5FQDA 4CY5A 4BUJC 4I79A 4G56B 3NVNA 4J79A 1TBGA 3NVXA 3MKSB 3ODTA 4NSXA 4JSXC 3C5MA 2YBAA 5A2Qg 3P4FA 4L1QD 3KRWB 4A09B 4Z8LA 5H1MA 3N0DA 1JMZB 4ZOYA 4GMBA 2P9PC 4JT5C 4A08A 4FWWA 1MDAH 4J86A 3VH0A 2IURA 4J8BA 4QL1A 4IA9A 2P9IC 4K3ID 4X3EA 3W15A 5EMJB 4O3TB 5B4WA 2PM9B 5JWZA 2HESX 3MMYA 3J80g 4Y7RA 5IT9g 3SHFA 4H5JA 1SQ9A 1YFQA 2QXVA 3JZNA 4LGNA 5HQGA 4GGCA 2G99A 3MKQA 5HE3B 4E54A 4CZXA 2H47A 2UZXB 3RSEC 3UVKA 4L3HD 5EALA 4PNKB 3JRPA 3RLMD 3I8CA 2H68A 4Y5RD 1R5MA
chains in the Genus database with same CATH superfamily
5SXMA 2XE4A 3EQ9A 1K32A 3I7HA 3UVOA 1Q47A 4FB1D 5GMKn 4A11B 2W18A 3PXWD 4UM8A 2J57G 2Z2PA 2XYIA 5I5IA 5M5UA 1I2MB 2IUQA 2VDNA 4HDJA 3UVLA 1N6DA 3V4PA 3V7DB 2JKXA 4TZ4A 2IUVA 3SXTD 3IJ0A 4J87A 3FRXA 2EIBA 3T3MA 1PBYB 3MUNA 3OKYA 4GM8A 1MG3A 4LG8A 4ERZA 2GC7A 1GOFA 5FKTA 3L4MD 4QQEA 5EMLB 2OJYA 4NAAA 1A12A 3GC3B 4CC9A 1JV2A 3GREA 1GOTB 4E5ZA 5FA5B 4DNWA 3K6SA 5KDOB 4XYIA 2PM6B 1VZ3A 1E5TA 4FA9D 3FCUA 2H9MA 3AL8A 3ZWLB 4Z7QA 1BPOA 4JT6C 4D9SA 3FCSA 3ZDZA 4ESGA 4ZOVA 2AH1A 2QR5A 5FLXg 3I8EA 1H2YA 3I7NA 3OL2A 2B5LA 3RN1D 3PE7A 4G1MA 3C75H 2VZ3A 4J0XA 2PBIB 1U2VC 3RFGA 1JTDB 4J0WA 3I7OA 1B9YA 1H2WA 4ZOZA 5AMSA 2VDPA 2G9AA 2O9KA 3BWSA 4D6VA 5M5SA 2UZYB 3JZHA 3ZE2A 2IAAA 5E6SA 3VI4A 2P9UC 4JSNC 4QRJA 2XDWA 3EI4B 5C9ZB 3C99A 4PBYA 3SN6B 4O9DA 4A09A 1MG2A 5HE2B 2BBKH 1QNIA 2HJ4A 3V5WB 2J55H 1K3IA 4PBZA 5IGQA 4AN0A 4FHLA 3DXKC 4A0AB 1XIPA 3EQ7A 3JPXA 1K8KC 4O02A 4O45A 4CI1A 4FAND 3V9FA 1GP2B 4CI3A 3F3FA 4RE5A 4X63B 5IJ8E 5EAPA 3NVQA 2H13A 3HFQA 5K19A 3V4VA 4BCBA 2P9SC 3OKWA 4CI2A 3RMZD 1JJUB 2PM9A 4GQBB 3SWSD 2HJBA 4A08B 2XL2A 2Q7QA 3PXTD 5C86A 1NEXB 2OVRB 4X61B 5C92A 2XU7A 3SLED 4J81A 3NIFA 3O4HA 3IKOA 3I7KA 2CN2A 3NIGA 3B7FA 5CXBA 1M1XA 2P9LC 3JZGA 1O6FA 1TYEA 2VC2A 4QAMA 3SFZA 3KRXB 3ULEC 5TF2A 2GC4A 2VDQA 3NIDA 3T3PA 1ERJA 4J84A 1PEVA 3ORVD 4OWRA 1L0QA 2QC5A 1H2XA 2H6KA 4A0BB 4N14A 4PSXB 2I0SA 2AH0A 3IJCA 2I0TA 2VDMA 4PXWA 5FKRA 5EM2A 3I7LA 2CN3A 1XKSA 2TRCB 5CXCB 5TEFA 2OIZA 2QZPA 3OTTA 1SQJA 1N6EA 4ES0A 3EI1B 3IUMA 3EI3B 3VGZA 2EIEA 3IUNA 2OVQB 3KCIA 4YVDA 3K72A 3PXSD 2HKMA 2CO0C 3SBRA 5EMMB 3SCYA 3JB9L 1GXRA 1XHMA 4H5IA 3UVNA 2B5MA 3IJ1A 2BKLA 3SMRA 2VDKA 2AGYA 3IIWA 4O3UB 1B9XA 3SJLD 1S4UX 4J8GA 4U1EI 4AOWA 4U7AA 2HU5A 4FAVD 3BG1A 1UOOA 2H6NA 4GGDA 3IUQA 5EAMA 4G55A 4J73A 4WK4A 4Z7NA 4JSPC 2IWKA 4A2MA 2YNNA 2MTAH 2P9KC 2BCJB 2H14A 4QT8A 1FWXA 4XYHA 2EICA 3IUJA 5M5VA 3VA6A 2HU7A 4BP8A 3AL8B 3N0EA 4KFMB 3JAMg 3MUOA 2AGZA 3EQ8A 4CY2A 5E6UA 1PGUA 4PC0A 4J82A 1E8MA 5I5MA 1PI6A 2H6QA 3O4IA 5THAA 2VDRA 1UOPA 4AEZA 1RI6A 3MXXA 3EMHA 4L3GD 1VYHC 4GQ1A 5M5RA 2YB8B 3MZLA 5H17A 2J56H 3SVWD 5CYKB 5E6RA 4DNUA 2AGXA 4MK0B 4J77A 3EI2B 3EI4A 4UI9R 3CFSB 4JHPC 4Z7OA 3ZDXA 2H9PA 2VDLA 5GXIA 1OLZA 2CNXA 4RE6A 3A0FA 4AMYA 3CFVA 4L9OA 3ZDYA 4NC4A 4FA4D 4A0AA 4OZUA 3IURA 3DSMA 3AH8B 5FFGA 4GM9A 3BG0A 4BH6A 2I0RA 5IJ7E 3PSCB 4L1MA 3F3GA 4AMZA 5H14A 4MMXA 1O6GA 4AN1A 4ERQA 1YR2A 4CI8A 2AGWA 5IGOA 5HDBA 5M61A 1C9LA 1TYQC 2I3SA 3DXMC 2XL3A 5EMKB 3UVMA 1GOGA 3PSLA 4ERYA 4X60B 2WQ8A 5HE0B 4IMMA 2IUPA 3CIKB 3L4OD 5TEEA 1U4CA 2HKRA 4GGAA 1L5GA 2YNPA 3IJEA 3RN0D 1JMXB 3QI0A 4MMYA 4D0KA 2Z2NA 4UM9A 3PVWB 3U4YA 1E8NA 3IVMA 2I3TA 3EU7A 2HU8A 4A7JA 4A11A 5FKQA 4E54B 3RRMC 4LG9A 2HYEA 4O2WA 5AJAA 4R7AB 4FA5D 3SBPA 5AFU3 4A0BA 1VE7A 5CXBB 1N6FA 2CO0A 3EWEA 5CXCA 3MVDK 1GG2B 3IIYA 2B4EA 3RFHA 3VI3A 3EI1A 3EI3A 3AFCA 2OK6A 1GOHA 3DDUA 4CY3A 3DM0A 3MZKA 2AGLA 2VDOA 2YMUA 4JXMA 4AX4A 3FM0A 2H3XA 4O1QD 3OW8A 4A2LA 5EM2B 4PSWB 3I7PA 3E0CA 4ZOXA 3UKUC 4EWRA 5HYNB 2OVPB 3OKYB 2CE8A 3I2NA 3AL9A 5TDHB 4JHNA 3O4GA 1NR0A 2H9LA 5HE1B 4GZ8A 2Z2OA 3EG6A 1OMWB 4CZYA 4FA1D 4E5ZB 3PVUB 4BP9A 1SHYB 5GSAA 2CE9A 5GXHA 3J81g 1P22A 5M5TA 2IWFA 3C9CA 2EBSA 3I89A 4NENA 1QFSA 2OK4A 5FXYA 1UOQA 4GM3A 2HXCA 4JSVC 3F3PA 3OF7A 3SBQA 3GD1I 3O4JA 5EARA 3QHYB 4BCDA 3DWLC 2P9NC 3K26A 4GQ2P 4CZVA 2AQ5A 3OL2B 5IC7A 4BL0A 3FGBA 1UTCA 3UR4A 3GFCA 3OKTA 2PM7B 5C2VB 4ZN4A 4K3JB 3K71A 4DNVA 3ZE0A 2H9NA 4J78A 1A0RB 4WK0A 3JROA 2GNQA 5CYKA 3UKRC 2YNOA 5C2WB 5FFOA 4CY1A 3EI2A 5I5JA 4XEIC 5FKSA 4JD2C 5K1CC 2B5NA 4BCCA 3K27A 1JOFA 1VE6A 5FQDA 4CY5A 4BUJC 4I79A 4G56B 1H2ZA 3NVNA 4J79A 1TBGA 3NVXA 3MKSB 3ODTA 4NSXA 4JSXC 3C5MA 2YBAA 5A2Qg 3P4FA 4L1QD 4MMZA 3KRWB 4A09B 4Z8LA 5H1MA 3N0DA 3ZE1A 1JMZB 4ZOYA 4GMBA 2P9PC 4JT5C 4A08A 1QFMA 4FWWA 1MDAH 4J86A 2VZ1A 3VH0A 2IURA 4G1EA 4J8BA 4NBMA 4IA9A 4QL1A 2P9IC 4K3ID 1C9IA 4X3EA 1U8CA 1VZ2A 3W15A 5EMJB 2XZGA 1T2XA 4O3TB 5B4WA 2PM9B 5JWZA 2HESX 3MMYA 3J80g 4Y7RA 5IT9g 3IULA 4IRZA 3SHFA 1SQ9A 1YFQA 2QXVA 4H5JA 3JZNA 4LGNA 5HQGA 2EIDA 4GGCA 2G99A 3MKQA 4WJKA 5HE3B 4E54A 4CZXA 2H47A 2UZXB 4WK2A 3RSEC 3UVKA 4L3HD 5EALA 4PNKB 3JRPA 3RLMD 3I8CA 2H68A 4Y5RD 1R5MA
chains in the Genus database with same CATH topology
5SXMA 3UVOA 1K32A 3I7HA 1Q47A 4FB1D 5GMKn 4A11B 2W18A 3PXWD 2J57G 2Z2PA 2XYIA 5I5IA 2IUQA 4HDJA 3UVLA 3V7DB 1N6DA 4TZ4A 2IUVA 3SXTD 3IJ0A 4J87A 3FRXA 1PBYB 3OKYA 4GM8A 1MG3A 4LG8A 4ERZA 2GC7A 5FKTA 3L4MD 4QQEA 5EMLB 2OJYA 4CC9A 1GOTB 3GREA 4E5ZA 5FA5B 5KDOB 4XYIA 2PM6B 4FA9D 2H9MA 3AL8A 3ZWLB 4JT6C 4ESGA 4ZOVA 2AH1A 5FLXg 3I8EA 3I7NA 3OL2A 2B5LA 3RN1D 3PE7A 3C75H 4J0XA 2PBIB 1U2VC 3RFGA 4J0WA 3I7OA 1B9YA 4ZOZA 5AMSA 2G9AA 2O9KA 3BWSA 4D6VA 2UZYB 3JZHA 2IAAA 2P9UC 4JSNC 4QRJA 5C9ZB 3EI4B 3C99A 4PBYA 3SN6B 4O9DA 4A09A 1MG2A 5HE2B 2BBKH 1QNIA 2HJ4A 3V5WB 2J55H 4PBZA 5IGQA 4FHLA 3DXKC 4A0AB 1XIPA 3JPXA 1K8KC 4O45A 4CI1A 4FAND 3V9FA 1GP2B 4CI3A 3F3FA 4X63B 5IJ8E 5K19A 5EAPA 3NVQA 3HFQA 2H13A 2P9SC 3OKWA 4CI2A 3RMZD 1JJUB 2PM9A 4GQBB 3SWSD 2HJBA 4A08B 2XL2A 2Q7QA 3PXTD 1NEXB 2OVRB 4X61B 2XU7A 3SLED 4J81A 3IKOA 3I7KA 2CN2A 3B7FA 5CXBA 2P9LC 3JZGA 3SFZA 3KRXB 3ULEC 5TF2A 2GC4A 1ERJA 4J84A 1PEVA 3ORVD 4OWRA 1L0QA 2QC5A 2H6KA 4A0BB 4N14A 4PSXB 2I0SA 2AH0A 3IJCA 2I0TA 4PXWA 5FKRA 5EM2A 3I7LA 2CN3A 1XKSA 2TRCB 5CXCB 5TEFA 2OIZA 3OTTA 1SQJA 1N6EA 4ES0A 3EI1B 3EI3B 3VGZA 2OVQB 4YVDA 3PXSD 2HKMA 2CO0C 3SBRA 5EMMB 3SCYA 3JB9L 1GXRA 1XHMA 4H5IA 3UVNA 2B5MA 3IJ1A 3SMRA 2AGYA 3IIWA 4O3UB 1B9XA 3SJLD 1S4UX 4J8GA 4U1EI 4AOWA 4U7AA 4FAVD 3BG1A 2H6NA 4GGDA 5EAMA 4J73A 4JSPC 2IWKA 4A2MA 2YNNA 2MTAH 2P9KC 2BCJB 2H14A 4QT8A 1FWXA 4XYHA 3VA6A 3AL8B 3N0EA 4KFMB 3JAMg 2AGZA 4CY2A 1PGUA 4PC0A 4J82A 5I5MA 1PI6A 2H6QA 5THAA 4AEZA 1RI6A 3MXXA 3EMHA 4L3GD 1VYHC 4GQ1A 2YB8B 3MZLA 5H17A 2J56H 3SVWD 5CYKB 2AGXA 4MK0B 4J77A 3EI2B 3EI4A 4UI9R 3CFSB 2H9PA 5GXIA 1OLZA 2CNXA 3A0FA 3CFVA 4L9OA 4FA4D 4A0AA 4OZUA 3DSMA 3AH8B 4GM9A 3BG0A 4BH6A 2I0RA 5IJ7E 3PSCB 3F3GA 5H14A 4ERQA 4CI8A 2AGWA 5IGOA 1TYQC 2I3SA 3DXMC 2XL3A 5EMKB 3UVMA 3PSLA 4ERYA 4X60B 5HE0B 4IMMA 2IUPA 3CIKB 3L4OD 5TEEA 1U4CA 2HKRA 4GGAA 2YNPA 3RN0D 1JMXB 4D0KA 2Z2NA 3PVWB 3U4YA 2I3TA 3EU7A 4A7JA 4A11A 5FKQA 4E54B 3RRMC 4LG9A 2HYEA 5AJAA 4R7AB 4FA5D 3SBPA 5AFU3 4A0BA 5CXBB 1N6FA 2CO0A 3EWEA 5CXCA 1GG2B 3IIYA 2B4EA 3RFHA 3EI1A 3EI3A 3AFCA 2OK6A 4CY3A 3DM0A 3MZKA 2AGLA 2YMUA 4JXMA 3FM0A 2H3XA 4O1QD 3OW8A 4A2LA 5EM2B 4PSWB 3I7PA 3E0CA 4ZOXA 3UKUC 4EWRA 5HYNB 2OVPB 3OKYB 2CE8A 3I2NA 3AL9A 5TDHB 1NR0A 2H9LA 5HE1B 4GZ8A 2Z2OA 3EG6A 1OMWB 4CZYA 4FA1D 4E5ZB 3PVUB 1SHYB 5GSAA 2CE9A 5GXHA 3J81g 1P22A 2IWFA 3C9CA 2EBSA 3I89A 2OK4A 5FXYA 4GM3A 2HXCA 4JSVC 3F3PA 3SBQA 5EARA 3DWLC 2P9NC 3K26A 4GQ2P 4CZVA 2AQ5A 3OL2B 5IC7A 4BL0A 3FGBA 3UR4A 3GFCA 3OKTA 2PM7B 5C2VB 4ZN4A 4K3JB 2H9NA 4J78A 1A0RB 5C2WB 3JROA 2GNQA 5CYKA 3UKRC 2YNOA 3EI2A 4CY1A 5I5JA 4XEIC 5FKSA 4JD2C 5K1CC 2B5NA 3K27A 1JOFA 5FQDA 4CY5A 4BUJC 4I79A 4G56B 3NVNA 4J79A 1TBGA 3NVXA 3MKSB 3ODTA 4NSXA 4JSXC 3C5MA 2YBAA 5A2Qg 3P4FA 4L1QD 3KRWB 4A09B 4Z8LA 5H1MA 3N0DA 1JMZB 4ZOYA 4GMBA 2P9PC 4JT5C 4A08A 4FWWA 1MDAH 4J86A 3VH0A 2IURA 4J8BA 4QL1A 4IA9A 2P9IC 4K3ID 4X3EA 3W15A 5EMJB 4O3TB 5B4WA 2PM9B 5JWZA 2HESX 3MMYA 3J80g 4Y7RA 5IT9g 3SHFA 4H5JA 1SQ9A 1YFQA 2QXVA 3JZNA 4LGNA 5HQGA 4GGCA 2G99A 3MKQA 5HE3B 4E54A 4CZXA 2H47A 2UZXB 3RSEC 3UVKA 4L3HD 5EALA 4PNKB 3JRPA 3RLMD 3I8CA 2H68A 4Y5RD 1R5MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5SXM A;  3UVO A;  1K32 A;  3I7H A;  1Q47 A;  4FB1 D;  5GMK n;  4A11 B;  2W18 A;  3PXW D;  2J57 G;  2Z2P A;  2XYI A;  5I5I A;  2IUQ A;  4HDJ A;  3UVL A;  3V7D B;  1N6D A;  4TZ4 A;  2IUV A;  3SXT D;  3IJ0 A;  4J87 A;  3FRX A;  1PBY B;  3OKY A;  4GM8 A;  1MG3 A;  4LG8 A;  4ERZ A;  2GC7 A;  5FKT A;  3L4M D;  4QQE A;  5EML B;  2OJY A;  4CC9 A;  1GOT B;  3GRE A;  4E5Z A;  5FA5 B;  5KDO B;  4XYI A;  2PM6 B;  4FA9 D;  2H9M A;  3AL8 A;  3ZWL B;  4JT6 C;  4ESG A;  4ZOV A;  2AH1 A;  5FLX g;  3I8E A;  3I7N A;  3OL2 A;  2B5L A;  3RN1 D;  3PE7 A;  3C75 H;  4J0X A;  2PBI B;  1U2V C;  3RFG A;  4J0W A;  3I7O A;  1B9Y A;  4ZOZ A;  5AMS A;  2G9A A;  2O9K A;  3BWS A;  4D6V A;  2UZY B;  3JZH A;  2IAA A;  2P9U C;  4JSN C;  4QRJ A;  5C9Z B;  3EI4 B;  3C99 A;  4PBY A;  3SN6 B;  4O9D A;  4A09 A;  1MG2 A;  5HE2 B;  2BBK H;  1QNI A;  2HJ4 A;  3V5W B;  2J55 H;  4PBZ A;  5IGQ A;  4FHL A;  3DXK C;  4A0A B;  1XIP A;  3JPX A;  1K8K C;  4O45 A;  4CI1 A;  4FAN D;  3V9F A;  1GP2 B;  4CI3 A;  3F3F A;  4X63 B;  5IJ8 E;  5K19 A;  5EAP A;  3NVQ A;  3HFQ A;  2H13 A;  2P9S C;  3OKW A;  4CI2 A;  3RMZ D;  1JJU B;  2PM9 A;  4GQB B;  3SWS D;  2HJB A;  4A08 B;  2XL2 A;  2Q7Q A;  3PXT D;  1NEX B;  2OVR B;  4X61 B;  2XU7 A;  3SLE D;  4J81 A;  3IKO A;  3I7K A;  2CN2 A;  3B7F A;  5CXB A;  2P9L C;  3JZG A;  3SFZ A;  3KRX B;  3ULE C;  5TF2 A;  2GC4 A;  1ERJ A;  4J84 A;  1PEV A;  3ORV D;  4OWR A;  1L0Q A;  2QC5 A;  2H6K A;  4A0B B;  4N14 A;  4PSX B;  2I0S A;  2AH0 A;  3IJC A;  2I0T A;  4PXW A;  5FKR A;  5EM2 A;  3I7L A;  2CN3 A;  1XKS A;  2TRC B;  5CXC B;  5TEF A;  2OIZ A;  3OTT A;  1SQJ A;  1N6E A;  4ES0 A;  3EI1 B;  3EI3 B;  3VGZ A;  2OVQ B;  4YVD A;  3PXS D;  2HKM A;  2CO0 C;  3SBR A;  5EMM B;  3SCY A;  3JB9 L;  1GXR A;  1XHM A;  4H5I A;  3UVN A;  2B5M A;  3IJ1 A;  3SMR A;  2AGY A;  3IIW A;  4O3U B;  1B9X A;  3SJL D;  1S4U X;  4J8G A;  4U1E I;  4AOW A;  4U7A A;  4FAV D;  3BG1 A;  2H6N A;  4GGD A;  5EAM A;  4J73 A;  4JSP C;  2IWK A;  4A2M A;  2YNN A;  2MTA H;  2P9K C;  2BCJ B;  2H14 A;  4QT8 A;  1FWX A;  4XYH A;  3VA6 A;  3AL8 B;  3N0E A;  4KFM B;  3JAM g;  2AGZ A;  4CY2 A;  1PGU A;  4PC0 A;  4J82 A;  5I5M A;  1PI6 A;  2H6Q A;  5THA A;  4AEZ A;  1RI6 A;  3MXX A;  3EMH A;  4L3G D;  1VYH C;  4GQ1 A;  2YB8 B;  3MZL A;  5H17 A;  2J56 H;  3SVW D;  5CYK B;  2AGX A;  4MK0 B;  4J77 A;  3EI2 B;  3EI4 A;  4UI9 R;  3CFS B;  2H9P A;  5GXI A;  1OLZ A;  2CNX A;  3A0F A;  3CFV A;  4L9O A;  4FA4 D;  4A0A A;  4OZU A;  3DSM A;  3AH8 B;  4GM9 A;  3BG0 A;  4BH6 A;  2I0R A;  5IJ7 E;  3PSC B;  3F3G A;  5H14 A;  4ERQ A;  4CI8 A;  2AGW A;  5IGO A;  1TYQ C;  2I3S A;  3DXM C;  2XL3 A;  5EMK B;  3UVM A;  3PSL A;  4ERY A;  4X60 B;  5HE0 B;  4IMM A;  2IUP A;  3CIK B;  3L4O D;  5TEE A;  1U4C A;  2HKR A;  4GGA A;  2YNP A;  3RN0 D;  1JMX B;  4D0K A;  2Z2N A;  3PVW B;  3U4Y A;  2I3T A;  3EU7 A;  4A7J A;  4A11 A;  5FKQ A;  4E54 B;  3RRM C;  4LG9 A;  2HYE A;  5AJA A;  4R7A B;  4FA5 D;  3SBP A;  5AFU 3;  4A0B A;  5CXB B;  1N6F A;  2CO0 A;  3EWE A;  5CXC A;  1GG2 B;  3IIY A;  2B4E A;  3RFH A;  3EI1 A;  3EI3 A;  3AFC A;  2OK6 A;  4CY3 A;  3DM0 A;  3MZK A;  2AGL A;  2YMU A;  4JXM A;  3FM0 A;  2H3X A;  4O1Q D;  3OW8 A;  4A2L A;  5EM2 B;  4PSW B;  3I7P A;  3E0C A;  4ZOX A;  3UKU C;  4EWR A;  5HYN B;  2OVP B;  3OKY B;  2CE8 A;  3I2N A;  3AL9 A;  5TDH B;  1NR0 A;  2H9L A;  5HE1 B;  4GZ8 A;  2Z2O A;  3EG6 A;  1OMW B;  4CZY A;  4FA1 D;  4E5Z B;  3PVU B;  1SHY B;  5GSA A;  2CE9 A;  5GXH A;  3J81 g;  1P22 A;  2IWF A;  3C9C A;  2EBS A;  3I89 A;  2OK4 A;  5FXY A;  4GM3 A;  2HXC A;  4JSV C;  3F3P A;  3SBQ A;  5EAR A;  3DWL C;  2P9N C;  3K26 A;  4GQ2 P;  4CZV A;  2AQ5 A;  3OL2 B;  5IC7 A;  4BL0 A;  3FGB A;  3UR4 A;  3GFC A;  3OKT A;  2PM7 B;  5C2V B;  4ZN4 A;  4K3J B;  2H9N A;  4J78 A;  1A0R B;  5C2W B;  3JRO A;  2GNQ A;  5CYK A;  3UKR C;  2YNO A;  3EI2 A;  4CY1 A;  5I5J A;  4XEI C;  5FKS A;  4JD2 C;  5K1C C;  2B5N A;  3K27 A;  1JOF A;  5FQD A;  4CY5 A;  4BUJ C;  4I79 A;  4G56 B;  3NVN A;  4J79 A;  1TBG A;  3NVX A;  3MKS B;  3ODT A;  4NSX A;  4JSX C;  3C5M A;  2YBA A;  5A2Q g;  3P4F A;  4L1Q D;  3KRW B;  4A09 B;  4Z8L A;  5H1M A;  3N0D A;  1JMZ B;  4ZOY A;  4GMB A;  2P9P C;  4JT5 C;  4A08 A;  4FWW A;  1MDA H;  4J86 A;  3VH0 A;  2IUR A;  4J8B A;  4QL1 A;  4IA9 A;  2P9I C;  4K3I D;  4X3E A;  3W15 A;  5EMJ B;  4O3T B;  5B4W A;  2PM9 B;  5JWZ A;  2HES X;  3MMY A;  3J80 g;  4Y7R A;  5IT9 g;  3SHF A;  4H5J A;  1SQ9 A;  1YFQ A;  2QXV A;  3JZN A;  4LGN A;  5HQG A;  4GGC A;  2G99 A;  3MKQ A;  5HE3 B;  4E54 A;  4CZX A;  2H47 A;  2UZX B;  3RSE C;  3UVK A;  4L3H D;  5EAL A;  4PNK B;  3JRP A;  3RLM D;  3I8C A;  2H68 A;  4Y5R D;  1R5M A; 
#chains in the Genus database with same CATH topology
 5SXM A;  2XE4 A;  3EQ9 A;  1K32 A;  3I7H A;  3UVO A;  1Q47 A;  4FB1 D;  5GMK n;  4A11 B;  2W18 A;  3PXW D;  4UM8 A;  2J57 G;  2Z2P A;  2XYI A;  5I5I A;  5M5U A;  1I2M B;  2IUQ A;  2VDN A;  4HDJ A;  3UVL A;  1N6D A;  3V4P A;  3V7D B;  2JKX A;  4TZ4 A;  2IUV A;  3SXT D;  3IJ0 A;  4J87 A;  3FRX A;  2EIB A;  3T3M A;  1PBY B;  3MUN A;  3OKY A;  4GM8 A;  1MG3 A;  4LG8 A;  4ERZ A;  2GC7 A;  1GOF A;  5FKT A;  3L4M D;  4QQE A;  5EML B;  2OJY A;  4NAA A;  1A12 A;  3GC3 B;  4CC9 A;  1JV2 A;  3GRE A;  1GOT B;  4E5Z A;  5FA5 B;  4DNW A;  3K6S A;  5KDO B;  4XYI A;  2PM6 B;  1VZ3 A;  1E5T A;  4FA9 D;  3FCU A;  2H9M A;  3AL8 A;  3ZWL B;  4Z7Q A;  1BPO A;  4JT6 C;  4D9S A;  3FCS A;  3ZDZ A;  4ESG A;  4ZOV A;  2AH1 A;  2QR5 A;  5FLX g;  3I8E A;  1H2Y A;  3I7N A;  3OL2 A;  2B5L A;  3RN1 D;  3PE7 A;  4G1M A;  3C75 H;  2VZ3 A;  4J0X A;  2PBI B;  1U2V C;  3RFG A;  1JTD B;  4J0W A;  3I7O A;  1B9Y A;  1H2W A;  4ZOZ A;  5AMS A;  2VDP A;  2G9A A;  2O9K A;  3BWS A;  4D6V A;  5M5S A;  2UZY B;  3JZH A;  3ZE2 A;  2IAA A;  5E6S A;  3VI4 A;  2P9U C;  4JSN C;  4QRJ A;  2XDW A;  3EI4 B;  5C9Z B;  3C99 A;  4PBY A;  3SN6 B;  4O9D A;  4A09 A;  1MG2 A;  5HE2 B;  2BBK H;  1QNI A;  2HJ4 A;  3V5W B;  2J55 H;  1K3I A;  4PBZ A;  5IGQ A;  4AN0 A;  4FHL A;  3DXK C;  4A0A B;  1XIP A;  3EQ7 A;  3JPX A;  1K8K C;  4O02 A;  4O45 A;  4CI1 A;  4FAN D;  3V9F A;  1GP2 B;  4CI3 A;  3F3F A;  4RE5 A;  4X63 B;  5IJ8 E;  5EAP A;  3NVQ A;  2H13 A;  3HFQ A;  5K19 A;  3V4V A;  4BCB A;  2P9S C;  3OKW A;  4CI2 A;  3RMZ D;  1JJU B;  2PM9 A;  4GQB B;  3SWS D;  2HJB A;  4A08 B;  2XL2 A;  2Q7Q A;  3PXT D;  5C86 A;  1NEX B;  2OVR B;  4X61 B;  5C92 A;  2XU7 A;  3SLE D;  4J81 A;  3NIF A;  3O4H A;  3IKO A;  3I7K A;  2CN2 A;  3NIG A;  3B7F A;  5CXB A;  1M1X A;  2P9L C;  3JZG A;  1O6F A;  1TYE A;  2VC2 A;  4QAM A;  3SFZ A;  3KRX B;  3ULE C;  5TF2 A;  2GC4 A;  2VDQ A;  3NID A;  3T3P A;  1ERJ A;  4J84 A;  1PEV A;  3ORV D;  4OWR A;  1L0Q A;  2QC5 A;  1H2X A;  2H6K A;  4A0B B;  4N14 A;  4PSX B;  2I0S A;  2AH0 A;  3IJC A;  2I0T A;  2VDM A;  4PXW A;  5FKR A;  5EM2 A;  3I7L A;  2CN3 A;  1XKS A;  2TRC B;  5CXC B;  5TEF A;  2OIZ A;  2QZP A;  3OTT A;  1SQJ A;  1N6E A;  4ES0 A;  3EI1 B;  3IUM A;  3EI3 B;  3VGZ A;  2EIE A;  3IUN A;  2OVQ B;  3KCI A;  4YVD A;  3K72 A;  3PXS D;  2HKM A;  2CO0 C;  3SBR A;  5EMM B;  3SCY A;  3JB9 L;  1GXR A;  1XHM A;  4H5I A;  3UVN A;  2B5M A;  3IJ1 A;  2BKL A;  3SMR A;  2VDK A;  2AGY A;  3IIW A;  4O3U B;  1B9X A;  3SJL D;  1S4U X;  4J8G A;  4U1E I;  4AOW A;  4U7A A;  2HU5 A;  4FAV D;  3BG1 A;  1UOO A;  2H6N A;  4GGD A;  3IUQ A;  5EAM A;  4G55 A;  4J73 A;  4WK4 A;  4Z7N A;  4JSP C;  2IWK A;  4A2M A;  2YNN A;  2MTA H;  2P9K C;  2BCJ B;  2H14 A;  4QT8 A;  1FWX A;  4XYH A;  2EIC A;  3IUJ A;  5M5V A;  3VA6 A;  2HU7 A;  4BP8 A;  3AL8 B;  3N0E A;  4KFM B;  3JAM g;  3MUO A;  2AGZ A;  3EQ8 A;  4CY2 A;  5E6U A;  1PGU A;  4PC0 A;  4J82 A;  1E8M A;  5I5M A;  1PI6 A;  2H6Q A;  3O4I A;  5THA A;  2VDR A;  1UOP A;  4AEZ A;  1RI6 A;  3MXX A;  3EMH A;  4L3G D;  1VYH C;  4GQ1 A;  5M5R A;  2YB8 B;  3MZL A;  5H17 A;  2J56 H;  3SVW D;  5CYK B;  5E6R A;  4DNU A;  2AGX A;  4MK0 B;  4J77 A;  3EI2 B;  3EI4 A;  4UI9 R;  3CFS B;  4JHP C;  4Z7O A;  3ZDX A;  2H9P A;  2VDL A;  5GXI A;  1OLZ A;  2CNX A;  4RE6 A;  3A0F A;  4AMY A;  3CFV A;  4L9O A;  3ZDY A;  4NC4 A;  4FA4 D;  4A0A A;  4OZU A;  3IUR A;  3DSM A;  3AH8 B;  5FFG A;  4GM9 A;  3BG0 A;  4BH6 A;  2I0R A;  5IJ7 E;  3PSC B;  4L1M A;  3F3G A;  4AMZ A;  5H14 A;  4MMX A;  1O6G A;  4AN1 A;  4ERQ A;  1YR2 A;  4CI8 A;  2AGW A;  5IGO A;  5HDB A;  5M61 A;  1C9L A;  1TYQ C;  2I3S A;  3DXM C;  2XL3 A;  5EMK B;  3UVM A;  1GOG A;  3PSL A;  4ERY A;  4X60 B;  2WQ8 A;  5HE0 B;  4IMM A;  2IUP A;  3CIK B;  3L4O D;  5TEE A;  1U4C A;  2HKR A;  4GGA A;  1L5G A;  2YNP A;  3IJE A;  3RN0 D;  1JMX B;  3QI0 A;  4MMY A;  4D0K A;  2Z2N A;  4UM9 A;  3PVW B;  3U4Y A;  1E8N A;  3IVM A;  2I3T A;  3EU7 A;  2HU8 A;  4A7J A;  4A11 A;  5FKQ A;  4E54 B;  3RRM C;  4LG9 A;  2HYE A;  4O2W A;  5AJA A;  4R7A B;  4FA5 D;  3SBP A;  5AFU 3;  4A0B A;  1VE7 A;  5CXB B;  1N6F A;  2CO0 A;  3EWE A;  5CXC A;  3MVD K;  1GG2 B;  3IIY A;  2B4E A;  3RFH A;  3VI3 A;  3EI1 A;  3EI3 A;  3AFC A;  2OK6 A;  1GOH A;  3DDU A;  4CY3 A;  3DM0 A;  3MZK A;  2AGL A;  2VDO A;  2YMU A;  4JXM A;  4AX4 A;  3FM0 A;  2H3X A;  4O1Q D;  3OW8 A;  4A2L A;  5EM2 B;  4PSW B;  3I7P A;  3E0C A;  4ZOX A;  3UKU C;  4EWR A;  5HYN B;  2OVP B;  3OKY B;  2CE8 A;  3I2N A;  3AL9 A;  5TDH B;  4JHN A;  3O4G A;  1NR0 A;  2H9L A;  5HE1 B;  4GZ8 A;  2Z2O A;  3EG6 A;  1OMW B;  4CZY A;  4FA1 D;  4E5Z B;  3PVU B;  4BP9 A;  1SHY B;  5GSA A;  2CE9 A;  5GXH A;  3J81 g;  1P22 A;  5M5T A;  2IWF A;  3C9C A;  2EBS A;  3I89 A;  4NEN A;  1QFS A;  2OK4 A;  5FXY A;  1UOQ A;  4GM3 A;  2HXC A;  4JSV C;  3F3P A;  3OF7 A;  3SBQ A;  3GD1 I;  3O4J A;  5EAR A;  3QHY B;  4BCD A;  3DWL C;  2P9N C;  3K26 A;  4GQ2 P;  4CZV A;  2AQ5 A;  3OL2 B;  5IC7 A;  4BL0 A;  3FGB A;  1UTC A;  3UR4 A;  3GFC A;  3OKT A;  2PM7 B;  5C2V B;  4ZN4 A;  4K3J B;  3K71 A;  4DNV A;  3ZE0 A;  2H9N A;  4J78 A;  1A0R B;  4WK0 A;  3JRO A;  2GNQ A;  5CYK A;  3UKR C;  2YNO A;  5C2W B;  5FFO A;  4CY1 A;  3EI2 A;  5I5J A;  4XEI C;  5FKS A;  4JD2 C;  5K1C C;  2B5N A;  4BCC A;  3K27 A;  1JOF A;  1VE6 A;  5FQD A;  4CY5 A;  4BUJ C;  4I79 A;  4G56 B;  1H2Z A;  3NVN A;  4J79 A;  1TBG A;  3NVX A;  3MKS B;  3ODT A;  4NSX A;  4JSX C;  3C5M A;  2YBA A;  5A2Q g;  3P4F A;  4L1Q D;  4MMZ A;  3KRW B;  4A09 B;  4Z8L A;  5H1M A;  3N0D A;  3ZE1 A;  1JMZ B;  4ZOY A;  4GMB A;  2P9P C;  4JT5 C;  4A08 A;  1QFM A;  4FWW A;  1MDA H;  4J86 A;  2VZ1 A;  3VH0 A;  2IUR A;  4G1E A;  4J8B A;  4NBM A;  4IA9 A;  4QL1 A;  2P9I C;  4K3I D;  1C9I A;  4X3E A;  1U8C A;  1VZ2 A;  3W15 A;  5EMJ B;  2XZG A;  1T2X A;  4O3T B;  5B4W A;  2PM9 B;  5JWZ A;  2HES X;  3MMY A;  3J80 g;  4Y7R A;  5IT9 g;  3IUL A;  4IRZ A;  3SHF A;  1SQ9 A;  1YFQ A;  2QXV A;  4H5J A;  3JZN A;  4LGN A;  5HQG A;  2EID A;  4GGC A;  2G99 A;  3MKQ A;  4WJK A;  5HE3 B;  4E54 A;  4CZX A;  2H47 A;  2UZX B;  4WK2 A;  3RSE C;  3UVK A;  4L3H D;  5EAL A;  4PNK B;  3JRP A;  3RLM D;  3I8C A;  2H68 A;  4Y5R D;  1R5M A; 
#chains in the Genus database with same CATH homology
 5SXM A;  3UVO A;  1K32 A;  3I7H A;  1Q47 A;  4FB1 D;  5GMK n;  4A11 B;  2W18 A;  3PXW D;  2J57 G;  2Z2P A;  2XYI A;  5I5I A;  2IUQ A;  4HDJ A;  3UVL A;  3V7D B;  1N6D A;  4TZ4 A;  2IUV A;  3SXT D;  3IJ0 A;  4J87 A;  3FRX A;  1PBY B;  3OKY A;  4GM8 A;  1MG3 A;  4LG8 A;  4ERZ A;  2GC7 A;  5FKT A;  3L4M D;  4QQE A;  5EML B;  2OJY A;  4CC9 A;  1GOT B;  3GRE A;  4E5Z A;  5FA5 B;  5KDO B;  4XYI A;  2PM6 B;  4FA9 D;  2H9M A;  3AL8 A;  3ZWL B;  4JT6 C;  4ESG A;  4ZOV A;  2AH1 A;  5FLX g;  3I8E A;  3I7N A;  3OL2 A;  2B5L A;  3RN1 D;  3PE7 A;  3C75 H;  4J0X A;  2PBI B;  1U2V C;  3RFG A;  4J0W A;  3I7O A;  1B9Y A;  4ZOZ A;  5AMS A;  2G9A A;  2O9K A;  3BWS A;  4D6V A;  2UZY B;  3JZH A;  2IAA A;  2P9U C;  4JSN C;  4QRJ A;  5C9Z B;  3EI4 B;  3C99 A;  4PBY A;  3SN6 B;  4O9D A;  4A09 A;  1MG2 A;  5HE2 B;  2BBK H;  1QNI A;  2HJ4 A;  3V5W B;  2J55 H;  4PBZ A;  5IGQ A;  4FHL A;  3DXK C;  4A0A B;  1XIP A;  3JPX A;  1K8K C;  4O45 A;  4CI1 A;  4FAN D;  3V9F A;  1GP2 B;  4CI3 A;  3F3F A;  4X63 B;  5IJ8 E;  5K19 A;  5EAP A;  3NVQ A;  3HFQ A;  2H13 A;  2P9S C;  3OKW A;  4CI2 A;  3RMZ D;  1JJU B;  2PM9 A;  4GQB B;  3SWS D;  2HJB A;  4A08 B;  2XL2 A;  2Q7Q A;  3PXT D;  1NEX B;  2OVR B;  4X61 B;  2XU7 A;  3SLE D;  4J81 A;  3IKO A;  3I7K A;  2CN2 A;  3B7F A;  5CXB A;  2P9L C;  3JZG A;  3SFZ A;  3KRX B;  3ULE C;  5TF2 A;  2GC4 A;  1ERJ A;  4J84 A;  1PEV A;  3ORV D;  4OWR A;  1L0Q A;  2QC5 A;  2H6K A;  4A0B B;  4N14 A;  4PSX B;  2I0S A;  2AH0 A;  3IJC A;  2I0T A;  4PXW A;  5FKR A;  5EM2 A;  3I7L A;  2CN3 A;  1XKS A;  2TRC B;  5CXC B;  5TEF A;  2OIZ A;  3OTT A;  1SQJ A;  1N6E A;  4ES0 A;  3EI1 B;  3EI3 B;  3VGZ A;  2OVQ B;  4YVD A;  3PXS D;  2HKM A;  2CO0 C;  3SBR A;  5EMM B;  3SCY A;  3JB9 L;  1GXR A;  1XHM A;  4H5I A;  3UVN A;  2B5M A;  3IJ1 A;  3SMR A;  2AGY A;  3IIW A;  4O3U B;  1B9X A;  3SJL D;  1S4U X;  4J8G A;  4U1E I;  4AOW A;  4U7A A;  4FAV D;  3BG1 A;  2H6N A;  4GGD A;  5EAM A;  4J73 A;  4JSP C;  2IWK A;  4A2M A;  2YNN A;  2MTA H;  2P9K C;  2BCJ B;  2H14 A;  4QT8 A;  1FWX A;  4XYH A;  3VA6 A;  3AL8 B;  3N0E A;  4KFM B;  3JAM g;  2AGZ A;  4CY2 A;  1PGU A;  4PC0 A;  4J82 A;  5I5M A;  1PI6 A;  2H6Q A;  5THA A;  4AEZ A;  1RI6 A;  3MXX A;  3EMH A;  4L3G D;  1VYH C;  4GQ1 A;  2YB8 B;  3MZL A;  5H17 A;  2J56 H;  3SVW D;  5CYK B;  2AGX A;  4MK0 B;  4J77 A;  3EI2 B;  3EI4 A;  4UI9 R;  3CFS B;  2H9P A;  5GXI A;  1OLZ A;  2CNX A;  3A0F A;  3CFV A;  4L9O A;  4FA4 D;  4A0A A;  4OZU A;  3DSM A;  3AH8 B;  4GM9 A;  3BG0 A;  4BH6 A;  2I0R A;  5IJ7 E;  3PSC B;  3F3G A;  5H14 A;  4ERQ A;  4CI8 A;  2AGW A;  5IGO A;  1TYQ C;  2I3S A;  3DXM C;  2XL3 A;  5EMK B;  3UVM A;  3PSL A;  4ERY A;  4X60 B;  5HE0 B;  4IMM A;  2IUP A;  3CIK B;  3L4O D;  5TEE A;  1U4C A;  2HKR A;  4GGA A;  2YNP A;  3RN0 D;  1JMX B;  4D0K A;  2Z2N A;  3PVW B;  3U4Y A;  2I3T A;  3EU7 A;  4A7J A;  4A11 A;  5FKQ A;  4E54 B;  3RRM C;  4LG9 A;  2HYE A;  5AJA A;  4R7A B;  4FA5 D;  3SBP A;  5AFU 3;  4A0B A;  5CXB B;  1N6F A;  2CO0 A;  3EWE A;  5CXC A;  1GG2 B;  3IIY A;  2B4E A;  3RFH A;  3EI1 A;  3EI3 A;  3AFC A;  2OK6 A;  4CY3 A;  3DM0 A;  3MZK A;  2AGL A;  2YMU A;  4JXM A;  3FM0 A;  2H3X A;  4O1Q D;  3OW8 A;  4A2L A;  5EM2 B;  4PSW B;  3I7P A;  3E0C A;  4ZOX A;  3UKU C;  4EWR A;  5HYN B;  2OVP B;  3OKY B;  2CE8 A;  3I2N A;  3AL9 A;  5TDH B;  1NR0 A;  2H9L A;  5HE1 B;  4GZ8 A;  2Z2O A;  3EG6 A;  1OMW B;  4CZY A;  4FA1 D;  4E5Z B;  3PVU B;  1SHY B;  5GSA A;  2CE9 A;  5GXH A;  3J81 g;  1P22 A;  2IWF A;  3C9C A;  2EBS A;  3I89 A;  2OK4 A;  5FXY A;  4GM3 A;  2HXC A;  4JSV C;  3F3P A;  3SBQ A;  5EAR A;  3DWL C;  2P9N C;  3K26 A;  4GQ2 P;  4CZV A;  2AQ5 A;  3OL2 B;  5IC7 A;  4BL0 A;  3FGB A;  3UR4 A;  3GFC A;  3OKT A;  2PM7 B;  5C2V B;  4ZN4 A;  4K3J B;  2H9N A;  4J78 A;  1A0R B;  5C2W B;  3JRO A;  2GNQ A;  5CYK A;  3UKR C;  2YNO A;  3EI2 A;  4CY1 A;  5I5J A;  4XEI C;  5FKS A;  4JD2 C;  5K1C C;  2B5N A;  3K27 A;  1JOF A;  5FQD A;  4CY5 A;  4BUJ C;  4I79 A;  4G56 B;  3NVN A;  4J79 A;  1TBG A;  3NVX A;  3MKS B;  3ODT A;  4NSX A;  4JSX C;  3C5M A;  2YBA A;  5A2Q g;  3P4F A;  4L1Q D;  3KRW B;  4A09 B;  4Z8L A;  5H1M A;  3N0D A;  1JMZ B;  4ZOY A;  4GMB A;  2P9P C;  4JT5 C;  4A08 A;  4FWW A;  1MDA H;  4J86 A;  3VH0 A;  2IUR A;  4J8B A;  4QL1 A;  4IA9 A;  2P9I C;  4K3I D;  4X3E A;  3W15 A;  5EMJ B;  4O3T B;  5B4W A;  2PM9 B;  5JWZ A;  2HES X;  3MMY A;  3J80 g;  4Y7R A;  5IT9 g;  3SHF A;  4H5J A;  1SQ9 A;  1YFQ A;  2QXV A;  3JZN A;  4LGN A;  5HQG A;  4GGC A;  2G99 A;  3MKQ A;  5HE3 B;  4E54 A;  4CZX A;  2H47 A;  2UZX B;  3RSE C;  3UVK A;  4L3H D;  5EAL A;  4PNK B;  3JRP A;  3RLM D;  3I8C A;  2H68 A;  4Y5R D;  1R5M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...