4CY1A

Crystal structure of the kansl1-wdr5 complex.
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
304
structure length
303
Chain Sequence
b'VKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WD REPEAT-CONTAINING PROTEIN 5
publication title Structural Analysis of the Kansl1/Wdr5/Kansl2 Complex Reveals that Wdr5 is Required for Efficient Assembly and Chromatin Targeting of the Nsl Complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 101
structure length 303
sequence length 304
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4cy1A00
4OWRA 5CYKA 3ORVD 1NEXB 4A2MA 5HQGA 2IUVA 4BUJC 2HJBA 3C99A 4A7JA 4A08B 1XKSA 4A08A 3EMHA 3ODTA 4X60B 5FKTA 4J77A 4PXWA 2YMUA 4PNKB 5C9ZB 2CN2A 3HFQA 2P9NC 4GGDA 5TEEA 3EU7A 5EARA 3K26A 3E0CA 2Z2NA 5IGQA 5C2WB 2CE8A 4GM8A 1N6DA 4GM9A 5EMMB 2H68A 2BBKH 3SLED 2PM6B 3N0DA 5I5MA 4ZOVA 5FXYA 2H47A 3I8CA 1R5MA 1S4UX 3OL2B 3DXMC 3OL2A 4BL0A 1SQ9A 3OW8A 4JSNC 2AGLA 4O1QD 4JSVC 2B5LA 1QNIA 2P9SC 3SBPA 5EALA 2HKRA 5CYKB 3BG0A 4XYHA 4GQBB 3J81g 3I7NA 4L3HD 2XL2A 3IJCA 2H9LA 4KFMB 3OKYA 4JD2C 3VA6A 1L0QA 4IA9A 4FB1D 3F3GA 1XIPA 3SBRA 2H6NA 2YBAA 2J57G 3OKWA 3OKTA 3KRWB 3MKSB 2OK4A 4PC0A 4BH6A 2EBSA 5IC7A 3DXKC 3NVXA 4L9OA 5JWZA 3UVMA 2IUPA 3RN0D 4H5IA 2HYEA 3L4MD 3EG6A 1GP2B 4CZYA 5IJ7E 3IKOA 5A2Qg 3SXTD 3FM0A 1JOFA 4GGCA 5AJAA 1P22A 1NR0A 4LG8A 3JPXA 4X63B 5CXBA 4E5ZB 4QT8A 3RMZD 4CI8A 4H5JA 4E5ZA 3FGBA 2YNNA 4K3ID 5I5JA 4Z8LA 1GOTB 3C9CA 4PSWB 3MXXA 5C2VB 2AGZA 4U7AA 4J79A 3PSCB 5THAA 1MG3A 2IWKA 4J8BA 2G9AA 4JSPC 1B9XA 4Y7RA 3MZKA 3EI2B 3EI2A 2G99A 2PBIB 1XHMA 2B4EA 1VYHC 2Z2PA 3JZGA 1FWXA 2B5NA 3UR4A 2B5MA 2MTAH 5FKQA 2AGYA 3IIWA 5AMSA 3UKRC 3NVNA 3IIYA 4GQ1A 2XU7A 3C5MA 3MMYA 3EI3B 2I3TA 3EI3A 3UVLA 5FLXg 3SBQA 3UVOA 4ERZA 4FA9D 2AH1A 3RSEC 4UI9R 1PBYB 1U4CA 5HE3B 4GQ2P 4GZ8A 3K27A 5HE0B 4CI3A 3SN6B 2GC4A 2AGXA 3U4YA 2H9NA 3N0EA 5IGOA 3DSMA 4CY3A 5EAPA 4A0AB 3IJ1A 2BCJB 4A0AA 5K19A 3EI1B 4FWWA 4A11B 3AL8B 4FA4D 3EI1A 4A11A 2H13A 3AL8A 4K3JB 4J87A 2P9IC 2YB8B 5H14A 3SHFA 1GG2B 1SHYB 3P4FA 4O9DA 4PSXB 4PBZA 5FKSA 3VGZA 5EAMA 3PE7A 4ERYA 1YFQA 3CFVA 3GREA 2AH0A 3JB9L 2HXCA 3SWSD 3PXTD 5B4WA 1U2VC 3RRMC 3I7PA 4ERQA 3I8EA 2W18A 3F3PA 5FQDA 4J78A 4XEIC 1PEVA 4ZN4A 5EMLB 2Z2OA 4AOWA 3PSLA 1RI6A 2AQ5A 4GMBA 2P9UC 3EWEA 5HE2B 3F3FA 3JZHA 2H9PA 4YVDA 3CIKB 3A0FA 4J86A 2H9MA 5EMJB 3SJLD 2I0RA 4A2LA 5TF2A 1OLZA 2PM9B 2PM9A 5TDHB 3I7HA 4O3TB 2XL3A 4A0BB 4FA5D 3RN1D 4A0BA 2HJ4A 2OJYA 2OVRB 2GC7A 5EM2B 2CNXA 2H6QA 2HESX 3VH0A 4CY2A 2J55H 3I89A 3JZNA 5IT9g 1TYQC 4GGAA 3L4OD 3IJ0A 3I7KA 4JXMA 1JMZB 2UZXB 4FA1D 4LG9A 3MKQA 5I5IA 3SMRA 4J82A 5H1MA 1Q47A 3EI4B 2YNOA 3DWLC 3EI4A 4IMMA 4L3GD 4PBYA 4TZ4A 3PVWB 4ZOYA 2H6KA 1PGUA 2I3SA 3ULEC 3UVNA 3SFZA 3V7DB 4J84A 1N6EA 4JT6C 5TEFA 4EWRA 3I2NA 3I7OA 3OTTA 3BG1A 3RFGA 4D6VA 4CZVA 3ZWLB 2I0SA 5GMKn 1JJUB 4ZOXA 4X61B 4R7AB 4MK0B 4O45A 4AEZA 5EMKB 3NVQA 4I79A 3SCYA 2J56H 5H17A 1A0RB 4CI2A 1TBGA 3PXSD 4Y5RD 4O3UB 4J81A 5IJ8E 2IWFA 2CE9A 2OVQB 3KRXB 2OVPB 3MZLA 4G56B 3J80g 4A09B 4ES0A 1OMWB 4A09A 2XYIA 3UVKA 4ZOZA 3RLMD 3FRXA 2HKMA 5KDOB 4N14A 3PVUB 4FHLA 2QC5A 4J0WA 4CY5A 4NSXA 5GSAA 3I7LA 5FKRA 2I0TA 3CFSB 4OZUA 5FA5B 3B7FA 2UZYB 4J0XA 2IAAA 2OK6A 2P9KC 4FAVD 2IUQA 1GXRA 4E54B 3PXWD 5K1CC 2Q7QA 3BWSA 4E54A 2IURA 2P9LC 1K32A 2AGWA 1SQJA 2CN3A 4GM3A 3OKYB 3JRPA 4X3EA 1PI6A 2GNQA 2QXVA 4J8GA 2CO0A 3DM0A 4L1QD 2P9PC 3SVWD 4U1EI 2OIZA 1ERJA 2PM7B 3JAMg 4XYIA 1K8KC 4JT5C 1MDAH 4CZXA 1JMXB 4QRJA 4CY1A 4QQEA 4LGNA 5HE1B 4CI1A 1MG2A 2YNPA 4QL1A 3V5WB 4HDJA 4FAND 3UKUC 2CO0C 4CC9A 2TRCB 3RFHA 5GXIA 3C75H 5AFU3 4D0KA 3JROA 4JSXC 5CXBB 5EM2A 5HYNB 2H3XA 1N6FA 3AH8B 5SXMA 5CXCB 2H14A 3W15A 4J73A 5GXHA 5CXCA 3GFCA 3V9FA 1B9YA 4ESGA 3AL9A 2O9KA 3AFCA
chains in the Genus database with same CATH superfamily
4OWRA 5CYKA 1M1XA 1NEXB 3ORVD 4A2MA 5HQGA 2IUVA 3O4JA 4BUJC 3ZDXA 2HJBA 3C99A 4QAMA 4BP8A 2VC2A 4A7JA 1H2WA 4A08B 2VDNA 1XKSA 4L1MA 4A08A 3EMHA 3ODTA 1O6GA 3MVDK 4X60B 5FKTA 5C92A 4J77A 4PXWA 2YMUA 4PNKB 5C9ZB 2CN2A 2HU8A 3HFQA 2P9NC 4GGDA 5TEEA 3EU7A 5EARA 4DNUA 3K26A 4MMYA 3E0CA 2Z2NA 2VDLA 5IGQA 4WK0A 5C2WB 2CE8A 4GM8A 1N6DA 3ZE2A 4GM9A 5EMMB 2H68A 2BBKH 2QZPA 3SLED 2PM6B 3N0DA 5I5MA 4ZOVA 5FXYA 2H47A 3I8CA 1R5MA 1S4UX 3MUNA 4AN0A 3V4VA 3OL2B 3DXMC 2VDMA 1UTCA 3OL2A 4RE5A 4BL0A 1SQ9A 3OW8A 3K71A 4BCBA 2AGLA 4JSNC 4O1QD 2VDQA 4JSVC 2B5LA 1QNIA 2P9SC 4O02A 3SBPA 3IUMA 1I2MB 1BPOA 5EALA 1U8CA 2HKRA 5CYKB 3BG0A 4XYHA 4AX4A 4GQBB 3J81g 3I7NA 4MMZA 4L3HD 2XL2A 1VZ2A 3IJCA 2H9LA 3T3PA 4KFMB 3OKYA 4JD2C 3VA6A 1L0QA 4IA9A 4FB1D 3F3GA 1XIPA 3SBRA 2H6NA 2YBAA 2J57G 3OKWA 1YR2A 3IUJA 3NIDA 3KRWB 3OKTA 3MKSB 5E6SA 2OK4A 2EICA 4PC0A 4BH6A 2EBSA 5IC7A 3DXKC 3NVXA 4L9OA 5JWZA 3UVMA 2IUPA 1JV2A 3RN0D 4H5IA 2HYEA 1GOGA 5M5VA 3L4MD 3EG6A 1GP2B 4CZYA 5IJ7E 3IKOA 3FCSA 3ZDYA 5A2Qg 4AMZA 3SXTD 4BCCA 3FM0A 1JOFA 4GGCA 1H2YA 5AJAA 1P22A 1NR0A 2VDOA 1GOFA 3JPXA 3NIGA 4LG8A 4X63B 5CXBA 4E5ZB 4QT8A 3RMZD 4CI8A 4H5JA 4E5ZA 1L5GA 2YNNA 3FGBA 4K3ID 5I5JA 4Z8LA 1GOTB 3C9CA 4PSWB 3MXXA 5C2VB 2AGZA 4AMYA 1VE6A 2JKXA 2XZGA 4U7AA 3ZE1A 4J79A 3PSCB 5THAA 1MG3A 1QFSA 2IWKA 3O4GA 4J8BA 2G9AA 2EIEA 1B9XA 4JSPC 4Y7RA 2BKLA 3MZKA 3EI2B 3IURA 1T2XA 3EI2A 2G99A 2PBIB 1XHMA 4JHPC 2B4EA 1VYHC 2Z2PA 5M5SA 3JZGA 1FWXA 5M5UA 2B5NA 2VZ3A 3UR4A 2B5MA 4DNVA 3K6SA 2MTAH 5FKQA 2AGYA 3IIWA 5AMSA 3UKRC 3NVNA 3IIYA 4IRZA 4GQ1A 2XU7A 3C5MA 3MMYA 3EI3B 2I3TA 3EI3A 3UVLA 2EIDA 4RE6A 5FLXg 3EQ8A 3SBQA 3UVOA 4ERZA 4FA9D 2AH1A 3RSEC 4UI9R 1PBYB 4DNWA 1U4CA 5HE3B 4GQ2P 4GZ8A 2HU7A 4G1MA 3K27A 5HE0B 4UM9A 4CI3A 3SN6B 2GC4A 2AGXA 2VDRA 3U4YA 2H9NA 3N0EA 5IGOA 3DSMA 4G1EA 4CY3A 5EAPA 4A0AB 3IJ1A 2BCJB 4A0AA 5K19A 3EI1B 4FWWA 4A11B 3AL8B 4FA4D 3EI1A 4A11A 1GOHA 2H13A 3AL8A 4K3JB 4J87A 4MMXA 2P9IC 2YB8B 5H14A 1C9LA 1GG2B 1SHYB 3SHFA 2XDWA 3P4FA 4O9DA 4NENA 3OF7A 4PSXB 4PBZA 5FKSA 3VGZA 5EAMA 3PE7A 4ERYA 3IULA 1YFQA 3CFVA 3GREA 2AH0A 3JB9L 3ZDZA 2HXCA 3SWSD 4JHNA 3PXTD 5B4WA 1U2VC 3RRMC 3I7PA 4ERQA 3I8EA 5C86A 2W18A 3F3PA 5FQDA 4J78A 4XEIC 1PEVA 4ZN4A 5EMLB 2VDKA 2Z2OA 4AOWA 3PSLA 1RI6A 2AQ5A 2VZ1A 3QHYB 2QR5A 4NBMA 4GMBA 2P9UC 3EWEA 5FFOA 4Z7QA 5HE2B 5M61A 3F3FA 3JZHA 2H9PA 1E5TA 4YVDA 3CIKB 3A0FA 4J86A 2H9MA 5EMJB 3SJLD 1UOOA 2I0RA 4A2LA 5TF2A 1OLZA 2PM9B 2PM9A 5TDHB 5HDBA 3I7HA 4O3TB 2XL3A 4O2WA 4A0BB 4FA5D 3RN1D 2HU5A 4A0BA 2HJ4A 2OJYA 2OVRB 1H2XA 1E8NA 2GC7A 5EM2B 2CNXA 2H6QA 2HESX 3VH0A 4CY2A 2J55H 3I89A 3JZNA 5IT9g 1TYQC 3GC3B 4GGAA 3L4OD 3IJ0A 3I7KA 2WQ8A 3V4PA 4JXMA 1JMZB 2UZXB 4FA1D 4LG9A 3MKQA 5I5IA 3SMRA 4NC4A 4J82A 5H1MA 4AN1A 1Q47A 3EI4B 5M5RA 2YNOA 3DWLC 3EI4A 4IMMA 4L3GD 4PBYA 4TZ4A 3PVWB 1C9IA 3VI4A 1A12A 4ZOYA 2H6KA 1PGUA 2I3SA 3ULEC 3UVNA 3SFZA 3V7DB 4J84A 1N6EA 4JT6C 5TEFA 4EWRA 3I2NA 3I7OA 3OTTA 5E6RA 3BG1A 3RFGA 4D6VA 3ZE0A 4CZVA 3ZWLB 2I0SA 5GMKn 1JJUB 4ZOXA 4X61B 4R7AB 4MK0B 1QFMA 4O45A 4AEZA 5EMKB 3NVQA 2EIBA 4I79A 3SCYA 2J56H 5H17A 1A0RB 3FCUA 4CI2A 4D9SA 1TBGA 3PXSD 1O6FA 4Y5RD 4O3UB 4J81A 5IJ8E 1H2ZA 2IWFA 2CE9A 1VE7A 2OVQB 3KRXB 2OVPB 3MZLA 3O4IA 4G56B 3J80g 5FFGA 4A09B 4ES0A 4WK4A 1OMWB 4BCDA 4A09A 2XYIA 3UVKA 4ZOZA 3RLMD 3FRXA 2HKMA 3DDUA 5KDOB 4N14A 3PVUB 4FHLA 2QC5A 4J0WA 4CY5A 4NSXA 5GSAA 3I7LA 5FKRA 1TYEA 4G55A 2I0TA 3CFSB 3O4HA 4OZUA 3VI3A 5FA5B 3B7FA 3MUOA 3K72A 2UZYB 4J0XA 2IAAA 2OK6A 2P9KC 4FAVD 2IUQA 4WK2A 3IUNA 1GXRA 4BP9A 4E54B 3PXWD 5K1CC 2Q7QA 3BWSA 4E54A 3KCIA 1JTDB 2IURA 2P9LC 1K32A 2AGWA 3EQ7A 1SQJA 2CN3A 4GM3A 3OKYB 1VZ3A 3JRPA 4X3EA 1PI6A 2GNQA 2QXVA 4J8GA 2CO0A 3DM0A 4L1QD 2P9PC 3SVWD 3GD1I 4U1EI 2OIZA 1ERJA 4Z7NA 2XE4A 3NIFA 3QI0A 2PM7B 3JAMg 4XYIA 1K8KC 4JT5C 4WJKA 1MDAH 4CZXA 1JMXB 4QRJA 4CY1A 3IJEA 1UOQA 4QQEA 4LGNA 5HE1B 4CI1A 1MG2A 2YNPA 4QL1A 3V5WB 3IUQA 4HDJA 4FAND 3UKUC 5M5TA 2CO0C 5E6UA 4NAAA 4CC9A 2TRCB 3RFHA 1UOPA 5GXIA 3C75H 5AFU3 4D0KA 3JROA 4JSXC 5CXBB 5EM2A 5HYNB 1E8MA 2H3XA 1N6FA 3AH8B 5SXMA 5CXCB 4Z7OA 2H14A 3W15A 4J73A 5GXHA 2VDPA 3EQ9A 3GFCA 5CXCA 1K3IA 3V9FA 1B9YA 4UM8A 4ESGA 3IVMA 3AL9A 3T3MA 2O9KA 3AFCA
chains in the Genus database with same CATH topology
4OWRA 5CYKA 3ORVD 1NEXB 4A2MA 5HQGA 2IUVA 4BUJC 2HJBA 3C99A 4A7JA 4A08B 1XKSA 4A08A 3EMHA 3ODTA 4X60B 5FKTA 4J77A 4PXWA 2YMUA 4PNKB 5C9ZB 2CN2A 3HFQA 2P9NC 4GGDA 5TEEA 3EU7A 5EARA 3K26A 3E0CA 2Z2NA 5IGQA 5C2WB 2CE8A 4GM8A 1N6DA 4GM9A 5EMMB 2H68A 2BBKH 3SLED 2PM6B 3N0DA 5I5MA 4ZOVA 5FXYA 2H47A 3I8CA 1R5MA 1S4UX 3OL2B 3DXMC 3OL2A 4BL0A 1SQ9A 3OW8A 4JSNC 2AGLA 4O1QD 4JSVC 2B5LA 1QNIA 2P9SC 3SBPA 5EALA 2HKRA 5CYKB 3BG0A 4XYHA 4GQBB 3J81g 3I7NA 4L3HD 2XL2A 3IJCA 2H9LA 4KFMB 3OKYA 4JD2C 3VA6A 1L0QA 4IA9A 4FB1D 3F3GA 1XIPA 3SBRA 2H6NA 2YBAA 2J57G 3OKWA 3OKTA 3KRWB 3MKSB 2OK4A 4PC0A 4BH6A 2EBSA 5IC7A 3DXKC 3NVXA 4L9OA 5JWZA 3UVMA 2IUPA 3RN0D 4H5IA 2HYEA 3L4MD 3EG6A 1GP2B 4CZYA 5IJ7E 3IKOA 5A2Qg 3SXTD 3FM0A 1JOFA 4GGCA 5AJAA 1P22A 1NR0A 4LG8A 3JPXA 4X63B 5CXBA 4E5ZB 4QT8A 3RMZD 4CI8A 4H5JA 4E5ZA 3FGBA 2YNNA 4K3ID 5I5JA 4Z8LA 1GOTB 3C9CA 4PSWB 3MXXA 5C2VB 2AGZA 4U7AA 4J79A 3PSCB 5THAA 1MG3A 2IWKA 4J8BA 2G9AA 4JSPC 1B9XA 4Y7RA 3MZKA 3EI2B 3EI2A 2G99A 2PBIB 1XHMA 2B4EA 1VYHC 2Z2PA 3JZGA 1FWXA 2B5NA 3UR4A 2B5MA 2MTAH 5FKQA 2AGYA 3IIWA 5AMSA 3UKRC 3NVNA 3IIYA 4GQ1A 2XU7A 3C5MA 3MMYA 3EI3B 2I3TA 3EI3A 3UVLA 5FLXg 3SBQA 3UVOA 4ERZA 4FA9D 2AH1A 3RSEC 4UI9R 1PBYB 1U4CA 5HE3B 4GQ2P 4GZ8A 3K27A 5HE0B 4CI3A 3SN6B 2GC4A 2AGXA 3U4YA 2H9NA 3N0EA 5IGOA 3DSMA 4CY3A 5EAPA 4A0AB 3IJ1A 2BCJB 4A0AA 5K19A 3EI1B 4FWWA 4A11B 3AL8B 4FA4D 3EI1A 4A11A 2H13A 3AL8A 4K3JB 4J87A 2P9IC 2YB8B 5H14A 3SHFA 1GG2B 1SHYB 3P4FA 4O9DA 4PSXB 4PBZA 5FKSA 3VGZA 5EAMA 3PE7A 4ERYA 1YFQA 3CFVA 3GREA 2AH0A 3JB9L 2HXCA 3SWSD 3PXTD 5B4WA 1U2VC 3RRMC 3I7PA 4ERQA 3I8EA 2W18A 3F3PA 5FQDA 4J78A 4XEIC 1PEVA 4ZN4A 5EMLB 2Z2OA 4AOWA 3PSLA 1RI6A 2AQ5A 4GMBA 2P9UC 3EWEA 5HE2B 3F3FA 3JZHA 2H9PA 4YVDA 3CIKB 3A0FA 4J86A 2H9MA 5EMJB 3SJLD 2I0RA 4A2LA 5TF2A 1OLZA 2PM9B 2PM9A 5TDHB 3I7HA 4O3TB 2XL3A 4A0BB 4FA5D 3RN1D 4A0BA 2HJ4A 2OJYA 2OVRB 2GC7A 5EM2B 2CNXA 2H6QA 2HESX 3VH0A 4CY2A 2J55H 3I89A 3JZNA 5IT9g 1TYQC 4GGAA 3L4OD 3IJ0A 3I7KA 4JXMA 1JMZB 2UZXB 4FA1D 4LG9A 3MKQA 5I5IA 3SMRA 4J82A 5H1MA 1Q47A 3EI4B 2YNOA 3DWLC 3EI4A 4IMMA 4L3GD 4PBYA 4TZ4A 3PVWB 4ZOYA 2H6KA 1PGUA 2I3SA 3ULEC 3UVNA 3SFZA 3V7DB 4J84A 1N6EA 4JT6C 5TEFA 4EWRA 3I2NA 3I7OA 3OTTA 3BG1A 3RFGA 4D6VA 4CZVA 3ZWLB 2I0SA 5GMKn 1JJUB 4ZOXA 4X61B 4R7AB 4MK0B 4O45A 4AEZA 5EMKB 3NVQA 4I79A 3SCYA 2J56H 5H17A 1A0RB 4CI2A 1TBGA 3PXSD 4Y5RD 4O3UB 4J81A 5IJ8E 2IWFA 2CE9A 2OVQB 3KRXB 2OVPB 3MZLA 4G56B 3J80g 4A09B 4ES0A 1OMWB 4A09A 2XYIA 3UVKA 4ZOZA 3RLMD 3FRXA 2HKMA 5KDOB 4N14A 3PVUB 4FHLA 2QC5A 4J0WA 4CY5A 4NSXA 5GSAA 3I7LA 5FKRA 2I0TA 3CFSB 4OZUA 5FA5B 3B7FA 2UZYB 4J0XA 2IAAA 2OK6A 2P9KC 4FAVD 2IUQA 1GXRA 4E54B 3PXWD 5K1CC 2Q7QA 3BWSA 4E54A 2IURA 2P9LC 1K32A 2AGWA 1SQJA 2CN3A 4GM3A 3OKYB 3JRPA 4X3EA 1PI6A 2GNQA 2QXVA 4J8GA 2CO0A 3DM0A 4L1QD 2P9PC 3SVWD 4U1EI 2OIZA 1ERJA 2PM7B 3JAMg 4XYIA 1K8KC 4JT5C 1MDAH 4CZXA 1JMXB 4QRJA 4CY1A 4QQEA 4LGNA 5HE1B 4CI1A 1MG2A 2YNPA 4QL1A 3V5WB 4HDJA 4FAND 3UKUC 2CO0C 4CC9A 2TRCB 3RFHA 5GXIA 3C75H 5AFU3 4D0KA 3JROA 4JSXC 5CXBB 5EM2A 5HYNB 2H3XA 1N6FA 3AH8B 5SXMA 5CXCB 2H14A 3W15A 4J73A 5GXHA 5CXCA 3GFCA 3V9FA 1B9YA 4ESGA 3AL9A 2O9KA 3AFCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OWR A;  5CYK A;  3ORV D;  1NEX B;  4A2M A;  5HQG A;  2IUV A;  4BUJ C;  2HJB A;  3C99 A;  4A7J A;  4A08 B;  1XKS A;  4A08 A;  3EMH A;  3ODT A;  4X60 B;  5FKT A;  4J77 A;  4PXW A;  2YMU A;  4PNK B;  5C9Z B;  2CN2 A;  3HFQ A;  2P9N C;  4GGD A;  5TEE A;  3EU7 A;  5EAR A;  3K26 A;  3E0C A;  2Z2N A;  5IGQ A;  5C2W B;  2CE8 A;  4GM8 A;  1N6D A;  4GM9 A;  5EMM B;  2H68 A;  2BBK H;  3SLE D;  2PM6 B;  3N0D A;  5I5M A;  4ZOV A;  5FXY A;  2H47 A;  3I8C A;  1R5M A;  1S4U X;  3OL2 B;  3DXM C;  3OL2 A;  4BL0 A;  1SQ9 A;  3OW8 A;  4JSN C;  2AGL A;  4O1Q D;  4JSV C;  2B5L A;  1QNI A;  2P9S C;  3SBP A;  5EAL A;  2HKR A;  5CYK B;  3BG0 A;  4XYH A;  4GQB B;  3J81 g;  3I7N A;  4L3H D;  2XL2 A;  3IJC A;  2H9L A;  4KFM B;  3OKY A;  4JD2 C;  3VA6 A;  1L0Q A;  4IA9 A;  4FB1 D;  3F3G A;  1XIP A;  3SBR A;  2H6N A;  2YBA A;  2J57 G;  3OKW A;  3OKT A;  3KRW B;  3MKS B;  2OK4 A;  4PC0 A;  4BH6 A;  2EBS A;  5IC7 A;  3DXK C;  3NVX A;  4L9O A;  5JWZ A;  3UVM A;  2IUP A;  3RN0 D;  4H5I A;  2HYE A;  3L4M D;  3EG6 A;  1GP2 B;  4CZY A;  5IJ7 E;  3IKO A;  5A2Q g;  3SXT D;  3FM0 A;  1JOF A;  4GGC A;  5AJA A;  1P22 A;  1NR0 A;  4LG8 A;  3JPX A;  4X63 B;  5CXB A;  4E5Z B;  4QT8 A;  3RMZ D;  4CI8 A;  4H5J A;  4E5Z A;  3FGB A;  2YNN A;  4K3I D;  5I5J A;  4Z8L A;  1GOT B;  3C9C A;  4PSW B;  3MXX A;  5C2V B;  2AGZ A;  4U7A A;  4J79 A;  3PSC B;  5THA A;  1MG3 A;  2IWK A;  4J8B A;  2G9A A;  4JSP C;  1B9X A;  4Y7R A;  3MZK A;  3EI2 B;  3EI2 A;  2G99 A;  2PBI B;  1XHM A;  2B4E A;  1VYH C;  2Z2P A;  3JZG A;  1FWX A;  2B5N A;  3UR4 A;  2B5M A;  2MTA H;  5FKQ A;  2AGY A;  3IIW A;  5AMS A;  3UKR C;  3NVN A;  3IIY A;  4GQ1 A;  2XU7 A;  3C5M A;  3MMY A;  3EI3 B;  2I3T A;  3EI3 A;  3UVL A;  5FLX g;  3SBQ A;  3UVO A;  4ERZ A;  4FA9 D;  2AH1 A;  3RSE C;  4UI9 R;  1PBY B;  1U4C A;  5HE3 B;  4GQ2 P;  4GZ8 A;  3K27 A;  5HE0 B;  4CI3 A;  3SN6 B;  2GC4 A;  2AGX A;  3U4Y A;  2H9N A;  3N0E A;  5IGO A;  3DSM A;  4CY3 A;  5EAP A;  4A0A B;  3IJ1 A;  2BCJ B;  4A0A A;  5K19 A;  3EI1 B;  4FWW A;  4A11 B;  3AL8 B;  4FA4 D;  3EI1 A;  4A11 A;  2H13 A;  3AL8 A;  4K3J B;  4J87 A;  2P9I C;  2YB8 B;  5H14 A;  3SHF A;  1GG2 B;  1SHY B;  3P4F A;  4O9D A;  4PSX B;  4PBZ A;  5FKS A;  3VGZ A;  5EAM A;  3PE7 A;  4ERY A;  1YFQ A;  3CFV A;  3GRE A;  2AH0 A;  3JB9 L;  2HXC A;  3SWS D;  3PXT D;  5B4W A;  1U2V C;  3RRM C;  3I7P A;  4ERQ A;  3I8E A;  2W18 A;  3F3P A;  5FQD A;  4J78 A;  4XEI C;  1PEV A;  4ZN4 A;  5EML B;  2Z2O A;  4AOW A;  3PSL A;  1RI6 A;  2AQ5 A;  4GMB A;  2P9U C;  3EWE A;  5HE2 B;  3F3F A;  3JZH A;  2H9P A;  4YVD A;  3CIK B;  3A0F A;  4J86 A;  2H9M A;  5EMJ B;  3SJL D;  2I0R A;  4A2L A;  5TF2 A;  1OLZ A;  2PM9 B;  2PM9 A;  5TDH B;  3I7H A;  4O3T B;  2XL3 A;  4A0B B;  4FA5 D;  3RN1 D;  4A0B A;  2HJ4 A;  2OJY A;  2OVR B;  2GC7 A;  5EM2 B;  2CNX A;  2H6Q A;  2HES X;  3VH0 A;  4CY2 A;  2J55 H;  3I89 A;  3JZN A;  5IT9 g;  1TYQ C;  4GGA A;  3L4O D;  3IJ0 A;  3I7K A;  4JXM A;  1JMZ B;  2UZX B;  4FA1 D;  4LG9 A;  3MKQ A;  5I5I A;  3SMR A;  4J82 A;  5H1M A;  1Q47 A;  3EI4 B;  2YNO A;  3DWL C;  3EI4 A;  4IMM A;  4L3G D;  4PBY A;  4TZ4 A;  3PVW B;  4ZOY A;  2H6K A;  1PGU A;  2I3S A;  3ULE C;  3UVN A;  3SFZ A;  3V7D B;  4J84 A;  1N6E A;  4JT6 C;  5TEF A;  4EWR A;  3I2N A;  3I7O A;  3OTT A;  3BG1 A;  3RFG A;  4D6V A;  4CZV A;  3ZWL B;  2I0S A;  5GMK n;  1JJU B;  4ZOX A;  4X61 B;  4R7A B;  4MK0 B;  4O45 A;  4AEZ A;  5EMK B;  3NVQ A;  4I79 A;  3SCY A;  2J56 H;  5H17 A;  1A0R B;  4CI2 A;  1TBG A;  3PXS D;  4Y5R D;  4O3U B;  4J81 A;  5IJ8 E;  2IWF A;  2CE9 A;  2OVQ B;  3KRX B;  2OVP B;  3MZL A;  4G56 B;  3J80 g;  4A09 B;  4ES0 A;  1OMW B;  4A09 A;  2XYI A;  3UVK A;  4ZOZ A;  3RLM D;  3FRX A;  2HKM A;  5KDO B;  4N14 A;  3PVU B;  4FHL A;  2QC5 A;  4J0W A;  4CY5 A;  4NSX A;  5GSA A;  3I7L A;  5FKR A;  2I0T A;  3CFS B;  4OZU A;  5FA5 B;  3B7F A;  2UZY B;  4J0X A;  2IAA A;  2OK6 A;  2P9K C;  4FAV D;  2IUQ A;  1GXR A;  4E54 B;  3PXW D;  5K1C C;  2Q7Q A;  3BWS A;  4E54 A;  2IUR A;  2P9L C;  1K32 A;  2AGW A;  1SQJ A;  2CN3 A;  4GM3 A;  3OKY B;  3JRP A;  4X3E A;  1PI6 A;  2GNQ A;  2QXV A;  4J8G A;  2CO0 A;  3DM0 A;  4L1Q D;  2P9P C;  3SVW D;  4U1E I;  2OIZ A;  1ERJ A;  2PM7 B;  3JAM g;  4XYI A;  1K8K C;  4JT5 C;  1MDA H;  4CZX A;  1JMX B;  4QRJ A;  4CY1 A;  4QQE A;  4LGN A;  5HE1 B;  4CI1 A;  1MG2 A;  2YNP A;  4QL1 A;  3V5W B;  4HDJ A;  4FAN D;  3UKU C;  2CO0 C;  4CC9 A;  2TRC B;  3RFH A;  5GXI A;  3C75 H;  5AFU 3;  4D0K A;  3JRO A;  4JSX C;  5CXB B;  5EM2 A;  5HYN B;  2H3X A;  1N6F A;  3AH8 B;  5SXM A;  5CXC B;  2H14 A;  3W15 A;  4J73 A;  5GXH A;  5CXC A;  3GFC A;  3V9F A;  1B9Y A;  4ESG A;  3AL9 A;  2O9K A;  3AFC A; 
#chains in the Genus database with same CATH topology
 4OWR A;  5CYK A;  1M1X A;  1NEX B;  3ORV D;  4A2M A;  5HQG A;  2IUV A;  3O4J A;  4BUJ C;  3ZDX A;  2HJB A;  3C99 A;  4QAM A;  4BP8 A;  2VC2 A;  4A7J A;  1H2W A;  4A08 B;  2VDN A;  1XKS A;  4L1M A;  4A08 A;  3EMH A;  3ODT A;  1O6G A;  3MVD K;  4X60 B;  5FKT A;  5C92 A;  4J77 A;  4PXW A;  2YMU A;  4PNK B;  5C9Z B;  2CN2 A;  2HU8 A;  3HFQ A;  2P9N C;  4GGD A;  5TEE A;  3EU7 A;  5EAR A;  4DNU A;  3K26 A;  4MMY A;  3E0C A;  2Z2N A;  2VDL A;  5IGQ A;  4WK0 A;  5C2W B;  2CE8 A;  4GM8 A;  1N6D A;  3ZE2 A;  4GM9 A;  5EMM B;  2H68 A;  2BBK H;  2QZP A;  3SLE D;  2PM6 B;  3N0D A;  5I5M A;  4ZOV A;  5FXY A;  2H47 A;  3I8C A;  1R5M A;  1S4U X;  3MUN A;  4AN0 A;  3V4V A;  3OL2 B;  3DXM C;  2VDM A;  1UTC A;  3OL2 A;  4RE5 A;  4BL0 A;  1SQ9 A;  3OW8 A;  3K71 A;  4BCB A;  2AGL A;  4JSN C;  4O1Q D;  2VDQ A;  4JSV C;  2B5L A;  1QNI A;  2P9S C;  4O02 A;  3SBP A;  3IUM A;  1I2M B;  1BPO A;  5EAL A;  1U8C A;  2HKR A;  5CYK B;  3BG0 A;  4XYH A;  4AX4 A;  4GQB B;  3J81 g;  3I7N A;  4MMZ A;  4L3H D;  2XL2 A;  1VZ2 A;  3IJC A;  2H9L A;  3T3P A;  4KFM B;  3OKY A;  4JD2 C;  3VA6 A;  1L0Q A;  4IA9 A;  4FB1 D;  3F3G A;  1XIP A;  3SBR A;  2H6N A;  2YBA A;  2J57 G;  3OKW A;  1YR2 A;  3IUJ A;  3NID A;  3KRW B;  3OKT A;  3MKS B;  5E6S A;  2OK4 A;  2EIC A;  4PC0 A;  4BH6 A;  2EBS A;  5IC7 A;  3DXK C;  3NVX A;  4L9O A;  5JWZ A;  3UVM A;  2IUP A;  1JV2 A;  3RN0 D;  4H5I A;  2HYE A;  1GOG A;  5M5V A;  3L4M D;  3EG6 A;  1GP2 B;  4CZY A;  5IJ7 E;  3IKO A;  3FCS A;  3ZDY A;  5A2Q g;  4AMZ A;  3SXT D;  4BCC A;  3FM0 A;  1JOF A;  4GGC A;  1H2Y A;  5AJA A;  1P22 A;  1NR0 A;  2VDO A;  1GOF A;  3JPX A;  3NIG A;  4LG8 A;  4X63 B;  5CXB A;  4E5Z B;  4QT8 A;  3RMZ D;  4CI8 A;  4H5J A;  4E5Z A;  1L5G A;  2YNN A;  3FGB A;  4K3I D;  5I5J A;  4Z8L A;  1GOT B;  3C9C A;  4PSW B;  3MXX A;  5C2V B;  2AGZ A;  4AMY A;  1VE6 A;  2JKX A;  2XZG A;  4U7A A;  3ZE1 A;  4J79 A;  3PSC B;  5THA A;  1MG3 A;  1QFS A;  2IWK A;  3O4G A;  4J8B A;  2G9A A;  2EIE A;  1B9X A;  4JSP C;  4Y7R A;  2BKL A;  3MZK A;  3EI2 B;  3IUR A;  1T2X A;  3EI2 A;  2G99 A;  2PBI B;  1XHM A;  4JHP C;  2B4E A;  1VYH C;  2Z2P A;  5M5S A;  3JZG A;  1FWX A;  5M5U A;  2B5N A;  2VZ3 A;  3UR4 A;  2B5M A;  4DNV A;  3K6S A;  2MTA H;  5FKQ A;  2AGY A;  3IIW A;  5AMS A;  3UKR C;  3NVN A;  3IIY A;  4IRZ A;  4GQ1 A;  2XU7 A;  3C5M A;  3MMY A;  3EI3 B;  2I3T A;  3EI3 A;  3UVL A;  2EID A;  4RE6 A;  5FLX g;  3EQ8 A;  3SBQ A;  3UVO A;  4ERZ A;  4FA9 D;  2AH1 A;  3RSE C;  4UI9 R;  1PBY B;  4DNW A;  1U4C A;  5HE3 B;  4GQ2 P;  4GZ8 A;  2HU7 A;  4G1M A;  3K27 A;  5HE0 B;  4UM9 A;  4CI3 A;  3SN6 B;  2GC4 A;  2AGX A;  2VDR A;  3U4Y A;  2H9N A;  3N0E A;  5IGO A;  3DSM A;  4G1E A;  4CY3 A;  5EAP A;  4A0A B;  3IJ1 A;  2BCJ B;  4A0A A;  5K19 A;  3EI1 B;  4FWW A;  4A11 B;  3AL8 B;  4FA4 D;  3EI1 A;  4A11 A;  1GOH A;  2H13 A;  3AL8 A;  4K3J B;  4J87 A;  4MMX A;  2P9I C;  2YB8 B;  5H14 A;  1C9L A;  1GG2 B;  1SHY B;  3SHF A;  2XDW A;  3P4F A;  4O9D A;  4NEN A;  3OF7 A;  4PSX B;  4PBZ A;  5FKS A;  3VGZ A;  5EAM A;  3PE7 A;  4ERY A;  3IUL A;  1YFQ A;  3CFV A;  3GRE A;  2AH0 A;  3JB9 L;  3ZDZ A;  2HXC A;  3SWS D;  4JHN A;  3PXT D;  5B4W A;  1U2V C;  3RRM C;  3I7P A;  4ERQ A;  3I8E A;  5C86 A;  2W18 A;  3F3P A;  5FQD A;  4J78 A;  4XEI C;  1PEV A;  4ZN4 A;  5EML B;  2VDK A;  2Z2O A;  4AOW A;  3PSL A;  1RI6 A;  2AQ5 A;  2VZ1 A;  3QHY B;  2QR5 A;  4NBM A;  4GMB A;  2P9U C;  3EWE A;  5FFO A;  4Z7Q A;  5HE2 B;  5M61 A;  3F3F A;  3JZH A;  2H9P A;  1E5T A;  4YVD A;  3CIK B;  3A0F A;  4J86 A;  2H9M A;  5EMJ B;  3SJL D;  1UOO A;  2I0R A;  4A2L A;  5TF2 A;  1OLZ A;  2PM9 B;  2PM9 A;  5TDH B;  5HDB A;  3I7H A;  4O3T B;  2XL3 A;  4O2W A;  4A0B B;  4FA5 D;  3RN1 D;  2HU5 A;  4A0B A;  2HJ4 A;  2OJY A;  2OVR B;  1H2X A;  1E8N A;  2GC7 A;  5EM2 B;  2CNX A;  2H6Q A;  2HES X;  3VH0 A;  4CY2 A;  2J55 H;  3I89 A;  3JZN A;  5IT9 g;  1TYQ C;  3GC3 B;  4GGA A;  3L4O D;  3IJ0 A;  3I7K A;  2WQ8 A;  3V4P A;  4JXM A;  1JMZ B;  2UZX B;  4FA1 D;  4LG9 A;  3MKQ A;  5I5I A;  3SMR A;  4NC4 A;  4J82 A;  5H1M A;  4AN1 A;  1Q47 A;  3EI4 B;  5M5R A;  2YNO A;  3DWL C;  3EI4 A;  4IMM A;  4L3G D;  4PBY A;  4TZ4 A;  3PVW B;  1C9I A;  3VI4 A;  1A12 A;  4ZOY A;  2H6K A;  1PGU A;  2I3S A;  3ULE C;  3UVN A;  3SFZ A;  3V7D B;  4J84 A;  1N6E A;  4JT6 C;  5TEF A;  4EWR A;  3I2N A;  3I7O A;  3OTT A;  5E6R A;  3BG1 A;  3RFG A;  4D6V A;  3ZE0 A;  4CZV A;  3ZWL B;  2I0S A;  5GMK n;  1JJU B;  4ZOX A;  4X61 B;  4R7A B;  4MK0 B;  1QFM A;  4O45 A;  4AEZ A;  5EMK B;  3NVQ A;  2EIB A;  4I79 A;  3SCY A;  2J56 H;  5H17 A;  1A0R B;  3FCU A;  4CI2 A;  4D9S A;  1TBG A;  3PXS D;  1O6F A;  4Y5R D;  4O3U B;  4J81 A;  5IJ8 E;  1H2Z A;  2IWF A;  2CE9 A;  1VE7 A;  2OVQ B;  3KRX B;  2OVP B;  3MZL A;  3O4I A;  4G56 B;  3J80 g;  5FFG A;  4A09 B;  4ES0 A;  4WK4 A;  1OMW B;  4BCD A;  4A09 A;  2XYI A;  3UVK A;  4ZOZ A;  3RLM D;  3FRX A;  2HKM A;  3DDU A;  5KDO B;  4N14 A;  3PVU B;  4FHL A;  2QC5 A;  4J0W A;  4CY5 A;  4NSX A;  5GSA A;  3I7L A;  5FKR A;  1TYE A;  4G55 A;  2I0T A;  3CFS B;  3O4H A;  4OZU A;  3VI3 A;  5FA5 B;  3B7F A;  3MUO A;  3K72 A;  2UZY B;  4J0X A;  2IAA A;  2OK6 A;  2P9K C;  4FAV D;  2IUQ A;  4WK2 A;  3IUN A;  1GXR A;  4BP9 A;  4E54 B;  3PXW D;  5K1C C;  2Q7Q A;  3BWS A;  4E54 A;  3KCI A;  1JTD B;  2IUR A;  2P9L C;  1K32 A;  2AGW A;  3EQ7 A;  1SQJ A;  2CN3 A;  4GM3 A;  3OKY B;  1VZ3 A;  3JRP A;  4X3E A;  1PI6 A;  2GNQ A;  2QXV A;  4J8G A;  2CO0 A;  3DM0 A;  4L1Q D;  2P9P C;  3SVW D;  3GD1 I;  4U1E I;  2OIZ A;  1ERJ A;  4Z7N A;  2XE4 A;  3NIF A;  3QI0 A;  2PM7 B;  3JAM g;  4XYI A;  1K8K C;  4JT5 C;  4WJK A;  1MDA H;  4CZX A;  1JMX B;  4QRJ A;  4CY1 A;  3IJE A;  1UOQ A;  4QQE A;  4LGN A;  5HE1 B;  4CI1 A;  1MG2 A;  2YNP A;  4QL1 A;  3V5W B;  3IUQ A;  4HDJ A;  4FAN D;  3UKU C;  5M5T A;  2CO0 C;  5E6U A;  4NAA A;  4CC9 A;  2TRC B;  3RFH A;  1UOP A;  5GXI A;  3C75 H;  5AFU 3;  4D0K A;  3JRO A;  4JSX C;  5CXB B;  5EM2 A;  5HYN B;  1E8M A;  2H3X A;  1N6F A;  3AH8 B;  5SXM A;  5CXC B;  4Z7O A;  2H14 A;  3W15 A;  4J73 A;  5GXH A;  2VDP A;  3EQ9 A;  3GFC A;  5CXC A;  1K3I A;  3V9F A;  1B9Y A;  4UM8 A;  4ESG A;  3IVM A;  3AL9 A;  3T3M A;  2O9K A;  3AFC A; 
#chains in the Genus database with same CATH homology
 4OWR A;  5CYK A;  3ORV D;  1NEX B;  4A2M A;  5HQG A;  2IUV A;  4BUJ C;  2HJB A;  3C99 A;  4A7J A;  4A08 B;  1XKS A;  4A08 A;  3EMH A;  3ODT A;  4X60 B;  5FKT A;  4J77 A;  4PXW A;  2YMU A;  4PNK B;  5C9Z B;  2CN2 A;  3HFQ A;  2P9N C;  4GGD A;  5TEE A;  3EU7 A;  5EAR A;  3K26 A;  3E0C A;  2Z2N A;  5IGQ A;  5C2W B;  2CE8 A;  4GM8 A;  1N6D A;  4GM9 A;  5EMM B;  2H68 A;  2BBK H;  3SLE D;  2PM6 B;  3N0D A;  5I5M A;  4ZOV A;  5FXY A;  2H47 A;  3I8C A;  1R5M A;  1S4U X;  3OL2 B;  3DXM C;  3OL2 A;  4BL0 A;  1SQ9 A;  3OW8 A;  4JSN C;  2AGL A;  4O1Q D;  4JSV C;  2B5L A;  1QNI A;  2P9S C;  3SBP A;  5EAL A;  2HKR A;  5CYK B;  3BG0 A;  4XYH A;  4GQB B;  3J81 g;  3I7N A;  4L3H D;  2XL2 A;  3IJC A;  2H9L A;  4KFM B;  3OKY A;  4JD2 C;  3VA6 A;  1L0Q A;  4IA9 A;  4FB1 D;  3F3G A;  1XIP A;  3SBR A;  2H6N A;  2YBA A;  2J57 G;  3OKW A;  3OKT A;  3KRW B;  3MKS B;  2OK4 A;  4PC0 A;  4BH6 A;  2EBS A;  5IC7 A;  3DXK C;  3NVX A;  4L9O A;  5JWZ A;  3UVM A;  2IUP A;  3RN0 D;  4H5I A;  2HYE A;  3L4M D;  3EG6 A;  1GP2 B;  4CZY A;  5IJ7 E;  3IKO A;  5A2Q g;  3SXT D;  3FM0 A;  1JOF A;  4GGC A;  5AJA A;  1P22 A;  1NR0 A;  4LG8 A;  3JPX A;  4X63 B;  5CXB A;  4E5Z B;  4QT8 A;  3RMZ D;  4CI8 A;  4H5J A;  4E5Z A;  3FGB A;  2YNN A;  4K3I D;  5I5J A;  4Z8L A;  1GOT B;  3C9C A;  4PSW B;  3MXX A;  5C2V B;  2AGZ A;  4U7A A;  4J79 A;  3PSC B;  5THA A;  1MG3 A;  2IWK A;  4J8B A;  2G9A A;  4JSP C;  1B9X A;  4Y7R A;  3MZK A;  3EI2 B;  3EI2 A;  2G99 A;  2PBI B;  1XHM A;  2B4E A;  1VYH C;  2Z2P A;  3JZG A;  1FWX A;  2B5N A;  3UR4 A;  2B5M A;  2MTA H;  5FKQ A;  2AGY A;  3IIW A;  5AMS A;  3UKR C;  3NVN A;  3IIY A;  4GQ1 A;  2XU7 A;  3C5M A;  3MMY A;  3EI3 B;  2I3T A;  3EI3 A;  3UVL A;  5FLX g;  3SBQ A;  3UVO A;  4ERZ A;  4FA9 D;  2AH1 A;  3RSE C;  4UI9 R;  1PBY B;  1U4C A;  5HE3 B;  4GQ2 P;  4GZ8 A;  3K27 A;  5HE0 B;  4CI3 A;  3SN6 B;  2GC4 A;  2AGX A;  3U4Y A;  2H9N A;  3N0E A;  5IGO A;  3DSM A;  4CY3 A;  5EAP A;  4A0A B;  3IJ1 A;  2BCJ B;  4A0A A;  5K19 A;  3EI1 B;  4FWW A;  4A11 B;  3AL8 B;  4FA4 D;  3EI1 A;  4A11 A;  2H13 A;  3AL8 A;  4K3J B;  4J87 A;  2P9I C;  2YB8 B;  5H14 A;  3SHF A;  1GG2 B;  1SHY B;  3P4F A;  4O9D A;  4PSX B;  4PBZ A;  5FKS A;  3VGZ A;  5EAM A;  3PE7 A;  4ERY A;  1YFQ A;  3CFV A;  3GRE A;  2AH0 A;  3JB9 L;  2HXC A;  3SWS D;  3PXT D;  5B4W A;  1U2V C;  3RRM C;  3I7P A;  4ERQ A;  3I8E A;  2W18 A;  3F3P A;  5FQD A;  4J78 A;  4XEI C;  1PEV A;  4ZN4 A;  5EML B;  2Z2O A;  4AOW A;  3PSL A;  1RI6 A;  2AQ5 A;  4GMB A;  2P9U C;  3EWE A;  5HE2 B;  3F3F A;  3JZH A;  2H9P A;  4YVD A;  3CIK B;  3A0F A;  4J86 A;  2H9M A;  5EMJ B;  3SJL D;  2I0R A;  4A2L A;  5TF2 A;  1OLZ A;  2PM9 B;  2PM9 A;  5TDH B;  3I7H A;  4O3T B;  2XL3 A;  4A0B B;  4FA5 D;  3RN1 D;  4A0B A;  2HJ4 A;  2OJY A;  2OVR B;  2GC7 A;  5EM2 B;  2CNX A;  2H6Q A;  2HES X;  3VH0 A;  4CY2 A;  2J55 H;  3I89 A;  3JZN A;  5IT9 g;  1TYQ C;  4GGA A;  3L4O D;  3IJ0 A;  3I7K A;  4JXM A;  1JMZ B;  2UZX B;  4FA1 D;  4LG9 A;  3MKQ A;  5I5I A;  3SMR A;  4J82 A;  5H1M A;  1Q47 A;  3EI4 B;  2YNO A;  3DWL C;  3EI4 A;  4IMM A;  4L3G D;  4PBY A;  4TZ4 A;  3PVW B;  4ZOY A;  2H6K A;  1PGU A;  2I3S A;  3ULE C;  3UVN A;  3SFZ A;  3V7D B;  4J84 A;  1N6E A;  4JT6 C;  5TEF A;  4EWR A;  3I2N A;  3I7O A;  3OTT A;  3BG1 A;  3RFG A;  4D6V A;  4CZV A;  3ZWL B;  2I0S A;  5GMK n;  1JJU B;  4ZOX A;  4X61 B;  4R7A B;  4MK0 B;  4O45 A;  4AEZ A;  5EMK B;  3NVQ A;  4I79 A;  3SCY A;  2J56 H;  5H17 A;  1A0R B;  4CI2 A;  1TBG A;  3PXS D;  4Y5R D;  4O3U B;  4J81 A;  5IJ8 E;  2IWF A;  2CE9 A;  2OVQ B;  3KRX B;  2OVP B;  3MZL A;  4G56 B;  3J80 g;  4A09 B;  4ES0 A;  1OMW B;  4A09 A;  2XYI A;  3UVK A;  4ZOZ A;  3RLM D;  3FRX A;  2HKM A;  5KDO B;  4N14 A;  3PVU B;  4FHL A;  2QC5 A;  4J0W A;  4CY5 A;  4NSX A;  5GSA A;  3I7L A;  5FKR A;  2I0T A;  3CFS B;  4OZU A;  5FA5 B;  3B7F A;  2UZY B;  4J0X A;  2IAA A;  2OK6 A;  2P9K C;  4FAV D;  2IUQ A;  1GXR A;  4E54 B;  3PXW D;  5K1C C;  2Q7Q A;  3BWS A;  4E54 A;  2IUR A;  2P9L C;  1K32 A;  2AGW A;  1SQJ A;  2CN3 A;  4GM3 A;  3OKY B;  3JRP A;  4X3E A;  1PI6 A;  2GNQ A;  2QXV A;  4J8G A;  2CO0 A;  3DM0 A;  4L1Q D;  2P9P C;  3SVW D;  4U1E I;  2OIZ A;  1ERJ A;  2PM7 B;  3JAM g;  4XYI A;  1K8K C;  4JT5 C;  1MDA H;  4CZX A;  1JMX B;  4QRJ A;  4CY1 A;  4QQE A;  4LGN A;  5HE1 B;  4CI1 A;  1MG2 A;  2YNP A;  4QL1 A;  3V5W B;  4HDJ A;  4FAN D;  3UKU C;  2CO0 C;  4CC9 A;  2TRC B;  3RFH A;  5GXI A;  3C75 H;  5AFU 3;  4D0K A;  3JRO A;  4JSX C;  5CXB B;  5EM2 A;  5HYN B;  2H3X A;  1N6F A;  3AH8 B;  5SXM A;  5CXC B;  2H14 A;  3W15 A;  4J73 A;  5GXH A;  5CXC A;  3GFC A;  3V9F A;  1B9Y A;  4ESG A;  3AL9 A;  2O9K A;  3AFC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...