4CY1A

Crystal structure of the kansl1-wdr5 complex.
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
304
structure length
303
Chain Sequence
VKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords WD REPEAT-CONTAINING PROTEIN 5
publication title Structural Analysis of the Kansl1/Wdr5/Kansl2 Complex Reveals that Wdr5 is Required for Efficient Assembly and Chromatin Targeting of the Nsl Complex.
pubmed doi rcsb
source organism Homo sapiens
total genus 101
structure length 303
sequence length 304
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4cy1A00
5IJ7E 1JJUB 5C9ZB 5FA5B 1NR0A 3RN1D 2AGWA 4IA9A 3EMHA 4J79A 1K32A 3PSLA 4JXMA 4GGCA 5C2VB 4L9OA 2Q7QA 4E54A 4EWRA 4ERQA 3SHFA 5CXCB 3VA6A 4QL1A 4PXWA 4MK0B 3SBQA 3SFZA 3UKUC 4GM3A 2HJ4A 4ZOZA 2J55H 5K1CC 3RMZD 4K3ID 1YFQA 2P9PC 3A0FA 1OMWB 2P9NC 2H6NA 4E5ZA 3I7PA 4A0BB 5FXYA 5A2Qg 3W15A 3BG1A 4GZ8A 2P9IC 3DM0A 3AL8A 3C75H 4CZYA 2XU7A 2IWKA 5H17A 3SCYA 2H6QA 1Q47A 2EBSA 4J0WA 4BL0A 3CFVA 2AQ5A 4Y7RA 4ZOYA 4CY5A 3C9CA 2HXCA 4O3TB 4ZOXA 2P9UC 3OL2B 1TBGA 5B4WA 3UVMA 4GQBB 3UVNA 3DWLC 2AGLA 2G99A 2P9LC 5I5IA 4Z8LA 2PBIB 4O9DA 4FAVD 2XL2A 3UVOA 4A09B 4J82A 5EM2A 1PEVA 4OWRA 3JZGA 3J81g 3N0DA 4FA1D 4J77A 3AH8B 3RN0D 5CYKA 3MKQA 3SN6B 1TYQC 2H9LA 3IIYA 2CE9A 1FWXA 4H5IA 4UI9R 5KDOB 3MKSB 1XHMA 4J8GA 1R5MA 5HQGA 5EAPA 3L4OD 4X63B 3C99A 3JAMg 4XEIC 4LG8A 2I3TA 4XYHA 1GXRA 1A0RB 3FM0A 3F3FA 4FWWA 3F3PA 3EU7A 2IURA 4PSXB 4ZN4A 3PSCB 3CFSB 1NEXB 5EMKB 1QNIA 3NVNA 3PXTD 4QT8A 2W18A 2BCJB 5HE1B 4AEZA 5TF2A 3KRXB 4A7JA 1U4CA 5IGOA 5C2WB 4A2LA 3SJLD 4JSXC 4E54B 2TRCB 2H3XA 4J8BA 5FKSA 3E0CA 4JSNC 2CN3A 5H14A 3RSEC 2HYEA 4HDJA 5TEEA 1OLZA 2OVQB 5FKTA 4ZOVA 4GGDA 3NVXA 5IC7A 1JMXB 4G56B 4BUJC 5TDHB 1GP2B 3SXTD 4U7AA 2B4EA 4FAND 3EI2A 2H9PA 3U4YA 4E5ZB 2H68A 3V9FA 2I0TA 3IJCA 4J87A 1SQJA 2AH1A 5CXBA 3IJ1A 3JB9L 2G9AA 3AL8B 1JOFA 3J80g 4L3HD 4A0AA 4CI3A 3I7OA 2MTAH 3MXXA 4N14A 5AJAA 3VH0A 1U2VC 2PM9A 3HFQA 4GQ2P 4R7AB 1VYHC 4PNKB 3OTTA 3MZLA 4KFMB 4O1QD 3UVLA 2Z2OA 4JSVC 3BWSA 2HKRA 5K19A 3RFGA 4D0KA 3AFCA 2AH0A 2HKMA 3K27A 3OW8A 5I5JA 3B7FA 3SMRA 3PE7A 5AMSA 5TEFA 2OK4A 1PI6A 2HJBA 2B5MA 4CY3A 4O45A 4GGAA 3DXKC 4J81A 4A2MA 4FB1D 3GFCA 3OKYA 2YBAA 3PVUB 3I7KA 3I89A 5EMMB 4YVDA 1MG2A 3UR4A 2CE8A 5EM2B 4J86A 1GG2B 3OKWA 2IAAA 5GSAA 1XIPA 4K3JB 3PXWD 2H14A 2AGXA 5CYKB 3AL9A 2B5LA 3JPXA 3IJ0A 3VGZA 3RLMD 4J73A 5IT9g 5EARA 4A08A 1N6FA 3BG0A 4CY1A 5FKRA 4TZ4A 4CY2A 3P4FA 4LGNA 3NVQA 4FA4D 4CI2A 3RRMC 5FKQA 4U1EI 3I7LA 3SBPA 3JROA 5EALA 4GQ1A 4A11A 4QRJA 4XYIA 1S4UX 4J0XA 3PVWB 1B9XA 3ORVD 3I8EA 4X3EA 3JZNA 4CC9A 1N6DA 3EI3A 2I3SA 3I7NA 4ERYA 2P9SC 3EG6A 2YB8B 2I0RA 3RFHA 3GREA 4J84A 4PC0A 2IWFA 2XL3A 1GOTB 3EI1A 3EI4A 4GM9A 1RI6A 4PSWB 2H9MA 3SBRA 3C5MA 3ULEC 2H47A 3I7HA 3I8CA 1ERJA 2QC5A 5GXIA 3FRXA 4GM8A 3EI2B 5EMLB 2H6KA 4JD2C 2QXVA 4OZUA 5CXCA 4JT6C 5CXBB 2OVRB 3OKTA 5EMJB 3ZWLB 1PGUA 4CZXA 4A0AB 5H1MA 4CI8A 1MG3A 3JZHA 3SLED 2PM9B 3K26A 4IMMA 3MZKA 2H9NA 2OIZA 5EAMA 2YNNA 4FA5D 2YMUA 2CO0A 4A0BA 5IGQA 4O3UB 2I0SA 4L1QD 5FLXg 4H5JA 2CNXA 2H13A 2J57G 3MMYA 3N0EA 3L4MD 3I2NA 3UKRC 2YNOA 2GC4A 3OKYB 4BH6A 2IUQA 2PM7B 1P22A 2O9KA 4GMBA 1MDAH 1XKSA 4ESGA 5AFU3 5JWZA 2CO0C 2GC7A 3CIKB 4CI1A 1JMZB 3OL2A 3DSMA 3SWSD 2Z2PA 2P9KC 4NSXA 2B5NA 4FA9D 2J56H 3PXSD 3SVWD 5HYNB 5HE2B 3JRPA 4JSPC 2PM6B 2OVPB 4LG9A 3V7DB 2IUVA 5FQDA 4A08B 4D6VA 3ODTA 4A09A 2AGYA 5IJ8E 4X61B 2GNQA 2AGZA 2UZYB 1L0QA 2YNPA 4AOWA 5HE3B 5GMKn 1SHYB 2HESX 2UZXB 4JT5C 2Z2NA 1K8KC 4ES0A 3IIWA 5THAA 1SQ9A 2XYIA 2BBKH 4A11B 4CZVA 5SXMA 4ERZA 4FHLA 4Y5RD 3FGBA 3DXMC 5I5MA 2IUPA 1B9YA 2CN2A 4I79A 4PBZA 3F3GA 3IKOA 3EI3B 4J78A 5GXHA 4X60B 3UVKA 1PBYB 4L3GD 1N6EA 2OJYA 4QQEA 3V5WB 3EWEA 2OK6A 3EI1B 3EI4B 3KRWB 5HE0B 4PBYA
chains in the Genus database with same CATH superfamily
4RE5A 5IJ7E 1JJUB 3O4IA 5C9ZB 3QHYB 5FA5B 4AMZA 5M5UA 1NR0A 2VZ1A 3RN1D 2AGWA 4IA9A 3EMHA 4J79A 1K32A 3PSLA 4JXMA 4GGCA 1I2MB 4L9OA 5C2VB 2Q7QA 4E54A 4EWRA 1UOPA 3EQ8A 4ERQA 3SHFA 5CXCB 1E5TA 3ZE0A 3VA6A 4QL1A 4PXWA 4MK0B 3SBQA 4MMYA 3SFZA 3O4HA 3UKUC 4GM3A 2HJ4A 2XE4A 4ZOZA 2J55H 4G1EA 5K1CC 3RMZD 3IULA 2EICA 4WK2A 4K3ID 1YFQA 2P9PC 1E8NA 3A0FA 4AX4A 1OMWB 2P9NC 3VI3A 2H6NA 5E6UA 4E5ZA 3I7PA 4A0BB 5FXYA 3K71A 5A2Qg 3W15A 2EIEA 1GOHA 3BG1A 4L1MA 4GZ8A 2P9IC 2VDKA 3DM0A 3ZE1A 3T3PA 3AL8A 3C75H 5HDBA 4CZYA 1VZ2A 1U8CA 2VDRA 2XU7A 1O6FA 2IWKA 5H17A 4BCDA 3SCYA 4BCBA 2H6QA 1E8MA 1Q47A 2EBSA 3V4PA 4J0WA 4BL0A 1K3IA 4DNVA 5M5SA 3CFVA 2AQ5A 4Y7RA 4ZOYA 4CY5A 3C9CA 2HXCA 4D9SA 4O3TB 4ZOXA 2P9UC 3OL2B 1TBGA 5B4WA 3UVMA 4GQBB 3UVNA 3DWLC 2HU8A 2AGLA 5M5RA 2G99A 2P9LC 5I5IA 4Z8LA 2PBIB 4O9DA 5M5TA 4FAVD 2XL2A 3UVOA 3K72A 4A09B 4J82A 5EM2A 1PEVA 4NAAA 4OWRA 3JZGA 3VI4A 3IJEA 3J81g 3N0DA 1YR2A 4MMXA 4FA1D 4AMYA 4J77A 3AH8B 4BP8A 3RN0D 5CYKA 3MKQA 3SN6B 1TYQC 2H9LA 3IIYA 2CE9A 1FWXA 1VZ3A 4H5IA 4UI9R 1H2ZA 3ZE2A 3MKSB 1XHMA 4J8GA 5KDOB 1R5MA 5HQGA 5EAPA 3L4OD 4X63B 3C99A 3JAMg 4XEIC 4LG8A 2I3TA 4XYHA 1QFMA 1GXRA 4BCCA 1A0RB 3OF7A 4BP9A 3FM0A 3F3FA 4FWWA 3F3PA 3EU7A 2IURA 4PSXB 4ZN4A 5M5VA 3PSCB 3CFSB 1NEXB 5EMKB 4WJKA 1QNIA 3NVNA 3PXTD 4QT8A 2W18A 2JKXA 2BCJB 5HE1B 4AEZA 5TF2A 3KRXB 4A7JA 1U4CA 5IGOA 5C2WB 4A2LA 3SJLD 1UOOA 3IUMA 4JSXC 4E54B 2TRCB 2H3XA 4J8BA 5FKSA 3E0CA 4JSNC 2CN3A 5H14A 3RSEC 2HYEA 2XDWA 4HDJA 3MUOA 5TEEA 3IUJA 5M61A 1OLZA 2OVQB 5FKTA 4IRZA 4WK4A 4ZOVA 4GGDA 3K6SA 3NVXA 5IC7A 3NIDA 1JMXB 4G56B 4BUJC 5TDHB 1GP2B 3SXTD 4U7AA 2B4EA 3O4JA 4FAND 3EI2A 2H9PA 3U4YA 4UM9A 4E5ZB 3NIFA 2H68A 4MMZA 2I0TA 3IJCA 4NBMA 3V9FA 4J87A 1SQJA 3NIGA 2AH1A 5CXBA 3IJ1A 1H2XA 3JB9L 1TYEA 2G9AA 3AL8B 1JOFA 5C92A 4L3HD 3GD1I 3J80g 4A0AA 4CI3A 3I7OA 2MTAH 3MXXA 4N14A 5AJAA 3VH0A 4QAMA 1U2VC 2EIDA 2PM9A 5E6SA 3ZDYA 3HFQA 4G1MA 4GQ2P 4R7AB 1VYHC 1JV2A 4PNKB 3OTTA 3T3MA 3MZLA 4KFMB 4O1QD 3UVLA 2Z2OA 2VDNA 4JSVC 3BWSA 2HKRA 3IUQA 5K19A 3RFGA 4D0KA 3AFCA 3EQ9A 2AH0A 2HKMA 3K27A 2VZ3A 3OW8A 5I5JA 3B7FA 4O02A 3SMRA 3PE7A 5AMSA 5TEFA 2OK4A 1PI6A 2HJBA 2B5MA 3KCIA 4CY3A 4O45A 4GGAA 3DXKC 4J81A 4A2MA 4FB1D 3GFCA 3OKYA 2YBAA 3PVUB 3I7KA 3I89A 4Z7NA 5EMMB 2VDOA 4YVDA 1MG2A 3UR4A 1BPOA 2CE8A 5EM2B 4J86A 1GG2B 3OKWA 2IAAA 1T2XA 5GSAA 1XIPA 4K3JB 2VDLA 4G55A 4DNWA 3PXWD 2H14A 2AGXA 5CYKB 1UOQA 3AL9A 2B5LA 3JPXA 3IJ0A 3EQ7A 5C86A 4NC4A 3VGZA 3RLMD 4J73A 5IT9g 5EARA 4O2WA 1GOGA 1N6FA 4A08A 3BG0A 4CY1A 5FKRA 4TZ4A 4CY2A 3P4FA 4LGNA 4DNUA 5FFGA 3NVQA 1A12A 4CI2A 4FA4D 3RRMC 5FKQA 4U1EI 3MUNA 3I7LA 3SBPA 3JROA 3MVDK 5EALA 4GQ1A 4A11A 4QRJA 4XYIA 2HU7A 1S4UX 4J0XA 3PVWB 1B9XA 3ORVD 3I8EA 4X3EA 1O6GA 3JZNA 4CC9A 1N6DA 3EI3A 2I3SA 3I7NA 4ERYA 1VE7A 2P9SC 3EG6A 2YB8B 2I0RA 3RFHA 3GREA 4J84A 4PC0A 2EIBA 3FCUA 2IWFA 2XL3A 4NENA 1GOTB 3EI1A 3EI4A 4GM9A 1RI6A 4PSWB 2H9MA 4Z7OA 3SBRA 3C5MA 3ULEC 2H47A 3I7HA 5E6RA 3I8CA 1ERJA 2QC5A 3ZDZA 5GXIA 3FRXA 4GM8A 3EI2B 5EMLB 2H6KA 4JD2C 2QXVA 2XZGA 4OZUA 5CXCA 2WQ8A 4JT6C 5CXBB 2OVRB 3OKTA 5EMJB 3ZWLB 1PGUA 4CZXA 1H2WA 4A0AB 5H1MA 3O4GA 4CI8A 1JTDB 1MG3A 3IURA 3JZHA 3SLED 2QR5A 3DDUA 2PM9B 3K26A 4IMMA 3FCSA 3MZKA 2H9NA 2OIZA 4JHNA 5EAMA 2YNNA 4FA5D 2YMUA 3IVMA 2CO0A 4A0BA 1C9LA 5IGQA 4O3UB 2VDQA 3ZDXA 2I0SA 4L1QD 5FLXg 3GC3B 1H2YA 4H5JA 2CNXA 2H13A 3QI0A 2J57G 3MMYA 3N0EA 4RE6A 3L4MD 3I2NA 3IUNA 1C9IA 3UKRC 2YNOA 2GC4A 3OKYB 4BH6A 2IUQA 2PM7B 4Z7QA 1P22A 2O9KA 4GMBA 1MDAH 1XKSA 4ESGA 5AFU3 5JWZA 2CO0C 2GC7A 2QZPA 3CIKB 4CI1A 1JMZB 4UM8A 3OL2A 3DSMA 3SWSD 1GOFA 2Z2PA 2P9KC 4NSXA 2B5NA 4FA9D 1UTCA 2J56H 3PXSD 3SVWD 1QFSA 2BKLA 5HYNB 5HE2B 5FFOA 4AN0A 3JRPA 4JSPC 4WK0A 2PM6B 2OVPB 4LG9A 3V7DB 2IUVA 2VDMA 5FQDA 4A08B 4D6VA 3ODTA 4A09A 1M1XA 2AGYA 1L5GA 3V4VA 2VC2A 5IJ8E 4X61B 2GNQA 2AGZA 2UZYB 1L0QA 2YNPA 4AOWA 5HE3B 5GMKn 1SHYB 2HESX 2UZXB 4JT5C 4AN1A 2Z2NA 1K8KC 4ES0A 3IIWA 5THAA 1VE6A 1SQ9A 2XYIA 2BBKH 4JHPC 4A11B 4CZVA 5SXMA 4ERZA 4FHLA 4Y5RD 3FGBA 3DXMC 5I5MA 2IUPA 1B9YA 2VDPA 2CN2A 4I79A 4PBZA 3F3GA 3IKOA 3EI3B 4J78A 5GXHA 4X60B 3UVKA 1PBYB 2HU5A 4L3GD 1N6EA 2OJYA 4QQEA 3V5WB 3EWEA 2OK6A 3EI1B 3EI4B 3KRWB 5HE0B 4PBYA
chains in the Genus database with same CATH topology
5IJ7E 1JJUB 5C9ZB 5FA5B 1NR0A 3RN1D 2AGWA 4IA9A 3EMHA 4J79A 1K32A 3PSLA 4JXMA 4GGCA 5C2VB 4L9OA 2Q7QA 4E54A 4EWRA 4ERQA 3SHFA 5CXCB 3VA6A 4QL1A 4PXWA 4MK0B 3SBQA 3SFZA 3UKUC 4GM3A 2HJ4A 4ZOZA 2J55H 5K1CC 3RMZD 4K3ID 1YFQA 2P9PC 3A0FA 1OMWB 2P9NC 2H6NA 4E5ZA 3I7PA 4A0BB 5FXYA 5A2Qg 3W15A 3BG1A 4GZ8A 2P9IC 3DM0A 3AL8A 3C75H 4CZYA 2XU7A 2IWKA 5H17A 3SCYA 2H6QA 1Q47A 2EBSA 4J0WA 4BL0A 3CFVA 2AQ5A 4Y7RA 4ZOYA 4CY5A 3C9CA 2HXCA 4O3TB 4ZOXA 2P9UC 3OL2B 1TBGA 5B4WA 3UVMA 4GQBB 3UVNA 3DWLC 2AGLA 2G99A 2P9LC 5I5IA 4Z8LA 2PBIB 4O9DA 4FAVD 2XL2A 3UVOA 4A09B 4J82A 5EM2A 1PEVA 4OWRA 3JZGA 3J81g 3N0DA 4FA1D 4J77A 3AH8B 3RN0D 5CYKA 3MKQA 3SN6B 1TYQC 2H9LA 3IIYA 2CE9A 1FWXA 4H5IA 4UI9R 5KDOB 3MKSB 1XHMA 4J8GA 1R5MA 5HQGA 5EAPA 3L4OD 4X63B 3C99A 3JAMg 4XEIC 4LG8A 2I3TA 4XYHA 1GXRA 1A0RB 3FM0A 3F3FA 4FWWA 3F3PA 3EU7A 2IURA 4PSXB 4ZN4A 3PSCB 3CFSB 1NEXB 5EMKB 1QNIA 3NVNA 3PXTD 4QT8A 2W18A 2BCJB 5HE1B 4AEZA 5TF2A 3KRXB 4A7JA 1U4CA 5IGOA 5C2WB 4A2LA 3SJLD 4JSXC 4E54B 2TRCB 2H3XA 4J8BA 5FKSA 3E0CA 4JSNC 2CN3A 5H14A 3RSEC 2HYEA 4HDJA 5TEEA 1OLZA 2OVQB 5FKTA 4ZOVA 4GGDA 3NVXA 5IC7A 1JMXB 4G56B 4BUJC 5TDHB 1GP2B 3SXTD 4U7AA 2B4EA 4FAND 3EI2A 2H9PA 3U4YA 4E5ZB 2H68A 3V9FA 2I0TA 3IJCA 4J87A 1SQJA 2AH1A 5CXBA 3IJ1A 3JB9L 2G9AA 3AL8B 1JOFA 3J80g 4L3HD 4A0AA 4CI3A 3I7OA 2MTAH 3MXXA 4N14A 5AJAA 3VH0A 1U2VC 2PM9A 3HFQA 4GQ2P 4R7AB 1VYHC 4PNKB 3OTTA 3MZLA 4KFMB 4O1QD 3UVLA 2Z2OA 4JSVC 3BWSA 2HKRA 5K19A 3RFGA 4D0KA 3AFCA 2AH0A 2HKMA 3K27A 3OW8A 5I5JA 3B7FA 3SMRA 3PE7A 5AMSA 5TEFA 2OK4A 1PI6A 2HJBA 2B5MA 4CY3A 4O45A 4GGAA 3DXKC 4J81A 4A2MA 4FB1D 3GFCA 3OKYA 2YBAA 3PVUB 3I7KA 3I89A 5EMMB 4YVDA 1MG2A 3UR4A 2CE8A 5EM2B 4J86A 1GG2B 3OKWA 2IAAA 5GSAA 1XIPA 4K3JB 3PXWD 2H14A 2AGXA 5CYKB 3AL9A 2B5LA 3JPXA 3IJ0A 3VGZA 3RLMD 4J73A 5IT9g 5EARA 4A08A 1N6FA 3BG0A 4CY1A 5FKRA 4TZ4A 4CY2A 3P4FA 4LGNA 3NVQA 4FA4D 4CI2A 3RRMC 5FKQA 4U1EI 3I7LA 3SBPA 3JROA 5EALA 4GQ1A 4A11A 4QRJA 4XYIA 1S4UX 4J0XA 3PVWB 1B9XA 3ORVD 3I8EA 4X3EA 3JZNA 4CC9A 1N6DA 3EI3A 2I3SA 3I7NA 4ERYA 2P9SC 3EG6A 2YB8B 2I0RA 3RFHA 3GREA 4J84A 4PC0A 2IWFA 2XL3A 1GOTB 3EI1A 3EI4A 4GM9A 1RI6A 4PSWB 2H9MA 3SBRA 3C5MA 3ULEC 2H47A 3I7HA 3I8CA 1ERJA 2QC5A 5GXIA 3FRXA 4GM8A 3EI2B 5EMLB 2H6KA 4JD2C 2QXVA 4OZUA 5CXCA 4JT6C 5CXBB 2OVRB 3OKTA 5EMJB 3ZWLB 1PGUA 4CZXA 4A0AB 5H1MA 4CI8A 1MG3A 3JZHA 3SLED 2PM9B 3K26A 4IMMA 3MZKA 2H9NA 2OIZA 5EAMA 2YNNA 4FA5D 2YMUA 2CO0A 4A0BA 5IGQA 4O3UB 2I0SA 4L1QD 5FLXg 4H5JA 2CNXA 2H13A 2J57G 3MMYA 3N0EA 3L4MD 3I2NA 3UKRC 2YNOA 2GC4A 3OKYB 4BH6A 2IUQA 2PM7B 1P22A 2O9KA 4GMBA 1MDAH 1XKSA 4ESGA 5AFU3 5JWZA 2CO0C 2GC7A 3CIKB 4CI1A 1JMZB 3OL2A 3DSMA 3SWSD 2Z2PA 2P9KC 4NSXA 2B5NA 4FA9D 2J56H 3PXSD 3SVWD 5HYNB 5HE2B 3JRPA 4JSPC 2PM6B 2OVPB 4LG9A 3V7DB 2IUVA 5FQDA 4A08B 4D6VA 3ODTA 4A09A 2AGYA 5IJ8E 4X61B 2GNQA 2AGZA 2UZYB 1L0QA 2YNPA 4AOWA 5HE3B 5GMKn 1SHYB 2HESX 2UZXB 4JT5C 2Z2NA 1K8KC 4ES0A 3IIWA 5THAA 1SQ9A 2XYIA 2BBKH 4A11B 4CZVA 5SXMA 4ERZA 4FHLA 4Y5RD 3FGBA 3DXMC 5I5MA 2IUPA 1B9YA 2CN2A 4I79A 4PBZA 3F3GA 3IKOA 3EI3B 4J78A 5GXHA 4X60B 3UVKA 1PBYB 4L3GD 1N6EA 2OJYA 4QQEA 3V5WB 3EWEA 2OK6A 3EI1B 3EI4B 3KRWB 5HE0B 4PBYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IJ7 E;  1JJU B;  5C9Z B;  5FA5 B;  1NR0 A;  3RN1 D;  2AGW A;  4IA9 A;  3EMH A;  4J79 A;  1K32 A;  3PSL A;  4JXM A;  4GGC A;  5C2V B;  4L9O A;  2Q7Q A;  4E54 A;  4EWR A;  4ERQ A;  3SHF A;  5CXC B;  3VA6 A;  4QL1 A;  4PXW A;  4MK0 B;  3SBQ A;  3SFZ A;  3UKU C;  4GM3 A;  2HJ4 A;  4ZOZ A;  2J55 H;  5K1C C;  3RMZ D;  4K3I D;  1YFQ A;  2P9P C;  3A0F A;  1OMW B;  2P9N C;  2H6N A;  4E5Z A;  3I7P A;  4A0B B;  5FXY A;  5A2Q g;  3W15 A;  3BG1 A;  4GZ8 A;  2P9I C;  3DM0 A;  3AL8 A;  3C75 H;  4CZY A;  2XU7 A;  2IWK A;  5H17 A;  3SCY A;  2H6Q A;  1Q47 A;  2EBS A;  4J0W A;  4BL0 A;  3CFV A;  2AQ5 A;  4Y7R A;  4ZOY A;  4CY5 A;  3C9C A;  2HXC A;  4O3T B;  4ZOX A;  2P9U C;  3OL2 B;  1TBG A;  5B4W A;  3UVM A;  4GQB B;  3UVN A;  3DWL C;  2AGL A;  2G99 A;  2P9L C;  5I5I A;  4Z8L A;  2PBI B;  4O9D A;  4FAV D;  2XL2 A;  3UVO A;  4A09 B;  4J82 A;  5EM2 A;  1PEV A;  4OWR A;  3JZG A;  3J81 g;  3N0D A;  4FA1 D;  4J77 A;  3AH8 B;  3RN0 D;  5CYK A;  3MKQ A;  3SN6 B;  1TYQ C;  2H9L A;  3IIY A;  2CE9 A;  1FWX A;  4H5I A;  4UI9 R;  5KDO B;  3MKS B;  1XHM A;  4J8G A;  1R5M A;  5HQG A;  5EAP A;  3L4O D;  4X63 B;  3C99 A;  3JAM g;  4XEI C;  4LG8 A;  2I3T A;  4XYH A;  1GXR A;  1A0R B;  3FM0 A;  3F3F A;  4FWW A;  3F3P A;  3EU7 A;  2IUR A;  4PSX B;  4ZN4 A;  3PSC B;  3CFS B;  1NEX B;  5EMK B;  1QNI A;  3NVN A;  3PXT D;  4QT8 A;  2W18 A;  2BCJ B;  5HE1 B;  4AEZ A;  5TF2 A;  3KRX B;  4A7J A;  1U4C A;  5IGO A;  5C2W B;  4A2L A;  3SJL D;  4JSX C;  4E54 B;  2TRC B;  2H3X A;  4J8B A;  5FKS A;  3E0C A;  4JSN C;  2CN3 A;  5H14 A;  3RSE C;  2HYE A;  4HDJ A;  5TEE A;  1OLZ A;  2OVQ B;  5FKT A;  4ZOV A;  4GGD A;  3NVX A;  5IC7 A;  1JMX B;  4G56 B;  4BUJ C;  5TDH B;  1GP2 B;  3SXT D;  4U7A A;  2B4E A;  4FAN D;  3EI2 A;  2H9P A;  3U4Y A;  4E5Z B;  2H68 A;  3V9F A;  2I0T A;  3IJC A;  4J87 A;  1SQJ A;  2AH1 A;  5CXB A;  3IJ1 A;  3JB9 L;  2G9A A;  3AL8 B;  1JOF A;  3J80 g;  4L3H D;  4A0A A;  4CI3 A;  3I7O A;  2MTA H;  3MXX A;  4N14 A;  5AJA A;  3VH0 A;  1U2V C;  2PM9 A;  3HFQ A;  4GQ2 P;  4R7A B;  1VYH C;  4PNK B;  3OTT A;  3MZL A;  4KFM B;  4O1Q D;  3UVL A;  2Z2O A;  4JSV C;  3BWS A;  2HKR A;  5K19 A;  3RFG A;  4D0K A;  3AFC A;  2AH0 A;  2HKM A;  3K27 A;  3OW8 A;  5I5J A;  3B7F A;  3SMR A;  3PE7 A;  5AMS A;  5TEF A;  2OK4 A;  1PI6 A;  2HJB A;  2B5M A;  4CY3 A;  4O45 A;  4GGA A;  3DXK C;  4J81 A;  4A2M A;  4FB1 D;  3GFC A;  3OKY A;  2YBA A;  3PVU B;  3I7K A;  3I89 A;  5EMM B;  4YVD A;  1MG2 A;  3UR4 A;  2CE8 A;  5EM2 B;  4J86 A;  1GG2 B;  3OKW A;  2IAA A;  5GSA A;  1XIP A;  4K3J B;  3PXW D;  2H14 A;  2AGX A;  5CYK B;  3AL9 A;  2B5L A;  3JPX A;  3IJ0 A;  3VGZ A;  3RLM D;  4J73 A;  5IT9 g;  5EAR A;  4A08 A;  1N6F A;  3BG0 A;  4CY1 A;  5FKR A;  4TZ4 A;  4CY2 A;  3P4F A;  4LGN A;  3NVQ A;  4FA4 D;  4CI2 A;  3RRM C;  5FKQ A;  4U1E I;  3I7L A;  3SBP A;  3JRO A;  5EAL A;  4GQ1 A;  4A11 A;  4QRJ A;  4XYI A;  1S4U X;  4J0X A;  3PVW B;  1B9X A;  3ORV D;  3I8E A;  4X3E A;  3JZN A;  4CC9 A;  1N6D A;  3EI3 A;  2I3S A;  3I7N A;  4ERY A;  2P9S C;  3EG6 A;  2YB8 B;  2I0R A;  3RFH A;  3GRE A;  4J84 A;  4PC0 A;  2IWF A;  2XL3 A;  1GOT B;  3EI1 A;  3EI4 A;  4GM9 A;  1RI6 A;  4PSW B;  2H9M A;  3SBR A;  3C5M A;  3ULE C;  2H47 A;  3I7H A;  3I8C A;  1ERJ A;  2QC5 A;  5GXI A;  3FRX A;  4GM8 A;  3EI2 B;  5EML B;  2H6K A;  4JD2 C;  2QXV A;  4OZU A;  5CXC A;  4JT6 C;  5CXB B;  2OVR B;  3OKT A;  5EMJ B;  3ZWL B;  1PGU A;  4CZX A;  4A0A B;  5H1M A;  4CI8 A;  1MG3 A;  3JZH A;  3SLE D;  2PM9 B;  3K26 A;  4IMM A;  3MZK A;  2H9N A;  2OIZ A;  5EAM A;  2YNN A;  4FA5 D;  2YMU A;  2CO0 A;  4A0B A;  5IGQ A;  4O3U B;  2I0S A;  4L1Q D;  5FLX g;  4H5J A;  2CNX A;  2H13 A;  2J57 G;  3MMY A;  3N0E A;  3L4M D;  3I2N A;  3UKR C;  2YNO A;  2GC4 A;  3OKY B;  4BH6 A;  2IUQ A;  2PM7 B;  1P22 A;  2O9K A;  4GMB A;  1MDA H;  1XKS A;  4ESG A;  5AFU 3;  5JWZ A;  2CO0 C;  2GC7 A;  3CIK B;  4CI1 A;  1JMZ B;  3OL2 A;  3DSM A;  3SWS D;  2Z2P A;  2P9K C;  4NSX A;  2B5N A;  4FA9 D;  2J56 H;  3PXS D;  3SVW D;  5HYN B;  5HE2 B;  3JRP A;  4JSP C;  2PM6 B;  2OVP B;  4LG9 A;  3V7D B;  2IUV A;  5FQD A;  4A08 B;  4D6V A;  3ODT A;  4A09 A;  2AGY A;  5IJ8 E;  4X61 B;  2GNQ A;  2AGZ A;  2UZY B;  1L0Q A;  2YNP A;  4AOW A;  5HE3 B;  5GMK n;  1SHY B;  2HES X;  2UZX B;  4JT5 C;  2Z2N A;  1K8K C;  4ES0 A;  3IIW A;  5THA A;  1SQ9 A;  2XYI A;  2BBK H;  4A11 B;  4CZV A;  5SXM A;  4ERZ A;  4FHL A;  4Y5R D;  3FGB A;  3DXM C;  5I5M A;  2IUP A;  1B9Y A;  2CN2 A;  4I79 A;  4PBZ A;  3F3G A;  3IKO A;  3EI3 B;  4J78 A;  5GXH A;  4X60 B;  3UVK A;  1PBY B;  4L3G D;  1N6E A;  2OJY A;  4QQE A;  3V5W B;  3EWE A;  2OK6 A;  3EI1 B;  3EI4 B;  3KRW B;  5HE0 B;  4PBY A; 
#chains in the Genus database with same CATH topology
 4RE5 A;  5IJ7 E;  1JJU B;  3O4I A;  5C9Z B;  3QHY B;  5FA5 B;  4AMZ A;  5M5U A;  1NR0 A;  2VZ1 A;  3RN1 D;  2AGW A;  4IA9 A;  3EMH A;  4J79 A;  1K32 A;  3PSL A;  4JXM A;  4GGC A;  1I2M B;  4L9O A;  5C2V B;  2Q7Q A;  4E54 A;  4EWR A;  1UOP A;  3EQ8 A;  4ERQ A;  3SHF A;  5CXC B;  1E5T A;  3ZE0 A;  3VA6 A;  4QL1 A;  4PXW A;  4MK0 B;  3SBQ A;  4MMY A;  3SFZ A;  3O4H A;  3UKU C;  4GM3 A;  2HJ4 A;  2XE4 A;  4ZOZ A;  2J55 H;  4G1E A;  5K1C C;  3RMZ D;  3IUL A;  2EIC A;  4WK2 A;  4K3I D;  1YFQ A;  2P9P C;  1E8N A;  3A0F A;  4AX4 A;  1OMW B;  2P9N C;  3VI3 A;  2H6N A;  5E6U A;  4E5Z A;  3I7P A;  4A0B B;  5FXY A;  3K71 A;  5A2Q g;  3W15 A;  2EIE A;  1GOH A;  3BG1 A;  4L1M A;  4GZ8 A;  2P9I C;  2VDK A;  3DM0 A;  3ZE1 A;  3T3P A;  3AL8 A;  3C75 H;  5HDB A;  4CZY A;  1VZ2 A;  1U8C A;  2VDR A;  2XU7 A;  1O6F A;  2IWK A;  5H17 A;  4BCD A;  3SCY A;  4BCB A;  2H6Q A;  1E8M A;  1Q47 A;  2EBS A;  3V4P A;  4J0W A;  4BL0 A;  1K3I A;  4DNV A;  5M5S A;  3CFV A;  2AQ5 A;  4Y7R A;  4ZOY A;  4CY5 A;  3C9C A;  2HXC A;  4D9S A;  4O3T B;  4ZOX A;  2P9U C;  3OL2 B;  1TBG A;  5B4W A;  3UVM A;  4GQB B;  3UVN A;  3DWL C;  2HU8 A;  2AGL A;  5M5R A;  2G99 A;  2P9L C;  5I5I A;  4Z8L A;  2PBI B;  4O9D A;  5M5T A;  4FAV D;  2XL2 A;  3UVO A;  3K72 A;  4A09 B;  4J82 A;  5EM2 A;  1PEV A;  4NAA A;  4OWR A;  3JZG A;  3VI4 A;  3IJE A;  3J81 g;  3N0D A;  1YR2 A;  4MMX A;  4FA1 D;  4AMY A;  4J77 A;  3AH8 B;  4BP8 A;  3RN0 D;  5CYK A;  3MKQ A;  3SN6 B;  1TYQ C;  2H9L A;  3IIY A;  2CE9 A;  1FWX A;  1VZ3 A;  4H5I A;  4UI9 R;  1H2Z A;  3ZE2 A;  3MKS B;  1XHM A;  4J8G A;  5KDO B;  1R5M A;  5HQG A;  5EAP A;  3L4O D;  4X63 B;  3C99 A;  3JAM g;  4XEI C;  4LG8 A;  2I3T A;  4XYH A;  1QFM A;  1GXR A;  4BCC A;  1A0R B;  3OF7 A;  4BP9 A;  3FM0 A;  3F3F A;  4FWW A;  3F3P A;  3EU7 A;  2IUR A;  4PSX B;  4ZN4 A;  5M5V A;  3PSC B;  3CFS B;  1NEX B;  5EMK B;  4WJK A;  1QNI A;  3NVN A;  3PXT D;  4QT8 A;  2W18 A;  2JKX A;  2BCJ B;  5HE1 B;  4AEZ A;  5TF2 A;  3KRX B;  4A7J A;  1U4C A;  5IGO A;  5C2W B;  4A2L A;  3SJL D;  1UOO A;  3IUM A;  4JSX C;  4E54 B;  2TRC B;  2H3X A;  4J8B A;  5FKS A;  3E0C A;  4JSN C;  2CN3 A;  5H14 A;  3RSE C;  2HYE A;  2XDW A;  4HDJ A;  3MUO A;  5TEE A;  3IUJ A;  5M61 A;  1OLZ A;  2OVQ B;  5FKT A;  4IRZ A;  4WK4 A;  4ZOV A;  4GGD A;  3K6S A;  3NVX A;  5IC7 A;  3NID A;  1JMX B;  4G56 B;  4BUJ C;  5TDH B;  1GP2 B;  3SXT D;  4U7A A;  2B4E A;  3O4J A;  4FAN D;  3EI2 A;  2H9P A;  3U4Y A;  4UM9 A;  4E5Z B;  3NIF A;  2H68 A;  4MMZ A;  2I0T A;  3IJC A;  4NBM A;  3V9F A;  4J87 A;  1SQJ A;  3NIG A;  2AH1 A;  5CXB A;  3IJ1 A;  1H2X A;  3JB9 L;  1TYE A;  2G9A A;  3AL8 B;  1JOF A;  5C92 A;  4L3H D;  3GD1 I;  3J80 g;  4A0A A;  4CI3 A;  3I7O A;  2MTA H;  3MXX A;  4N14 A;  5AJA A;  3VH0 A;  4QAM A;  1U2V C;  2EID A;  2PM9 A;  5E6S A;  3ZDY A;  3HFQ A;  4G1M A;  4GQ2 P;  4R7A B;  1VYH C;  1JV2 A;  4PNK B;  3OTT A;  3T3M A;  3MZL A;  4KFM B;  4O1Q D;  3UVL A;  2Z2O A;  2VDN A;  4JSV C;  3BWS A;  2HKR A;  3IUQ A;  5K19 A;  3RFG A;  4D0K A;  3AFC A;  3EQ9 A;  2AH0 A;  2HKM A;  3K27 A;  2VZ3 A;  3OW8 A;  5I5J A;  3B7F A;  4O02 A;  3SMR A;  3PE7 A;  5AMS A;  5TEF A;  2OK4 A;  1PI6 A;  2HJB A;  2B5M A;  3KCI A;  4CY3 A;  4O45 A;  4GGA A;  3DXK C;  4J81 A;  4A2M A;  4FB1 D;  3GFC A;  3OKY A;  2YBA A;  3PVU B;  3I7K A;  3I89 A;  4Z7N A;  5EMM B;  2VDO A;  4YVD A;  1MG2 A;  3UR4 A;  1BPO A;  2CE8 A;  5EM2 B;  4J86 A;  1GG2 B;  3OKW A;  2IAA A;  1T2X A;  5GSA A;  1XIP A;  4K3J B;  2VDL A;  4G55 A;  4DNW A;  3PXW D;  2H14 A;  2AGX A;  5CYK B;  1UOQ A;  3AL9 A;  2B5L A;  3JPX A;  3IJ0 A;  3EQ7 A;  5C86 A;  4NC4 A;  3VGZ A;  3RLM D;  4J73 A;  5IT9 g;  5EAR A;  4O2W A;  1GOG A;  1N6F A;  4A08 A;  3BG0 A;  4CY1 A;  5FKR A;  4TZ4 A;  4CY2 A;  3P4F A;  4LGN A;  4DNU A;  5FFG A;  3NVQ A;  1A12 A;  4CI2 A;  4FA4 D;  3RRM C;  5FKQ A;  4U1E I;  3MUN A;  3I7L A;  3SBP A;  3JRO A;  3MVD K;  5EAL A;  4GQ1 A;  4A11 A;  4QRJ A;  4XYI A;  2HU7 A;  1S4U X;  4J0X A;  3PVW B;  1B9X A;  3ORV D;  3I8E A;  4X3E A;  1O6G A;  3JZN A;  4CC9 A;  1N6D A;  3EI3 A;  2I3S A;  3I7N A;  4ERY A;  1VE7 A;  2P9S C;  3EG6 A;  2YB8 B;  2I0R A;  3RFH A;  3GRE A;  4J84 A;  4PC0 A;  2EIB A;  3FCU A;  2IWF A;  2XL3 A;  4NEN A;  1GOT B;  3EI1 A;  3EI4 A;  4GM9 A;  1RI6 A;  4PSW B;  2H9M A;  4Z7O A;  3SBR A;  3C5M A;  3ULE C;  2H47 A;  3I7H A;  5E6R A;  3I8C A;  1ERJ A;  2QC5 A;  3ZDZ A;  5GXI A;  3FRX A;  4GM8 A;  3EI2 B;  5EML B;  2H6K A;  4JD2 C;  2QXV A;  2XZG A;  4OZU A;  5CXC A;  2WQ8 A;  4JT6 C;  5CXB B;  2OVR B;  3OKT A;  5EMJ B;  3ZWL B;  1PGU A;  4CZX A;  1H2W A;  4A0A B;  5H1M A;  3O4G A;  4CI8 A;  1JTD B;  1MG3 A;  3IUR A;  3JZH A;  3SLE D;  2QR5 A;  3DDU A;  2PM9 B;  3K26 A;  4IMM A;  3FCS A;  3MZK A;  2H9N A;  2OIZ A;  4JHN A;  5EAM A;  2YNN A;  4FA5 D;  2YMU A;  3IVM A;  2CO0 A;  4A0B A;  1C9L A;  5IGQ A;  4O3U B;  2VDQ A;  3ZDX A;  2I0S A;  4L1Q D;  5FLX g;  3GC3 B;  1H2Y A;  4H5J A;  2CNX A;  2H13 A;  3QI0 A;  2J57 G;  3MMY A;  3N0E A;  4RE6 A;  3L4M D;  3I2N A;  3IUN A;  1C9I A;  3UKR C;  2YNO A;  2GC4 A;  3OKY B;  4BH6 A;  2IUQ A;  2PM7 B;  4Z7Q A;  1P22 A;  2O9K A;  4GMB A;  1MDA H;  1XKS A;  4ESG A;  5AFU 3;  5JWZ A;  2CO0 C;  2GC7 A;  2QZP A;  3CIK B;  4CI1 A;  1JMZ B;  4UM8 A;  3OL2 A;  3DSM A;  3SWS D;  1GOF A;  2Z2P A;  2P9K C;  4NSX A;  2B5N A;  4FA9 D;  1UTC A;  2J56 H;  3PXS D;  3SVW D;  1QFS A;  2BKL A;  5HYN B;  5HE2 B;  5FFO A;  4AN0 A;  3JRP A;  4JSP C;  4WK0 A;  2PM6 B;  2OVP B;  4LG9 A;  3V7D B;  2IUV A;  2VDM A;  5FQD A;  4A08 B;  4D6V A;  3ODT A;  4A09 A;  1M1X A;  2AGY A;  1L5G A;  3V4V A;  2VC2 A;  5IJ8 E;  4X61 B;  2GNQ A;  2AGZ A;  2UZY B;  1L0Q A;  2YNP A;  4AOW A;  5HE3 B;  5GMK n;  1SHY B;  2HES X;  2UZX B;  4JT5 C;  4AN1 A;  2Z2N A;  1K8K C;  4ES0 A;  3IIW A;  5THA A;  1VE6 A;  1SQ9 A;  2XYI A;  2BBK H;  4JHP C;  4A11 B;  4CZV A;  5SXM A;  4ERZ A;  4FHL A;  4Y5R D;  3FGB A;  3DXM C;  5I5M A;  2IUP A;  1B9Y A;  2VDP A;  2CN2 A;  4I79 A;  4PBZ A;  3F3G A;  3IKO A;  3EI3 B;  4J78 A;  5GXH A;  4X60 B;  3UVK A;  1PBY B;  2HU5 A;  4L3G D;  1N6E A;  2OJY A;  4QQE A;  3V5W B;  3EWE A;  2OK6 A;  3EI1 B;  3EI4 B;  3KRW B;  5HE0 B;  4PBY A; 
#chains in the Genus database with same CATH homology
 5IJ7 E;  1JJU B;  5C9Z B;  5FA5 B;  1NR0 A;  3RN1 D;  2AGW A;  4IA9 A;  3EMH A;  4J79 A;  1K32 A;  3PSL A;  4JXM A;  4GGC A;  5C2V B;  4L9O A;  2Q7Q A;  4E54 A;  4EWR A;  4ERQ A;  3SHF A;  5CXC B;  3VA6 A;  4QL1 A;  4PXW A;  4MK0 B;  3SBQ A;  3SFZ A;  3UKU C;  4GM3 A;  2HJ4 A;  4ZOZ A;  2J55 H;  5K1C C;  3RMZ D;  4K3I D;  1YFQ A;  2P9P C;  3A0F A;  1OMW B;  2P9N C;  2H6N A;  4E5Z A;  3I7P A;  4A0B B;  5FXY A;  5A2Q g;  3W15 A;  3BG1 A;  4GZ8 A;  2P9I C;  3DM0 A;  3AL8 A;  3C75 H;  4CZY A;  2XU7 A;  2IWK A;  5H17 A;  3SCY A;  2H6Q A;  1Q47 A;  2EBS A;  4J0W A;  4BL0 A;  3CFV A;  2AQ5 A;  4Y7R A;  4ZOY A;  4CY5 A;  3C9C A;  2HXC A;  4O3T B;  4ZOX A;  2P9U C;  3OL2 B;  1TBG A;  5B4W A;  3UVM A;  4GQB B;  3UVN A;  3DWL C;  2AGL A;  2G99 A;  2P9L C;  5I5I A;  4Z8L A;  2PBI B;  4O9D A;  4FAV D;  2XL2 A;  3UVO A;  4A09 B;  4J82 A;  5EM2 A;  1PEV A;  4OWR A;  3JZG A;  3J81 g;  3N0D A;  4FA1 D;  4J77 A;  3AH8 B;  3RN0 D;  5CYK A;  3MKQ A;  3SN6 B;  1TYQ C;  2H9L A;  3IIY A;  2CE9 A;  1FWX A;  4H5I A;  4UI9 R;  5KDO B;  3MKS B;  1XHM A;  4J8G A;  1R5M A;  5HQG A;  5EAP A;  3L4O D;  4X63 B;  3C99 A;  3JAM g;  4XEI C;  4LG8 A;  2I3T A;  4XYH A;  1GXR A;  1A0R B;  3FM0 A;  3F3F A;  4FWW A;  3F3P A;  3EU7 A;  2IUR A;  4PSX B;  4ZN4 A;  3PSC B;  3CFS B;  1NEX B;  5EMK B;  1QNI A;  3NVN A;  3PXT D;  4QT8 A;  2W18 A;  2BCJ B;  5HE1 B;  4AEZ A;  5TF2 A;  3KRX B;  4A7J A;  1U4C A;  5IGO A;  5C2W B;  4A2L A;  3SJL D;  4JSX C;  4E54 B;  2TRC B;  2H3X A;  4J8B A;  5FKS A;  3E0C A;  4JSN C;  2CN3 A;  5H14 A;  3RSE C;  2HYE A;  4HDJ A;  5TEE A;  1OLZ A;  2OVQ B;  5FKT A;  4ZOV A;  4GGD A;  3NVX A;  5IC7 A;  1JMX B;  4G56 B;  4BUJ C;  5TDH B;  1GP2 B;  3SXT D;  4U7A A;  2B4E A;  4FAN D;  3EI2 A;  2H9P A;  3U4Y A;  4E5Z B;  2H68 A;  3V9F A;  2I0T A;  3IJC A;  4J87 A;  1SQJ A;  2AH1 A;  5CXB A;  3IJ1 A;  3JB9 L;  2G9A A;  3AL8 B;  1JOF A;  3J80 g;  4L3H D;  4A0A A;  4CI3 A;  3I7O A;  2MTA H;  3MXX A;  4N14 A;  5AJA A;  3VH0 A;  1U2V C;  2PM9 A;  3HFQ A;  4GQ2 P;  4R7A B;  1VYH C;  4PNK B;  3OTT A;  3MZL A;  4KFM B;  4O1Q D;  3UVL A;  2Z2O A;  4JSV C;  3BWS A;  2HKR A;  5K19 A;  3RFG A;  4D0K A;  3AFC A;  2AH0 A;  2HKM A;  3K27 A;  3OW8 A;  5I5J A;  3B7F A;  3SMR A;  3PE7 A;  5AMS A;  5TEF A;  2OK4 A;  1PI6 A;  2HJB A;  2B5M A;  4CY3 A;  4O45 A;  4GGA A;  3DXK C;  4J81 A;  4A2M A;  4FB1 D;  3GFC A;  3OKY A;  2YBA A;  3PVU B;  3I7K A;  3I89 A;  5EMM B;  4YVD A;  1MG2 A;  3UR4 A;  2CE8 A;  5EM2 B;  4J86 A;  1GG2 B;  3OKW A;  2IAA A;  5GSA A;  1XIP A;  4K3J B;  3PXW D;  2H14 A;  2AGX A;  5CYK B;  3AL9 A;  2B5L A;  3JPX A;  3IJ0 A;  3VGZ A;  3RLM D;  4J73 A;  5IT9 g;  5EAR A;  4A08 A;  1N6F A;  3BG0 A;  4CY1 A;  5FKR A;  4TZ4 A;  4CY2 A;  3P4F A;  4LGN A;  3NVQ A;  4FA4 D;  4CI2 A;  3RRM C;  5FKQ A;  4U1E I;  3I7L A;  3SBP A;  3JRO A;  5EAL A;  4GQ1 A;  4A11 A;  4QRJ A;  4XYI A;  1S4U X;  4J0X A;  3PVW B;  1B9X A;  3ORV D;  3I8E A;  4X3E A;  3JZN A;  4CC9 A;  1N6D A;  3EI3 A;  2I3S A;  3I7N A;  4ERY A;  2P9S C;  3EG6 A;  2YB8 B;  2I0R A;  3RFH A;  3GRE A;  4J84 A;  4PC0 A;  2IWF A;  2XL3 A;  1GOT B;  3EI1 A;  3EI4 A;  4GM9 A;  1RI6 A;  4PSW B;  2H9M A;  3SBR A;  3C5M A;  3ULE C;  2H47 A;  3I7H A;  3I8C A;  1ERJ A;  2QC5 A;  5GXI A;  3FRX A;  4GM8 A;  3EI2 B;  5EML B;  2H6K A;  4JD2 C;  2QXV A;  4OZU A;  5CXC A;  4JT6 C;  5CXB B;  2OVR B;  3OKT A;  5EMJ B;  3ZWL B;  1PGU A;  4CZX A;  4A0A B;  5H1M A;  4CI8 A;  1MG3 A;  3JZH A;  3SLE D;  2PM9 B;  3K26 A;  4IMM A;  3MZK A;  2H9N A;  2OIZ A;  5EAM A;  2YNN A;  4FA5 D;  2YMU A;  2CO0 A;  4A0B A;  5IGQ A;  4O3U B;  2I0S A;  4L1Q D;  5FLX g;  4H5J A;  2CNX A;  2H13 A;  2J57 G;  3MMY A;  3N0E A;  3L4M D;  3I2N A;  3UKR C;  2YNO A;  2GC4 A;  3OKY B;  4BH6 A;  2IUQ A;  2PM7 B;  1P22 A;  2O9K A;  4GMB A;  1MDA H;  1XKS A;  4ESG A;  5AFU 3;  5JWZ A;  2CO0 C;  2GC7 A;  3CIK B;  4CI1 A;  1JMZ B;  3OL2 A;  3DSM A;  3SWS D;  2Z2P A;  2P9K C;  4NSX A;  2B5N A;  4FA9 D;  2J56 H;  3PXS D;  3SVW D;  5HYN B;  5HE2 B;  3JRP A;  4JSP C;  2PM6 B;  2OVP B;  4LG9 A;  3V7D B;  2IUV A;  5FQD A;  4A08 B;  4D6V A;  3ODT A;  4A09 A;  2AGY A;  5IJ8 E;  4X61 B;  2GNQ A;  2AGZ A;  2UZY B;  1L0Q A;  2YNP A;  4AOW A;  5HE3 B;  5GMK n;  1SHY B;  2HES X;  2UZX B;  4JT5 C;  2Z2N A;  1K8K C;  4ES0 A;  3IIW A;  5THA A;  1SQ9 A;  2XYI A;  2BBK H;  4A11 B;  4CZV A;  5SXM A;  4ERZ A;  4FHL A;  4Y5R D;  3FGB A;  3DXM C;  5I5M A;  2IUP A;  1B9Y A;  2CN2 A;  4I79 A;  4PBZ A;  3F3G A;  3IKO A;  3EI3 B;  4J78 A;  5GXH A;  4X60 B;  3UVK A;  1PBY B;  4L3G D;  1N6E A;  2OJY A;  4QQE A;  3V5W B;  3EWE A;  2OK6 A;  3EI1 B;  3EI4 B;  3KRW B;  5HE0 B;  4PBY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...