4CY1A

Crystal structure of the kansl1-wdr5 complex.
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
304
structure length
303
Chain Sequence
VKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WD REPEAT-CONTAINING PROTEIN 5
publication title Structural Analysis of the Kansl1/Wdr5/Kansl2 Complex Reveals that Wdr5 is Required for Efficient Assembly and Chromatin Targeting of the Nsl Complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 101
structure length 303
sequence length 304
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4cy1A00
2B5LA 4AOWA 4X60B 2CN3A 4CY2A 2H9LA 2IURA 4ZOZA 4GQ1A 4QQEA 5CYKA 1GG2B 3JRPA 4Y7RA 2YNOA 2HXCA 4AEZA 3KRXB 2H6KA 4GM8A 3RN0D 3SWSD 4GQBB 2OVPB 4HDJA 3MKQA 4A08A 3PSLA 3OKYB 2OK6A 3JPXA 5FA5B 4ZOXA 4U1EI 3A0FA 5IC7A 2BCJB 2IWFA 1JMXB 2YNPA 4O45A 3BG0A 3I7OA 4PSWB 4CI1A 4K3JB 3N0EA 5H14A 2TRCB 1P22A 2CO0C 5HE1B 4ES0A 1N6EA 5EM2B 5EARA 5I5JA 2P9SC 4CZYA 2GC4A 4GZ8A 3I8EA 3AL8B 3JZHA 1SQ9A 4L3GD 4ERQA 2EBSA 2P9LC 3B7FA 3EI4A 4IA9A 5EAPA 5I5IA 2O9KA 1GP2B 5GMKn 4E54A 4U7AA 4I79A 2PM9A 3EG6A 3I7NA 3DM0A 4CZXA 4BL0A 4A0BA 3BWSA 2CE8A 1N6FA 4IMMA 3PXSD 3SJLD 1XIPA 2XL2A 1SQJA 3KRWB 5CXBB 2HKMA 3UR4A 3UKRC 3OKTA 2HJBA 3EI1B 4QL1A 2Z2PA 3GREA 2B5NA 2I0TA 4CI2A 4A09A 4J82A 3V5WB 2H9NA 4FAVD 3U4YA 4PBYA 2OK4A 2IUPA 3AL9A 5C2WB 5AFU3 3PSCB 1PI6A 5THAA 4CY5A 4J79A 4ERZA 5C9ZB 3DSMA 4OZUA 3JZGA 5B4WA 4J73A 5H17A 2YMUA 4BUJC 4MK0B 5FKSA 1TBGA 3V9FA 4FWWA 5HE2B 3PVWB 4JSNC 5KDOB 5IJ8E 4FA4D 3MZLA 2IAAA 3EI3A 2IUVA 1JJUB 1GOTB 2H14A 4FHLA 3IJ0A 4Y5RD 2PBIB 4CY1A 4JT6C 1A0RB 2G99A 4NSXA 4JSVC 3AFCA 4FAND 2OVRB 4GGCA 3OL2B 1MDAH 2CO0A 4L3HD 4PBZA 3OW8A 2H9PA 5H1MA 4LGNA 2P9NC 4FA5D 3RSEC 1RI6A 2Z2NA 4Z8LA 5K1CC 3DXKC 5EMLB 3RMZD 2P9UC 2HKRA 1TYQC 2HJ4A 3C99A 4O3UB 3RRMC 3C5MA 1PEVA 3UVMA 3SVWD 4J81A 3JB9L 2PM7B 2I3SA 4ZN4A 2B5MA 2I0SA 5CYKB 4J8BA 5JWZA 4EWRA 3RN1D 3JZNA 3CFVA 4D6VA 4CC9A 3MMYA 4J0WA 3UVOA 4GQ2P 3F3FA 2YNNA 4R7AB 1JOFA 2QXVA 2XU7A 3AL8A 3PE7A 2H3XA 3L4MD 1JMZB 1YFQA 3JROA 4A08B 4J0XA 2GC7A 3FM0A 2H13A 3JAMg 4E5ZA 2AGWA 2MTAH 2H47A 1U2VC 3F3GA 5EALA 5HE3B 4K3ID 4O1QD 2XL3A 3EU7A 4J87A 4FB1D 3SCYA 1OMWB 3FRXA 4QT8A 4FA9D 5HYNB 2HYEA 3CFSB 4A11A 4OWRA 2BBKH 3I2NA 1NR0A 3DWLC 2AGZA 4A0AA 3I89A 2CN2A 3J80g 2J57G 4ZOVA 5CXBA 1QNIA 3K27A 3SBRA 4XYHA 4J77A 3EI4B 4ERYA 5AMSA 2GNQA 4LG8A 3IIYA 4GM9A 3UVLA 3C75H 1XHMA 4TZ4A 1NEXB 3GFCA 3ULEC 3PXTD 4E54B 4GMBA 4JSPC 2PM9B 3SFZA 3VGZA 4L9OA 5TF2A 3SBPA 2H6NA 3C9CA 2J55H 3SLED 1Q47A 2I3TA 5FQDA 4J78A 1U4CA 2P9PC 5SXMA 2AH1A 3SXTD 3VA6A 1OLZA 3I8CA 3EI2B 3NVQA 5FKQA 4A7JA 4H5JA 2W18A 4X63B 5IT9g 3K26A 4X61B 5GXIA 2OVQB 3MXXA 2CNXA 4PSXB 3NVNA 4ESGA 3W15A 1R5MA 2H9MA 4L1QD 3OTTA 5CXCB 3IKOA 3I7LA 4N14A 5HE0B 3N0DA 2Z2OA 5GXHA 4PXWA 2UZYB 3MKSB 4BH6A 4XEIC 2OIZA 3OKWA 3UVNA 4J84A 3OKYA 1L0QA 1VYHC 3EI3B 3DXMC 3F3PA 3VH0A 1K32A 5FKRA 3UKUC 4O9DA 5IGQA 3ORVD 3I7HA 2AGLA 5EAMA 4CI8A 2B4EA 1S4UX 5EM2A 2YBAA 4X3EA 4FA1D 4D0KA 4JSXC 4LG9A 4G56B 2XYIA 3I7PA 3FGBA 3ZWLB 3I7KA 3RLMD 2AH0A 1ERJA 1MG3A 3J81g 1PGUA 5A2Qg 5FXYA 2I0RA 3EWEA 2H6QA 1B9YA 5TDHB 1B9XA 5EMMB 2Q7QA 1PBYB 5HQGA 3UVKA 4XYIA 3NVXA 4JXMA 4JT5C 5TEEA 3V7DB 4PNKB 4GM3A 1K8KC 4J86A 2P9KC 3P4FA 5AJAA 5FLXg 4E5ZB 4JD2C 2H68A 4UI9R 5EMKB 3HFQA 3EI1A 5TEFA 4GGAA 3L4OD 3CIKB 3AH8B 3RFHA 5I5MA 3SMRA 4A11B 3PVUB 4A0BB 2G9AA 4J8GA 1GXRA 4A0AB 3E0CA 5IGOA 3SN6B 4CI3A 3BG1A 5C2VB 3SBQA 1SHYB 2IWKA 4QRJA 2CE9A 4O3TB 1N6DA 2HESX 3EI2A 5K19A 3IJCA 4CZVA 2OJYA 1MG2A 2QC5A 5IJ7E 4A09B 4GGDA 2YB8B 4ZOYA 1XKSA 2J56H 3EMHA 3RFGA 4H5IA 2AQ5A 3PXWD 3SHFA 3ODTA 2P9IC 4CY3A 2IUQA 5CXCA 2AGXA 2AGYA 1FWXA 4KFMB 5FKTA 5EMJB 3OL2A 2UZXB 3IJ1A 3IIWA 5GSAA 4PC0A 3MZKA 4YVDA 2PM6B 4A2MA 4A2LA
chains in the Genus database with same CATH superfamily
2B5LA 4AOWA 4X60B 2BKLA 2CN3A 4WK0A 4CY2A 2H9LA 2IURA 4ZOZA 4GQ1A 4QQEA 5CYKA 1GG2B 3JRPA 4Y7RA 2YNOA 2HXCA 3O4GA 4AEZA 2VC2A 3KRXB 2H6KA 4GM8A 3RN0D 3SWSD 1A12A 3O4IA 4IRZA 1VZ3A 4GQBB 2OVPB 4HDJA 3MKQA 4A08A 3PSLA 2XDWA 3OKYB 2OK6A 4AMZA 3JPXA 2VDRA 1VE7A 2VDOA 5FA5B 4MMZA 4ZOXA 4U1EI 3A0FA 3IULA 5IC7A 2BCJB 2IWFA 1JMXB 2YNPA 4O45A 3BG0A 3I7OA 3IJEA 1O6GA 4PSWB 4CI1A 4K3JB 3N0EA 5E6SA 5H14A 2TRCB 3EQ9A 5M5VA 1P22A 2CO0C 3NIGA 5HE1B 4ES0A 3IVMA 1N6EA 4RE5A 5EARA 4Z7QA 5EM2B 5I5JA 2P9SC 2EIDA 4CZYA 2GC4A 4GZ8A 4BP9A 3I8EA 3AL8B 3JZHA 1SQ9A 4L3GD 4ERQA 2EBSA 2P9LC 3B7FA 3EI4A 4JHPC 4IA9A 1GOGA 5EAPA 5I5IA 2O9KA 3MVDK 1GP2B 5GMKn 4E54A 4U7AA 4I79A 2PM9A 3EG6A 3I7NA 3DM0A 4CZXA 3ZDZA 4BL0A 4A0BA 3BWSA 2CE8A 2VDNA 1N6FA 4IMMA 3PXSD 3SJLD 1U8CA 1XIPA 2XL2A 2VDQA 1SQJA 3KRWB 5CXBB 2HKMA 3UR4A 3UKRC 3OKTA 2HJBA 1C9LA 2VZ3A 3IUNA 3K72A 4Z7NA 3MUNA 3EI1B 4QL1A 2Z2PA 3GREA 1E8NA 2B5NA 2I0TA 4CI2A 4J82A 3V5WB 4A09A 2H9NA 4FAVD 3U4YA 4PBYA 2OK4A 4WJKA 2IUPA 3AL9A 5C2WB 5AFU3 5E6RA 3PSCB 4UM8A 1PI6A 5THAA 4CY5A 4J79A 4ERZA 5C9ZB 3DSMA 4OZUA 3JZGA 1H2ZA 1T2XA 4J73A 5H17A 2YMUA 3QHYB 5B4WA 4BUJC 4MK0B 5FKSA 1TBGA 2QR5A 3V9FA 4FWWA 5HE2B 3PVWB 4D9SA 4JSNC 1K3IA 5KDOB 5IJ8E 4NBMA 4FA4D 1O6FA 3MZLA 2IAAA 4WK2A 3EI3A 2IUVA 1UOQA 3FCUA 1JJUB 1GOTB 2H14A 4FHLA 2WQ8A 3IJ0A 4Y5RD 1E8MA 2PBIB 4JT6C 4CY1A 3KCIA 1A0RB 4G55A 2G99A 4NSXA 1L5GA 5HDBA 3O4JA 4JSVC 3AFCA 4BCDA 4FAND 2VDMA 2HU8A 2OVRB 4GGCA 3V4VA 3OL2B 1MDAH 1YR2A 2CO0A 4L3HD 3OW8A 4PBZA 2H9PA 5H1MA 1QFSA 4LGNA 2P9NC 4FA5D 3RSEC 1RI6A 3ZE1A 2Z2NA 4O2WA 2EICA 4Z8LA 5K1CC 3DXKC 5EMLB 3RMZD 2P9UC 2HKRA 3C99A 1TYQC 2HJ4A 4O3UB 3RRMC 2EIEA 3C5MA 1PEVA 3UVMA 3SVWD 4J81A 1QFMA 3JB9L 2PM7B 2I3SA 4ZN4A 2B5MA 1I2MB 3EQ7A 2I0SA 5CYKB 4J8BA 5JWZA 3ZDYA 4EWRA 3RN1D 3JZNA 3CFVA 4D6VA 4CC9A 3MMYA 4J0WA 3UVOA 4GQ2P 3VI3A 3ZDXA 3F3FA 2YNNA 4R7AB 1H2XA 1JOFA 1JV2A 2QXVA 2XU7A 3AL8A 3PE7A 2H3XA 3L4MD 3JROA 1JMZB 1YFQA 4A08B 4J0XA 2GC7A 3FM0A 2H13A 2VDKA 3JAMg 4AMYA 4E5ZA 2AGWA 2MTAH 2H47A 1U2VC 4WK4A 3F3GA 5EALA 5HE3B 4K3ID 4O1QD 2XL3A 2XZGA 3EU7A 4J87A 4FB1D 3SCYA 1OMWB 3FRXA 4QT8A 4FA9D 5HYNB 2HYEA 3CFSB 3IUMA 4A11A 4Z7OA 4OWRA 3NIDA 2BBKH 3I2NA 1NR0A 3DWLC 4AN0A 1VE6A 3GC3B 2AGZA 4AN1A 4A0AA 3I89A 2CN2A 3J80g 2J57G 4ZOVA 5CXBA 1QNIA 3K27A 3SBRA 4XYHA 3OF7A 4J77A 3EI4B 4ERYA 5AMSA 2GNQA 4LG8A 3IIYA 4GM9A 3FCSA 3C75H 3UVLA 1XHMA 4TZ4A 1NEXB 3GFCA 3ULEC 3IUJA 3PXTD 4E54B 4GMBA 4JSPC 2PM9B 3SFZA 3VGZA 4L9OA 5TF2A 4MMXA 3SBPA 2QZPA 2H6NA 3C9CA 2J55H 3SLED 1Q47A 2I3TA 5FQDA 3O4HA 5C92A 4J78A 4RE6A 3T3MA 3ZE2A 1GOHA 1U4CA 2P9PC 5SXMA 2AH1A 3SXTD 5M5TA 3VA6A 1OLZA 3I8CA 1C9IA 5M5SA 3EI2B 5FFOA 5FFGA 3NVQA 5FKQA 4A7JA 2VDLA 4H5JA 2W18A 4X63B 5IT9g 3K26A 4X61B 5GXIA 2OVQB 3MXXA 2CNXA 4G1MA 1VZ2A 4PSXB 3NVNA 4ESGA 2JKXA 3W15A 1R5MA 3MUOA 2H9MA 4L1QD 4BCCA 1TYEA 3OTTA 1UTCA 5CXCB 3IKOA 3I7LA 4N14A 3NIFA 5HE0B 3N0DA 2Z2OA 2XE4A 5GXHA 1E5TA 4PXWA 2UZYB 4BCBA 3MKSB 4AX4A 4BH6A 4XEIC 2OIZA 3OKWA 4L1MA 4O02A 3UVNA 4J84A 3OKYA 1L0QA 1VYHC 3EI3B 3DXMC 3F3PA 3VH0A 2VDPA 1K32A 5FKRA 3UKUC 4O9DA 5IGQA 3ORVD 3K71A 3I7HA 2AGLA 5EAMA 1GOFA 4CI8A 2B4EA 3IURA 4DNVA 4DNWA 1S4UX 5EM2A 2YBAA 4NC4A 4X3EA 1H2YA 4FA1D 3EQ8A 4D0KA 4JSXC 3K6SA 2HU5A 4LG9A 3V4PA 3IUQA 4BP8A 4G56B 1H2WA 2XYIA 3I7PA 3DDUA 3FGBA 3ZWLB 3I7KA 4NAAA 3RLMD 2AH0A 1ERJA 4QAMA 1MG3A 3J81g 1PGUA 5A2Qg 5FXYA 2I0RA 1UOPA 3EWEA 2H6QA 5E6UA 5C86A 1B9YA 5TDHB 5M5UA 1B9XA 5EMMB 2Q7QA 1PBYB 5HQGA 3UVKA 4XYIA 3NVXA 4JXMA 4JT5C 4G1EA 3VI4A 5M61A 5TEEA 3V7DB 4PNKB 4GM3A 1K8KC 4J86A 2P9KC 3P4FA 5AJAA 5FLXg 4E5ZB 4JD2C 4MMYA 2H68A 4UI9R 5EMKB 3HFQA 1UOOA 3EI1A 5TEFA 4GGAA 3L4OD 3CIKB 3AH8B 3RFHA 5I5MA 3SMRA 4A11B 3PVUB 4A0BB 2G9AA 4J8GA 1GXRA 4A0AB 3E0CA 1BPOA 5IGOA 2EIBA 5M5RA 3SN6B 4CI3A 3BG1A 5C2VB 3SBQA 1SHYB 1M1XA 2IWKA 4QRJA 2CE9A 4O3TB 4DNUA 1N6DA 2HESX 3EI2A 5K19A 3T3PA 3IJCA 4CZVA 2OJYA 1MG2A 2QC5A 5IJ7E 4A09B 4GGDA 2YB8B 4ZOYA 2VZ1A 3QI0A 1XKSA 2J56H 3EMHA 3RFGA 1JTDB 2AQ5A 4H5IA 3PXWD 3SHFA 3ODTA 2P9IC 3ZE0A 2IUQA 3GD1I 4CY3A 5CXCA 2AGXA 2AGYA 4JHNA 1FWXA 4KFMB 5FKTA 5EMJB 4NENA 2HU7A 3OL2A 4UM9A 2UZXB 3IJ1A 3IIWA 5GSAA 4PC0A 3MZKA 4YVDA 2PM6B 4A2MA 4A2LA
chains in the Genus database with same CATH topology
2B5LA 4AOWA 4X60B 2CN3A 4CY2A 2H9LA 2IURA 4ZOZA 4GQ1A 4QQEA 5CYKA 1GG2B 3JRPA 4Y7RA 2YNOA 2HXCA 4AEZA 3KRXB 2H6KA 4GM8A 3RN0D 3SWSD 4GQBB 2OVPB 4HDJA 3MKQA 4A08A 3PSLA 3OKYB 2OK6A 3JPXA 5FA5B 4ZOXA 4U1EI 3A0FA 5IC7A 2BCJB 2IWFA 1JMXB 2YNPA 4O45A 3BG0A 3I7OA 4PSWB 4CI1A 4K3JB 3N0EA 5H14A 2TRCB 1P22A 2CO0C 5HE1B 4ES0A 1N6EA 5EM2B 5EARA 5I5JA 2P9SC 4CZYA 2GC4A 4GZ8A 3I8EA 3AL8B 3JZHA 1SQ9A 4L3GD 4ERQA 2EBSA 2P9LC 3B7FA 3EI4A 4IA9A 5EAPA 5I5IA 2O9KA 1GP2B 5GMKn 4E54A 4U7AA 4I79A 2PM9A 3EG6A 3I7NA 3DM0A 4CZXA 4BL0A 4A0BA 3BWSA 2CE8A 1N6FA 4IMMA 3PXSD 3SJLD 1XIPA 2XL2A 1SQJA 3KRWB 5CXBB 2HKMA 3UR4A 3UKRC 3OKTA 2HJBA 3EI1B 4QL1A 2Z2PA 3GREA 2B5NA 2I0TA 4CI2A 4A09A 4J82A 3V5WB 2H9NA 4FAVD 3U4YA 4PBYA 2OK4A 2IUPA 3AL9A 5C2WB 5AFU3 3PSCB 1PI6A 5THAA 4CY5A 4J79A 4ERZA 5C9ZB 3DSMA 4OZUA 3JZGA 5B4WA 4J73A 5H17A 2YMUA 4BUJC 4MK0B 5FKSA 1TBGA 3V9FA 4FWWA 5HE2B 3PVWB 4JSNC 5KDOB 5IJ8E 4FA4D 3MZLA 2IAAA 3EI3A 2IUVA 1JJUB 1GOTB 2H14A 4FHLA 3IJ0A 4Y5RD 2PBIB 4CY1A 4JT6C 1A0RB 2G99A 4NSXA 4JSVC 3AFCA 4FAND 2OVRB 4GGCA 3OL2B 1MDAH 2CO0A 4L3HD 4PBZA 3OW8A 2H9PA 5H1MA 4LGNA 2P9NC 4FA5D 3RSEC 1RI6A 2Z2NA 4Z8LA 5K1CC 3DXKC 5EMLB 3RMZD 2P9UC 2HKRA 1TYQC 2HJ4A 3C99A 4O3UB 3RRMC 3C5MA 1PEVA 3UVMA 3SVWD 4J81A 3JB9L 2PM7B 2I3SA 4ZN4A 2B5MA 2I0SA 5CYKB 4J8BA 5JWZA 4EWRA 3RN1D 3JZNA 3CFVA 4D6VA 4CC9A 3MMYA 4J0WA 3UVOA 4GQ2P 3F3FA 2YNNA 4R7AB 1JOFA 2QXVA 2XU7A 3AL8A 3PE7A 2H3XA 3L4MD 1JMZB 1YFQA 3JROA 4A08B 4J0XA 2GC7A 3FM0A 2H13A 3JAMg 4E5ZA 2AGWA 2MTAH 2H47A 1U2VC 3F3GA 5EALA 5HE3B 4K3ID 4O1QD 2XL3A 3EU7A 4J87A 4FB1D 3SCYA 1OMWB 3FRXA 4QT8A 4FA9D 5HYNB 2HYEA 3CFSB 4A11A 4OWRA 2BBKH 3I2NA 1NR0A 3DWLC 2AGZA 4A0AA 3I89A 2CN2A 3J80g 2J57G 4ZOVA 5CXBA 1QNIA 3K27A 3SBRA 4XYHA 4J77A 3EI4B 4ERYA 5AMSA 2GNQA 4LG8A 3IIYA 4GM9A 3UVLA 3C75H 1XHMA 4TZ4A 1NEXB 3GFCA 3ULEC 3PXTD 4E54B 4GMBA 4JSPC 2PM9B 3SFZA 3VGZA 4L9OA 5TF2A 3SBPA 2H6NA 3C9CA 2J55H 3SLED 1Q47A 2I3TA 5FQDA 4J78A 1U4CA 2P9PC 5SXMA 2AH1A 3SXTD 3VA6A 1OLZA 3I8CA 3EI2B 3NVQA 5FKQA 4A7JA 4H5JA 2W18A 4X63B 5IT9g 3K26A 4X61B 5GXIA 2OVQB 3MXXA 2CNXA 4PSXB 3NVNA 4ESGA 3W15A 1R5MA 2H9MA 4L1QD 3OTTA 5CXCB 3IKOA 3I7LA 4N14A 5HE0B 3N0DA 2Z2OA 5GXHA 4PXWA 2UZYB 3MKSB 4BH6A 4XEIC 2OIZA 3OKWA 3UVNA 4J84A 3OKYA 1L0QA 1VYHC 3EI3B 3DXMC 3F3PA 3VH0A 1K32A 5FKRA 3UKUC 4O9DA 5IGQA 3ORVD 3I7HA 2AGLA 5EAMA 4CI8A 2B4EA 1S4UX 5EM2A 2YBAA 4X3EA 4FA1D 4D0KA 4JSXC 4LG9A 4G56B 2XYIA 3I7PA 3FGBA 3ZWLB 3I7KA 3RLMD 2AH0A 1ERJA 1MG3A 3J81g 1PGUA 5A2Qg 5FXYA 2I0RA 3EWEA 2H6QA 1B9YA 5TDHB 1B9XA 5EMMB 2Q7QA 1PBYB 5HQGA 3UVKA 4XYIA 3NVXA 4JXMA 4JT5C 5TEEA 3V7DB 4PNKB 4GM3A 1K8KC 4J86A 2P9KC 3P4FA 5AJAA 5FLXg 4E5ZB 4JD2C 2H68A 4UI9R 5EMKB 3HFQA 3EI1A 5TEFA 4GGAA 3L4OD 3CIKB 3AH8B 3RFHA 5I5MA 3SMRA 4A11B 3PVUB 4A0BB 2G9AA 4J8GA 1GXRA 4A0AB 3E0CA 5IGOA 3SN6B 4CI3A 3BG1A 5C2VB 3SBQA 1SHYB 2IWKA 4QRJA 2CE9A 4O3TB 1N6DA 2HESX 3EI2A 5K19A 3IJCA 4CZVA 2OJYA 1MG2A 2QC5A 5IJ7E 4A09B 4GGDA 2YB8B 4ZOYA 1XKSA 2J56H 3EMHA 3RFGA 4H5IA 2AQ5A 3PXWD 3SHFA 3ODTA 2P9IC 4CY3A 2IUQA 5CXCA 2AGXA 2AGYA 1FWXA 4KFMB 5FKTA 5EMJB 3OL2A 2UZXB 3IJ1A 3IIWA 5GSAA 4PC0A 3MZKA 4YVDA 2PM6B 4A2MA 4A2LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B5L A;  4AOW A;  4X60 B;  2CN3 A;  4CY2 A;  2H9L A;  2IUR A;  4ZOZ A;  4GQ1 A;  4QQE A;  5CYK A;  1GG2 B;  3JRP A;  4Y7R A;  2YNO A;  2HXC A;  4AEZ A;  3KRX B;  2H6K A;  4GM8 A;  3RN0 D;  3SWS D;  4GQB B;  2OVP B;  4HDJ A;  3MKQ A;  4A08 A;  3PSL A;  3OKY B;  2OK6 A;  3JPX A;  5FA5 B;  4ZOX A;  4U1E I;  3A0F A;  5IC7 A;  2BCJ B;  2IWF A;  1JMX B;  2YNP A;  4O45 A;  3BG0 A;  3I7O A;  4PSW B;  4CI1 A;  4K3J B;  3N0E A;  5H14 A;  2TRC B;  1P22 A;  2CO0 C;  5HE1 B;  4ES0 A;  1N6E A;  5EM2 B;  5EAR A;  5I5J A;  2P9S C;  4CZY A;  2GC4 A;  4GZ8 A;  3I8E A;  3AL8 B;  3JZH A;  1SQ9 A;  4L3G D;  4ERQ A;  2EBS A;  2P9L C;  3B7F A;  3EI4 A;  4IA9 A;  5EAP A;  5I5I A;  2O9K A;  1GP2 B;  5GMK n;  4E54 A;  4U7A A;  4I79 A;  2PM9 A;  3EG6 A;  3I7N A;  3DM0 A;  4CZX A;  4BL0 A;  4A0B A;  3BWS A;  2CE8 A;  1N6F A;  4IMM A;  3PXS D;  3SJL D;  1XIP A;  2XL2 A;  1SQJ A;  3KRW B;  5CXB B;  2HKM A;  3UR4 A;  3UKR C;  3OKT A;  2HJB A;  3EI1 B;  4QL1 A;  2Z2P A;  3GRE A;  2B5N A;  2I0T A;  4CI2 A;  4A09 A;  4J82 A;  3V5W B;  2H9N A;  4FAV D;  3U4Y A;  4PBY A;  2OK4 A;  2IUP A;  3AL9 A;  5C2W B;  5AFU 3;  3PSC B;  1PI6 A;  5THA A;  4CY5 A;  4J79 A;  4ERZ A;  5C9Z B;  3DSM A;  4OZU A;  3JZG A;  5B4W A;  4J73 A;  5H17 A;  2YMU A;  4BUJ C;  4MK0 B;  5FKS A;  1TBG A;  3V9F A;  4FWW A;  5HE2 B;  3PVW B;  4JSN C;  5KDO B;  5IJ8 E;  4FA4 D;  3MZL A;  2IAA A;  3EI3 A;  2IUV A;  1JJU B;  1GOT B;  2H14 A;  4FHL A;  3IJ0 A;  4Y5R D;  2PBI B;  4CY1 A;  4JT6 C;  1A0R B;  2G99 A;  4NSX A;  4JSV C;  3AFC A;  4FAN D;  2OVR B;  4GGC A;  3OL2 B;  1MDA H;  2CO0 A;  4L3H D;  4PBZ A;  3OW8 A;  2H9P A;  5H1M A;  4LGN A;  2P9N C;  4FA5 D;  3RSE C;  1RI6 A;  2Z2N A;  4Z8L A;  5K1C C;  3DXK C;  5EML B;  3RMZ D;  2P9U C;  2HKR A;  1TYQ C;  2HJ4 A;  3C99 A;  4O3U B;  3RRM C;  3C5M A;  1PEV A;  3UVM A;  3SVW D;  4J81 A;  3JB9 L;  2PM7 B;  2I3S A;  4ZN4 A;  2B5M A;  2I0S A;  5CYK B;  4J8B A;  5JWZ A;  4EWR A;  3RN1 D;  3JZN A;  3CFV A;  4D6V A;  4CC9 A;  3MMY A;  4J0W A;  3UVO A;  4GQ2 P;  3F3F A;  2YNN A;  4R7A B;  1JOF A;  2QXV A;  2XU7 A;  3AL8 A;  3PE7 A;  2H3X A;  3L4M D;  1JMZ B;  1YFQ A;  3JRO A;  4A08 B;  4J0X A;  2GC7 A;  3FM0 A;  2H13 A;  3JAM g;  4E5Z A;  2AGW A;  2MTA H;  2H47 A;  1U2V C;  3F3G A;  5EAL A;  5HE3 B;  4K3I D;  4O1Q D;  2XL3 A;  3EU7 A;  4J87 A;  4FB1 D;  3SCY A;  1OMW B;  3FRX A;  4QT8 A;  4FA9 D;  5HYN B;  2HYE A;  3CFS B;  4A11 A;  4OWR A;  2BBK H;  3I2N A;  1NR0 A;  3DWL C;  2AGZ A;  4A0A A;  3I89 A;  2CN2 A;  3J80 g;  2J57 G;  4ZOV A;  5CXB A;  1QNI A;  3K27 A;  3SBR A;  4XYH A;  4J77 A;  3EI4 B;  4ERY A;  5AMS A;  2GNQ A;  4LG8 A;  3IIY A;  4GM9 A;  3UVL A;  3C75 H;  1XHM A;  4TZ4 A;  1NEX B;  3GFC A;  3ULE C;  3PXT D;  4E54 B;  4GMB A;  4JSP C;  2PM9 B;  3SFZ A;  3VGZ A;  4L9O A;  5TF2 A;  3SBP A;  2H6N A;  3C9C A;  2J55 H;  3SLE D;  1Q47 A;  2I3T A;  5FQD A;  4J78 A;  1U4C A;  2P9P C;  5SXM A;  2AH1 A;  3SXT D;  3VA6 A;  1OLZ A;  3I8C A;  3EI2 B;  3NVQ A;  5FKQ A;  4A7J A;  4H5J A;  2W18 A;  4X63 B;  5IT9 g;  3K26 A;  4X61 B;  5GXI A;  2OVQ B;  3MXX A;  2CNX A;  4PSX B;  3NVN A;  4ESG A;  3W15 A;  1R5M A;  2H9M A;  4L1Q D;  3OTT A;  5CXC B;  3IKO A;  3I7L A;  4N14 A;  5HE0 B;  3N0D A;  2Z2O A;  5GXH A;  4PXW A;  2UZY B;  3MKS B;  4BH6 A;  4XEI C;  2OIZ A;  3OKW A;  3UVN A;  4J84 A;  3OKY A;  1L0Q A;  1VYH C;  3EI3 B;  3DXM C;  3F3P A;  3VH0 A;  1K32 A;  5FKR A;  3UKU C;  4O9D A;  5IGQ A;  3ORV D;  3I7H A;  2AGL A;  5EAM A;  4CI8 A;  2B4E A;  1S4U X;  5EM2 A;  2YBA A;  4X3E A;  4FA1 D;  4D0K A;  4JSX C;  4LG9 A;  4G56 B;  2XYI A;  3I7P A;  3FGB A;  3ZWL B;  3I7K A;  3RLM D;  2AH0 A;  1ERJ A;  1MG3 A;  3J81 g;  1PGU A;  5A2Q g;  5FXY A;  2I0R A;  3EWE A;  2H6Q A;  1B9Y A;  5TDH B;  1B9X A;  5EMM B;  2Q7Q A;  1PBY B;  5HQG A;  3UVK A;  4XYI A;  3NVX A;  4JXM A;  4JT5 C;  5TEE A;  3V7D B;  4PNK B;  4GM3 A;  1K8K C;  4J86 A;  2P9K C;  3P4F A;  5AJA A;  5FLX g;  4E5Z B;  4JD2 C;  2H68 A;  4UI9 R;  5EMK B;  3HFQ A;  3EI1 A;  5TEF A;  4GGA A;  3L4O D;  3CIK B;  3AH8 B;  3RFH A;  5I5M A;  3SMR A;  4A11 B;  3PVU B;  4A0B B;  2G9A A;  4J8G A;  1GXR A;  4A0A B;  3E0C A;  5IGO A;  3SN6 B;  4CI3 A;  3BG1 A;  5C2V B;  3SBQ A;  1SHY B;  2IWK A;  4QRJ A;  2CE9 A;  4O3T B;  1N6D A;  2HES X;  3EI2 A;  5K19 A;  3IJC A;  4CZV A;  2OJY A;  1MG2 A;  2QC5 A;  5IJ7 E;  4A09 B;  4GGD A;  2YB8 B;  4ZOY A;  1XKS A;  2J56 H;  3EMH A;  3RFG A;  4H5I A;  2AQ5 A;  3PXW D;  3SHF A;  3ODT A;  2P9I C;  4CY3 A;  2IUQ A;  5CXC A;  2AGX A;  2AGY A;  1FWX A;  4KFM B;  5FKT A;  5EMJ B;  3OL2 A;  2UZX B;  3IJ1 A;  3IIW A;  5GSA A;  4PC0 A;  3MZK A;  4YVD A;  2PM6 B;  4A2M A;  4A2L A; 
#chains in the Genus database with same CATH topology
 2B5L A;  4AOW A;  4X60 B;  2BKL A;  2CN3 A;  4WK0 A;  4CY2 A;  2H9L A;  2IUR A;  4ZOZ A;  4GQ1 A;  4QQE A;  5CYK A;  1GG2 B;  3JRP A;  4Y7R A;  2YNO A;  2HXC A;  3O4G A;  4AEZ A;  2VC2 A;  3KRX B;  2H6K A;  4GM8 A;  3RN0 D;  3SWS D;  1A12 A;  3O4I A;  4IRZ A;  1VZ3 A;  4GQB B;  2OVP B;  4HDJ A;  3MKQ A;  4A08 A;  3PSL A;  2XDW A;  3OKY B;  2OK6 A;  4AMZ A;  3JPX A;  2VDR A;  1VE7 A;  2VDO A;  5FA5 B;  4MMZ A;  4ZOX A;  4U1E I;  3A0F A;  3IUL A;  5IC7 A;  2BCJ B;  2IWF A;  1JMX B;  2YNP A;  4O45 A;  3BG0 A;  3I7O A;  3IJE A;  1O6G A;  4PSW B;  4CI1 A;  4K3J B;  3N0E A;  5E6S A;  5H14 A;  2TRC B;  3EQ9 A;  5M5V A;  1P22 A;  2CO0 C;  3NIG A;  5HE1 B;  4ES0 A;  3IVM A;  1N6E A;  4RE5 A;  5EAR A;  4Z7Q A;  5EM2 B;  5I5J A;  2P9S C;  2EID A;  4CZY A;  2GC4 A;  4GZ8 A;  4BP9 A;  3I8E A;  3AL8 B;  3JZH A;  1SQ9 A;  4L3G D;  4ERQ A;  2EBS A;  2P9L C;  3B7F A;  3EI4 A;  4JHP C;  4IA9 A;  1GOG A;  5EAP A;  5I5I A;  2O9K A;  3MVD K;  1GP2 B;  5GMK n;  4E54 A;  4U7A A;  4I79 A;  2PM9 A;  3EG6 A;  3I7N A;  3DM0 A;  4CZX A;  3ZDZ A;  4BL0 A;  4A0B A;  3BWS A;  2CE8 A;  2VDN A;  1N6F A;  4IMM A;  3PXS D;  3SJL D;  1U8C A;  1XIP A;  2XL2 A;  2VDQ A;  1SQJ A;  3KRW B;  5CXB B;  2HKM A;  3UR4 A;  3UKR C;  3OKT A;  2HJB A;  1C9L A;  2VZ3 A;  3IUN A;  3K72 A;  4Z7N A;  3MUN A;  3EI1 B;  4QL1 A;  2Z2P A;  3GRE A;  1E8N A;  2B5N A;  2I0T A;  4CI2 A;  4J82 A;  3V5W B;  4A09 A;  2H9N A;  4FAV D;  3U4Y A;  4PBY A;  2OK4 A;  4WJK A;  2IUP A;  3AL9 A;  5C2W B;  5AFU 3;  5E6R A;  3PSC B;  4UM8 A;  1PI6 A;  5THA A;  4CY5 A;  4J79 A;  4ERZ A;  5C9Z B;  3DSM A;  4OZU A;  3JZG A;  1H2Z A;  1T2X A;  4J73 A;  5H17 A;  2YMU A;  3QHY B;  5B4W A;  4BUJ C;  4MK0 B;  5FKS A;  1TBG A;  2QR5 A;  3V9F A;  4FWW A;  5HE2 B;  3PVW B;  4D9S A;  4JSN C;  1K3I A;  5KDO B;  5IJ8 E;  4NBM A;  4FA4 D;  1O6F A;  3MZL A;  2IAA A;  4WK2 A;  3EI3 A;  2IUV A;  1UOQ A;  3FCU A;  1JJU B;  1GOT B;  2H14 A;  4FHL A;  2WQ8 A;  3IJ0 A;  4Y5R D;  1E8M A;  2PBI B;  4JT6 C;  4CY1 A;  3KCI A;  1A0R B;  4G55 A;  2G99 A;  4NSX A;  1L5G A;  5HDB A;  3O4J A;  4JSV C;  3AFC A;  4BCD A;  4FAN D;  2VDM A;  2HU8 A;  2OVR B;  4GGC A;  3V4V A;  3OL2 B;  1MDA H;  1YR2 A;  2CO0 A;  4L3H D;  3OW8 A;  4PBZ A;  2H9P A;  5H1M A;  1QFS A;  4LGN A;  2P9N C;  4FA5 D;  3RSE C;  1RI6 A;  3ZE1 A;  2Z2N A;  4O2W A;  2EIC A;  4Z8L A;  5K1C C;  3DXK C;  5EML B;  3RMZ D;  2P9U C;  2HKR A;  3C99 A;  1TYQ C;  2HJ4 A;  4O3U B;  3RRM C;  2EIE A;  3C5M A;  1PEV A;  3UVM A;  3SVW D;  4J81 A;  1QFM A;  3JB9 L;  2PM7 B;  2I3S A;  4ZN4 A;  2B5M A;  1I2M B;  3EQ7 A;  2I0S A;  5CYK B;  4J8B A;  5JWZ A;  3ZDY A;  4EWR A;  3RN1 D;  3JZN A;  3CFV A;  4D6V A;  4CC9 A;  3MMY A;  4J0W A;  3UVO A;  4GQ2 P;  3VI3 A;  3ZDX A;  3F3F A;  2YNN A;  4R7A B;  1H2X A;  1JOF A;  1JV2 A;  2QXV A;  2XU7 A;  3AL8 A;  3PE7 A;  2H3X A;  3L4M D;  3JRO A;  1JMZ B;  1YFQ A;  4A08 B;  4J0X A;  2GC7 A;  3FM0 A;  2H13 A;  2VDK A;  3JAM g;  4AMY A;  4E5Z A;  2AGW A;  2MTA H;  2H47 A;  1U2V C;  4WK4 A;  3F3G A;  5EAL A;  5HE3 B;  4K3I D;  4O1Q D;  2XL3 A;  2XZG A;  3EU7 A;  4J87 A;  4FB1 D;  3SCY A;  1OMW B;  3FRX A;  4QT8 A;  4FA9 D;  5HYN B;  2HYE A;  3CFS B;  3IUM A;  4A11 A;  4Z7O A;  4OWR A;  3NID A;  2BBK H;  3I2N A;  1NR0 A;  3DWL C;  4AN0 A;  1VE6 A;  3GC3 B;  2AGZ A;  4AN1 A;  4A0A A;  3I89 A;  2CN2 A;  3J80 g;  2J57 G;  4ZOV A;  5CXB A;  1QNI A;  3K27 A;  3SBR A;  4XYH A;  3OF7 A;  4J77 A;  3EI4 B;  4ERY A;  5AMS A;  2GNQ A;  4LG8 A;  3IIY A;  4GM9 A;  3FCS A;  3C75 H;  3UVL A;  1XHM A;  4TZ4 A;  1NEX B;  3GFC A;  3ULE C;  3IUJ A;  3PXT D;  4E54 B;  4GMB A;  4JSP C;  2PM9 B;  3SFZ A;  3VGZ A;  4L9O A;  5TF2 A;  4MMX A;  3SBP A;  2QZP A;  2H6N A;  3C9C A;  2J55 H;  3SLE D;  1Q47 A;  2I3T A;  5FQD A;  3O4H A;  5C92 A;  4J78 A;  4RE6 A;  3T3M A;  3ZE2 A;  1GOH A;  1U4C A;  2P9P C;  5SXM A;  2AH1 A;  3SXT D;  5M5T A;  3VA6 A;  1OLZ A;  3I8C A;  1C9I A;  5M5S A;  3EI2 B;  5FFO A;  5FFG A;  3NVQ A;  5FKQ A;  4A7J A;  2VDL A;  4H5J A;  2W18 A;  4X63 B;  5IT9 g;  3K26 A;  4X61 B;  5GXI A;  2OVQ B;  3MXX A;  2CNX A;  4G1M A;  1VZ2 A;  4PSX B;  3NVN A;  4ESG A;  2JKX A;  3W15 A;  1R5M A;  3MUO A;  2H9M A;  4L1Q D;  4BCC A;  1TYE A;  3OTT A;  1UTC A;  5CXC B;  3IKO A;  3I7L A;  4N14 A;  3NIF A;  5HE0 B;  3N0D A;  2Z2O A;  2XE4 A;  5GXH A;  1E5T A;  4PXW A;  2UZY B;  4BCB A;  3MKS B;  4AX4 A;  4BH6 A;  4XEI C;  2OIZ A;  3OKW A;  4L1M A;  4O02 A;  3UVN A;  4J84 A;  3OKY A;  1L0Q A;  1VYH C;  3EI3 B;  3DXM C;  3F3P A;  3VH0 A;  2VDP A;  1K32 A;  5FKR A;  3UKU C;  4O9D A;  5IGQ A;  3ORV D;  3K71 A;  3I7H A;  2AGL A;  5EAM A;  1GOF A;  4CI8 A;  2B4E A;  3IUR A;  4DNV A;  4DNW A;  1S4U X;  5EM2 A;  2YBA A;  4NC4 A;  4X3E A;  1H2Y A;  4FA1 D;  3EQ8 A;  4D0K A;  4JSX C;  3K6S A;  2HU5 A;  4LG9 A;  3V4P A;  3IUQ A;  4BP8 A;  4G56 B;  1H2W A;  2XYI A;  3I7P A;  3DDU A;  3FGB A;  3ZWL B;  3I7K A;  4NAA A;  3RLM D;  2AH0 A;  1ERJ A;  4QAM A;  1MG3 A;  3J81 g;  1PGU A;  5A2Q g;  5FXY A;  2I0R A;  1UOP A;  3EWE A;  2H6Q A;  5E6U A;  5C86 A;  1B9Y A;  5TDH B;  5M5U A;  1B9X A;  5EMM B;  2Q7Q A;  1PBY B;  5HQG A;  3UVK A;  4XYI A;  3NVX A;  4JXM A;  4JT5 C;  4G1E A;  3VI4 A;  5M61 A;  5TEE A;  3V7D B;  4PNK B;  4GM3 A;  1K8K C;  4J86 A;  2P9K C;  3P4F A;  5AJA A;  5FLX g;  4E5Z B;  4JD2 C;  4MMY A;  2H68 A;  4UI9 R;  5EMK B;  3HFQ A;  1UOO A;  3EI1 A;  5TEF A;  4GGA A;  3L4O D;  3CIK B;  3AH8 B;  3RFH A;  5I5M A;  3SMR A;  4A11 B;  3PVU B;  4A0B B;  2G9A A;  4J8G A;  1GXR A;  4A0A B;  3E0C A;  1BPO A;  5IGO A;  2EIB A;  5M5R A;  3SN6 B;  4CI3 A;  3BG1 A;  5C2V B;  3SBQ A;  1SHY B;  1M1X A;  2IWK A;  4QRJ A;  2CE9 A;  4O3T B;  4DNU A;  1N6D A;  2HES X;  3EI2 A;  5K19 A;  3T3P A;  3IJC A;  4CZV A;  2OJY A;  1MG2 A;  2QC5 A;  5IJ7 E;  4A09 B;  4GGD A;  2YB8 B;  4ZOY A;  2VZ1 A;  3QI0 A;  1XKS A;  2J56 H;  3EMH A;  3RFG A;  1JTD B;  2AQ5 A;  4H5I A;  3PXW D;  3SHF A;  3ODT A;  2P9I C;  3ZE0 A;  2IUQ A;  3GD1 I;  4CY3 A;  5CXC A;  2AGX A;  2AGY A;  4JHN A;  1FWX A;  4KFM B;  5FKT A;  5EMJ B;  4NEN A;  2HU7 A;  3OL2 A;  4UM9 A;  2UZX B;  3IJ1 A;  3IIW A;  5GSA A;  4PC0 A;  3MZK A;  4YVD A;  2PM6 B;  4A2M A;  4A2L A; 
#chains in the Genus database with same CATH homology
 2B5L A;  4AOW A;  4X60 B;  2CN3 A;  4CY2 A;  2H9L A;  2IUR A;  4ZOZ A;  4GQ1 A;  4QQE A;  5CYK A;  1GG2 B;  3JRP A;  4Y7R A;  2YNO A;  2HXC A;  4AEZ A;  3KRX B;  2H6K A;  4GM8 A;  3RN0 D;  3SWS D;  4GQB B;  2OVP B;  4HDJ A;  3MKQ A;  4A08 A;  3PSL A;  3OKY B;  2OK6 A;  3JPX A;  5FA5 B;  4ZOX A;  4U1E I;  3A0F A;  5IC7 A;  2BCJ B;  2IWF A;  1JMX B;  2YNP A;  4O45 A;  3BG0 A;  3I7O A;  4PSW B;  4CI1 A;  4K3J B;  3N0E A;  5H14 A;  2TRC B;  1P22 A;  2CO0 C;  5HE1 B;  4ES0 A;  1N6E A;  5EM2 B;  5EAR A;  5I5J A;  2P9S C;  4CZY A;  2GC4 A;  4GZ8 A;  3I8E A;  3AL8 B;  3JZH A;  1SQ9 A;  4L3G D;  4ERQ A;  2EBS A;  2P9L C;  3B7F A;  3EI4 A;  4IA9 A;  5EAP A;  5I5I A;  2O9K A;  1GP2 B;  5GMK n;  4E54 A;  4U7A A;  4I79 A;  2PM9 A;  3EG6 A;  3I7N A;  3DM0 A;  4CZX A;  4BL0 A;  4A0B A;  3BWS A;  2CE8 A;  1N6F A;  4IMM A;  3PXS D;  3SJL D;  1XIP A;  2XL2 A;  1SQJ A;  3KRW B;  5CXB B;  2HKM A;  3UR4 A;  3UKR C;  3OKT A;  2HJB A;  3EI1 B;  4QL1 A;  2Z2P A;  3GRE A;  2B5N A;  2I0T A;  4CI2 A;  4A09 A;  4J82 A;  3V5W B;  2H9N A;  4FAV D;  3U4Y A;  4PBY A;  2OK4 A;  2IUP A;  3AL9 A;  5C2W B;  5AFU 3;  3PSC B;  1PI6 A;  5THA A;  4CY5 A;  4J79 A;  4ERZ A;  5C9Z B;  3DSM A;  4OZU A;  3JZG A;  5B4W A;  4J73 A;  5H17 A;  2YMU A;  4BUJ C;  4MK0 B;  5FKS A;  1TBG A;  3V9F A;  4FWW A;  5HE2 B;  3PVW B;  4JSN C;  5KDO B;  5IJ8 E;  4FA4 D;  3MZL A;  2IAA A;  3EI3 A;  2IUV A;  1JJU B;  1GOT B;  2H14 A;  4FHL A;  3IJ0 A;  4Y5R D;  2PBI B;  4CY1 A;  4JT6 C;  1A0R B;  2G99 A;  4NSX A;  4JSV C;  3AFC A;  4FAN D;  2OVR B;  4GGC A;  3OL2 B;  1MDA H;  2CO0 A;  4L3H D;  4PBZ A;  3OW8 A;  2H9P A;  5H1M A;  4LGN A;  2P9N C;  4FA5 D;  3RSE C;  1RI6 A;  2Z2N A;  4Z8L A;  5K1C C;  3DXK C;  5EML B;  3RMZ D;  2P9U C;  2HKR A;  1TYQ C;  2HJ4 A;  3C99 A;  4O3U B;  3RRM C;  3C5M A;  1PEV A;  3UVM A;  3SVW D;  4J81 A;  3JB9 L;  2PM7 B;  2I3S A;  4ZN4 A;  2B5M A;  2I0S A;  5CYK B;  4J8B A;  5JWZ A;  4EWR A;  3RN1 D;  3JZN A;  3CFV A;  4D6V A;  4CC9 A;  3MMY A;  4J0W A;  3UVO A;  4GQ2 P;  3F3F A;  2YNN A;  4R7A B;  1JOF A;  2QXV A;  2XU7 A;  3AL8 A;  3PE7 A;  2H3X A;  3L4M D;  1JMZ B;  1YFQ A;  3JRO A;  4A08 B;  4J0X A;  2GC7 A;  3FM0 A;  2H13 A;  3JAM g;  4E5Z A;  2AGW A;  2MTA H;  2H47 A;  1U2V C;  3F3G A;  5EAL A;  5HE3 B;  4K3I D;  4O1Q D;  2XL3 A;  3EU7 A;  4J87 A;  4FB1 D;  3SCY A;  1OMW B;  3FRX A;  4QT8 A;  4FA9 D;  5HYN B;  2HYE A;  3CFS B;  4A11 A;  4OWR A;  2BBK H;  3I2N A;  1NR0 A;  3DWL C;  2AGZ A;  4A0A A;  3I89 A;  2CN2 A;  3J80 g;  2J57 G;  4ZOV A;  5CXB A;  1QNI A;  3K27 A;  3SBR A;  4XYH A;  4J77 A;  3EI4 B;  4ERY A;  5AMS A;  2GNQ A;  4LG8 A;  3IIY A;  4GM9 A;  3UVL A;  3C75 H;  1XHM A;  4TZ4 A;  1NEX B;  3GFC A;  3ULE C;  3PXT D;  4E54 B;  4GMB A;  4JSP C;  2PM9 B;  3SFZ A;  3VGZ A;  4L9O A;  5TF2 A;  3SBP A;  2H6N A;  3C9C A;  2J55 H;  3SLE D;  1Q47 A;  2I3T A;  5FQD A;  4J78 A;  1U4C A;  2P9P C;  5SXM A;  2AH1 A;  3SXT D;  3VA6 A;  1OLZ A;  3I8C A;  3EI2 B;  3NVQ A;  5FKQ A;  4A7J A;  4H5J A;  2W18 A;  4X63 B;  5IT9 g;  3K26 A;  4X61 B;  5GXI A;  2OVQ B;  3MXX A;  2CNX A;  4PSX B;  3NVN A;  4ESG A;  3W15 A;  1R5M A;  2H9M A;  4L1Q D;  3OTT A;  5CXC B;  3IKO A;  3I7L A;  4N14 A;  5HE0 B;  3N0D A;  2Z2O A;  5GXH A;  4PXW A;  2UZY B;  3MKS B;  4BH6 A;  4XEI C;  2OIZ A;  3OKW A;  3UVN A;  4J84 A;  3OKY A;  1L0Q A;  1VYH C;  3EI3 B;  3DXM C;  3F3P A;  3VH0 A;  1K32 A;  5FKR A;  3UKU C;  4O9D A;  5IGQ A;  3ORV D;  3I7H A;  2AGL A;  5EAM A;  4CI8 A;  2B4E A;  1S4U X;  5EM2 A;  2YBA A;  4X3E A;  4FA1 D;  4D0K A;  4JSX C;  4LG9 A;  4G56 B;  2XYI A;  3I7P A;  3FGB A;  3ZWL B;  3I7K A;  3RLM D;  2AH0 A;  1ERJ A;  1MG3 A;  3J81 g;  1PGU A;  5A2Q g;  5FXY A;  2I0R A;  3EWE A;  2H6Q A;  1B9Y A;  5TDH B;  1B9X A;  5EMM B;  2Q7Q A;  1PBY B;  5HQG A;  3UVK A;  4XYI A;  3NVX A;  4JXM A;  4JT5 C;  5TEE A;  3V7D B;  4PNK B;  4GM3 A;  1K8K C;  4J86 A;  2P9K C;  3P4F A;  5AJA A;  5FLX g;  4E5Z B;  4JD2 C;  2H68 A;  4UI9 R;  5EMK B;  3HFQ A;  3EI1 A;  5TEF A;  4GGA A;  3L4O D;  3CIK B;  3AH8 B;  3RFH A;  5I5M A;  3SMR A;  4A11 B;  3PVU B;  4A0B B;  2G9A A;  4J8G A;  1GXR A;  4A0A B;  3E0C A;  5IGO A;  3SN6 B;  4CI3 A;  3BG1 A;  5C2V B;  3SBQ A;  1SHY B;  2IWK A;  4QRJ A;  2CE9 A;  4O3T B;  1N6D A;  2HES X;  3EI2 A;  5K19 A;  3IJC A;  4CZV A;  2OJY A;  1MG2 A;  2QC5 A;  5IJ7 E;  4A09 B;  4GGD A;  2YB8 B;  4ZOY A;  1XKS A;  2J56 H;  3EMH A;  3RFG A;  4H5I A;  2AQ5 A;  3PXW D;  3SHF A;  3ODT A;  2P9I C;  4CY3 A;  2IUQ A;  5CXC A;  2AGX A;  2AGY A;  1FWX A;  4KFM B;  5FKT A;  5EMJ B;  3OL2 A;  2UZX B;  3IJ1 A;  3IIW A;  5GSA A;  4PC0 A;  3MZK A;  4YVD A;  2PM6 B;  4A2M A;  4A2L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...