4QRJA

Crystal structure of a putative 6-phosphogluconolactonase (bacuni_04672) from bacteroides uniformis atcc 8492 at 2.20 a resolution
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
345
structure length
345
Chain Sequence
DQDELAMLIGTYTNGSSKGIYTFRFNQETGTAVPLSSAALPNPSYLVPSEDGEFVYAVSEMNDSTAALSSLAFDRETGELRLLNTVPTFGADPCYVATNGREVLTANYSGGTMSVFPLQKDGTLAPADTLFQGSATGPDAIRQATPHIHCTVFSPDGKYIFATDFSADRILRFVMHPDNPIPHASLEAVGIEADSGPRHLTFSPNGKFAYLITELSGKVIAFSYDDGCLEQIQTITADTVAARGSADIHLSPDGKYLYASNRLKEDGIAIFAVNPENGTLAKVGYQPTGIHPRNFNITPNGKYLLAACRDSNVIQVYKRNEVTGLLEDTHQDIVVDMPVCVQFVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative 6-phosphogluconolactonase
publication title Crystal structure of a putative 6-phosphogluconolactonase (BACUNI_04672) from Bacteroides uniformis ATCC 8492 at 2.20 A resolution
rcsb
source organism Bacteroides uniformis atcc 8492
molecule tags Hydrolase
total genus 89
structure length 345
sequence length 345
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10282 Lactonase Lactonase, 7-bladed beta-propeller
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4qrjA00
5I5JA 4E54A 2IURA 4ERYA 4CZYA 4NSXA 2OVPB 2IUVA 3OTTA 3I7PA 2P9LC 2HKRA 4IA9A 4Y7RA 3N0DA 3EI3A 4PXWA 3UR4A 5CXBB 5EALA 3CIKB 2EBSA 4JSXC 3GFCA 3ODTA 4CI2A 2P9IC 4J8BA 3V5WB 2I0TA 5C9ZB 3C75H 2P9PC 3OKTA 4O3TB 4ZN4A 4A08A 4KFMB 3BG1A 3DWLC 3MMYA 2IWFA 1MDAH 4YVDA 4PSXB 3PXSD 2B4EA 2CO0C 4EWRA 5GXHA 3AL8A 3JPXA 5I5MA 1XHMA 3SFZA 5FQDA 2MTAH 1U4CA 1MG2A 4MK0B 3I2NA 5FKRA 5IC7A 4ESGA 2Z2PA 3OKYB 5EMLB 4L9OA 2P9SC 3VH0A 2PM7B 4FA5D 1SHYB 1VYHC 2Z2OA 4Z8LA 4O9DA 3V9FA 3IJCA 1N6FA 4LG8A 1SQ9A 4OZUA 4QL1A 3GREA 3F3FA 3DXMC 5IJ8E 3PSCB 3BWSA 4JT6C 2AGWA 5FKSA 3MZLA 2PM9A 1PGUA 2H68A 3UVLA 3AFCA 3MKQA 5B4WA 4Y5RD 2AGZA 2GNQA 3B7FA 4XYHA 3DXKC 3FM0A 3RMZD 4LG9A 3K26A 4K3JB 4PBYA 2OJYA 3NVQA 2YNPA 5FA5B 3PXWD 1NR0A 4A0AA 5AFU3 5FKQA 4BL0A 1GG2B 5CXCB 5EMMB 4UI9R 3OL2B 2I0RA 5EAPA 2B5MA 3EMHA 3AH8B 5JWZA 4A09B 2G9AA 1R5MA 2H9NA 1B9XA 2H13A 1JOFA 1TBGA 4A2MA 3F3PA 3PSLA 4JXMA 5EMJB 3RN1D 2YMUA 4GM3A 4ERZA 4X60B 4A0BB 4CY1A 4PC0A 5HE2B 4J84A 4X63B 5AJAA 2XYIA 3JZHA 2YNNA 2HXCA 4G56B 3RN0D 4A11A 4GM8A 4J0XA 4GGCA 2CE8A 2B5LA 2OVQB 2CN2A 5GXIA 1Q47A 2PBIB 4N14A 3K27A 4TZ4A 4L1QD 2Q7QA 4E54B 2H6NA 4J77A 4OWRA 4A7JA 2CNXA 3U4YA 1NEXB 2H6KA 2AGYA 3ORVD 3I8EA 3EI3B 4CC9A 4AOWA 4GZ8A 4IMMA 4J0WA 4FAVD 3EI2A 1OLZA 3AL9A 4E5ZA 2YBAA 4XYIA 3J81g 1XKSA 3JZNA 3PE7A 2OIZA 1JJUB 3I7HA 3UKRC 5EARA 5H17A 2IAAA 5HE0B 3J80g 4A08B 4A2LA 2P9UC 5HYNB 5TDHB 2HJBA 2J55H 4O45A 3SCYA 2QXVA 3KRWB 1A0RB 1JMXB 3AL8B 4FA4D 4H5IA 2IWKA 2XL3A 3RSEC 1TYQC 4BH6A 1GXRA 5IGOA 4D6VA 4JSVC 5HE1B 3IJ0A 3I89A 3VA6A 2HYEA 5KDOB 5FLXg 3HFQA 4GGDA 3C99A 1N6EA 4J82A 5IGQA 3I8CA 4JD2C 1RI6A 3RFGA 2HKMA 2PM9B 3EI4A 4ZOYA 4PSWB 3JRPA 4CZXA 1N6DA 4GMBA 4U7AA 3SVWD 2H9LA 3PVWB 2CE9A 5FKTA 5TEEA 1XIPA 4A0AB 3JROA 4CY5A 3OKWA 3W15A 4CY3A 4J86A 3OW8A 1MG3A 4D0KA 2I3TA 3EWEA 3I7KA 3IIYA 4CI3A 3CFSB 3IJ1A 3C9CA 2J57G 4FA9D 2XU7A 3EI1A 5K19A 3UVNA 3L4MD 2J56H 4JSPC 1PBYB 3SWSD 4FWWA 3IKOA 2OK4A 4JT5C 2YB8B 5EM2A 3N0EA 1U2VC 5THAA 5CYKA 4FA1D 4CI8A 2HESX 2IUQA 2TRCB 1L0QA 2I3SA 1K32A 1P22A 2YNOA 2AQ5A 4A11B 2BBKH 5IJ7E 3L4OD 3DM0A 5TEFA 5I5IA 3C5MA 3SMRA 3UVMA 4QRJA 3FRXA 2AH1A 5EAMA 3RFHA 3ULEC 5H14A 4X3EA 3UVKA 3SBQA 4O1QD 5FXYA 4GQ2P 3CFVA 1GOTB 3MZKA 2QC5A 4GQBB 5CXBA 5IT9g 5TF2A 2OK6A 1YFQA 2UZXB 3F3GA 5AMSA 3RLMD 4FHLA 4GM9A 4FAND 2G99A 4HDJA 3FGBA 3EI2B 5GSAA 4E5ZB 5HE3B 1PEVA 4PNKB 2HJ4A 4J87A 3SHFA 4ZOZA 2H47A 1JMZB 2UZYB 3VGZA 2H9MA 4ZOVA 4H5JA 2BCJB 4XEIC 2B5NA 4O3UB 1OMWB 3SN6B 1QNIA 4U1EI 5A2Qg 2CN3A 2XL2A 4QT8A 4J81A 3OKYA 3UVOA 3PXTD 4R7AB 4CZVA 1ERJA 2GC4A 4K3ID 3SBPA 5C2VB 4PBZA 4LGNA 2H9PA 3UKUC 3V7DB 1GP2B 3JAMg 4J79A 4ES0A 1SQJA 2H14A 2O9KA 1S4UX 5HQGA 3MXXA 3RRMC 2GC7A 2H3XA 1B9YA 2W18A 3JZGA 3I7LA 3BG0A 2CO0A 3EI4B 3MKSB 4I79A 5K1CC 3SJLD 3I7OA 3IIWA 3ZWLB 4QQEA 1FWXA 1K8KC 5GMKn 4ERQA 5EMKB 5CXCA 5C2WB 3OL2A 3NVXA 3EG6A 2H6QA 2AH0A 4X61B 4CI1A 2Z2NA 4A09A 3P4FA 5H1MA 4FB1D 3KRXB 4CY2A 3EU7A 4GQ1A 4J8GA 4J78A 4J73A 4A0BA 4BUJC 4L3HD 4L3GD 3SXTD 3EI1B 2P9NC 4ZOXA 2IUPA 3PVUB 3NVNA 3JB9L 2PM6B 2I0SA 3A0FA 5EM2B 3I7NA 2OVRB 3DSMA 2AGLA 5CYKB 4JSNC 4GGAA 3SBRA 1PI6A 2P9KC 3SLED 3E0CA 5SXMA 4AEZA 2AGXA
chains in the Genus database with same CATH superfamily
5I5JA 4E54A 2IURA 3NIFA 4G55A 4ERYA 4CZYA 3O4IA 4NSXA 2OVPB 2IUVA 3IULA 3OTTA 3I7PA 2P9LC 2HKRA 4IA9A 4Y7RA 3N0DA 3EI3A 4PXWA 3UR4A 5CXBB 5EALA 3CIKB 2EBSA 4JSXC 3GFCA 4NENA 3ODTA 4CI2A 2P9IC 3IVMA 4J8BA 3V5WB 3K72A 2I0TA 5C9ZB 3C75H 2P9PC 3OKTA 4O3TB 4ZN4A 4A08A 4JHPC 4KFMB 4O02A 3BG1A 3DWLC 3MMYA 2EICA 2IWFA 1VE6A 4WK0A 1MDAH 4UM9A 1JTDB 3ZDZA 4YVDA 1VZ2A 4PSXB 3PXSD 2B4EA 2CO0C 4EWRA 5GXHA 3AL8A 3JPXA 5I5MA 1XHMA 3SFZA 4O2WA 5FQDA 2MTAH 3ZE2A 1U4CA 1MG2A 4MK0B 3I2NA 3IUNA 2JKXA 5FKRA 5IC7A 4ESGA 2Z2PA 3OKYB 5EMLB 3O4JA 4L9OA 3ZE0A 2P9SC 3VH0A 4NBMA 2PM7B 4FA5D 1H2YA 1VYHC 1SHYB 2Z2OA 1VE7A 4O9DA 4Z8LA 3V9FA 3IJCA 1N6FA 4LG8A 2VDRA 1SQ9A 4OZUA 4QL1A 3GREA 3F3FA 3DXMC 5IJ8E 3PSCB 3BWSA 4JT6C 2VDLA 4RE5A 2AGWA 2VDNA 3MZLA 2PM9A 5FKSA 1PGUA 2H68A 3UVLA 3AFCA 4NAAA 4D9SA 3MKQA 5B4WA 4Y5RD 2AGZA 1O6FA 2GNQA 3B7FA 4XYHA 3MUNA 3DXKC 3FM0A 3RMZD 4LG9A 3K26A 4K3JB 4PBYA 2OJYA 3NVQA 1O6GA 2YNPA 5FA5B 3PXWD 1NR0A 4DNVA 4A0AA 5AFU3 5FKQA 4BL0A 1GG2B 5CXCB 5EMMB 4UI9R 3MUOA 3ZE1A 3OL2B 2I0RA 5EAPA 2B5MA 3EMHA 3NIDA 3AH8B 5JWZA 4A09B 2G9AA 4BP8A 1R5MA 2H9NA 1JV2A 1B9XA 2H13A 1JOFA 1TBGA 4A2MA 3F3PA 3PSLA 3QHYB 4JXMA 5EMJB 2VDQA 3RN1D 2YMUA 4GM3A 4ERZA 4X60B 4A0BB 4Z7QA 4AN0A 4CY1A 4PC0A 5HE2B 4J84A 4X63B 5AJAA 2XYIA 3JZHA 3V4VA 2YNNA 2HXCA 4G56B 3RN0D 4A11A 4GM8A 4J0XA 4GGCA 2CE8A 2HU8A 2B5LA 5M5VA 2QR5A 2OVQB 2CN2A 5GXIA 1Q47A 3ZDXA 2PBIB 4N14A 3K27A 4TZ4A 2QZPA 3FCUA 2Q7QA 1GOFA 4L1QD 4E54B 2H6NA 4J77A 4OWRA 4A7JA 2CNXA 4WK2A 2VDOA 3U4YA 1NEXB 2H6KA 1U8CA 2AGYA 3ORVD 3I8EA 3EI3B 4CC9A 4AOWA 4GZ8A 4IMMA 4J0WA 4FAVD 3EI2A 1OLZA 3AL9A 4UM8A 4E5ZA 2YBAA 4XYIA 3J81g 1XKSA 3JZNA 3PE7A 2OIZA 1JJUB 3IURA 1A12A 3I7HA 5EARA 3UKRC 5H17A 1K3IA 2IAAA 5HE0B 4RE6A 3J80g 4A08B 4A2LA 2P9UC 5HYNB 5TDHB 2HJBA 2J55H 3QI0A 4O45A 3SCYA 4MMYA 5C86A 4JHNA 2QXVA 3KRWB 1A0RB 1JMXB 1GOHA 3AL8B 2WQ8A 5FFOA 4FA4D 4H5IA 2IWKA 2XL3A 3RSEC 1TYQC 4BH6A 3K71A 1GXRA 5IGOA 1UOQA 4D6VA 1E8MA 3DDUA 4JSVC 4QAMA 5M61A 5HE1B 3IJ0A 3MVDK 2HU7A 3I89A 3VA6A 1E8NA 5KDOB 2HYEA 5FLXg 3HFQA 3EQ7A 3C99A 4GGDA 1N6EA 4J82A 5IGQA 3I8CA 4JD2C 1RI6A 3O4HA 2HKMA 3RFGA 1M1XA 3K6SA 1L5GA 2PM9B 3EI4A 4DNWA 4ZOYA 4PSWB 3JRPA 4CZXA 1N6DA 4GMBA 4U7AA 3SVWD 5M5RA 1UOOA 3IUQA 2H9LA 1H2ZA 3PVWB 2CE9A 5FKTA 3EQ8A 5TEEA 1GOGA 1QFMA 3VI4A 1XIPA 5M5SA 4NC4A 1UTCA 4A0AB 3JROA 5E6SA 4CY5A 3OKWA 3W15A 4BCBA 4J86A 4CY3A 3OW8A 1MG3A 2EIDA 4D0KA 2I3TA 3EWEA 3I7KA 3IIYA 1UOPA 3CFSB 2HU5A 3IJ1A 3C9CA 3ZDYA 5C92A 4CI3A 2J57G 4FA9D 2VC2A 2XU7A 3EI1A 5K19A 3UVNA 3L4MD 2J56H 4JSPC 1PBYB 3SWSD 4FWWA 3IKOA 4L1MA 2OK4A 4JT5C 2YB8B 5EM2A 3N0EA 2VZ3A 1U2VC 5THAA 5CYKA 4G1MA 4FA1D 4CI8A 2HESX 2IUQA 2TRCB 1L0QA 2I3SA 1K32A 1P22A 1QFSA 2YNOA 2AQ5A 4A11B 2BBKH 5IJ7E 1YR2A 2VDKA 4DNUA 3L4OD 3NIGA 3DM0A 5TEFA 5I5IA 3C5MA 3SMRA 2VDPA 3UVMA 4QRJA 3FRXA 2AH1A 5EAMA 3FCSA 3RFHA 3ULEC 5H14A 4X3EA 3UVKA 3SBQA 4O1QD 5FXYA 4GQ2P 1BPOA 3CFVA 1GOTB 3MZKA 2QC5A 4GQBB 5CXBA 2XE4A 5IT9g 5TF2A 2OK6A 1YFQA 4WK4A 2UZXB 3F3GA 3IUMA 5AMSA 4FHLA 4GM9A 3RLMD 4FAND 2G99A 4HDJA 3FGBA 3EI2B 5GSAA 3OF7A 4E5ZB 2EIEA 5HE3B 1PEVA 4PNKB 1E5TA 2HJ4A 4J87A 3SHFA 4ZOZA 2H47A 1JMZB 1VZ3A 2UZYB 3VGZA 2H9MA 4ZOVA 4H5JA 2BCJB 4WJKA 4XEIC 2B5NA 4O3UB 1OMWB 3SN6B 1QNIA 4U1EI 1H2XA 5A2Qg 2CN3A 2XL2A 4QT8A 2EIBA 4J81A 3OKYA 4G1EA 3PXTD 3UVOA 4AX4A 4AN1A 4R7AB 4CZVA 1ERJA 2GC4A 4K3ID 4IRZA 3SBPA 5C2VB 4PBZA 4LGNA 2H9PA 3VI3A 3V4PA 3UKUC 3V7DB 1GP2B 3JAMg 4J79A 5FFGA 3T3PA 4ES0A 3KCIA 1SQJA 2H14A 2O9KA 1C9IA 1S4UX 3T3MA 5HQGA 3MXXA 3RRMC 2GC7A 2H3XA 1B9YA 3GD1I 3JZGA 2W18A 3I7LA 3BG0A 2CO0A 5M5TA 1H2WA 3IUJA 3EI4B 3MKSB 4I79A 5K1CC 3SJLD 3I7OA 3IIWA 2VDMA 4QQEA 3ZWLB 4BCCA 1FWXA 2XDWA 1K8KC 1I2MB 3EQ9A 4ERQA 5GMKn 5EMKB 5CXCA 1TYEA 5C2WB 3OL2A 3NVXA 3IJEA 5M5UA 3EG6A 4BCDA 2H6QA 2AH0A 4X61B 4CI1A 2Z2NA 4A09A 3P4FA 5H1MA 4FB1D 2VZ1A 3KRXB 4CY2A 3EU7A 3GC3B 2XZGA 1C9LA 4GQ1A 5E6UA 4J8GA 4J78A 4J73A 4MMXA 4A0BA 4BUJC 4L3HD 1T2XA 4L3GD 5E6RA 3SXTD 4BP9A 3EI1B 3O4GA 4Z7NA 2P9NC 4ZOXA 2IUPA 3PVUB 3NVNA 5HDBA 3JB9L 2PM6B 2I0SA 3A0FA 5EM2B 4AMYA 3I7NA 2OVRB 3DSMA 4MMZA 2AGLA 2BKLA 5CYKB 4JSNC 4AMZA 4GGAA 3SBRA 1PI6A 4Z7OA 2P9KC 3SLED 3E0CA 5SXMA 4AEZA 2AGXA
chains in the Genus database with same CATH topology
5I5JA 4E54A 2IURA 4ERYA 4CZYA 4NSXA 2OVPB 2IUVA 3OTTA 3I7PA 2P9LC 2HKRA 4IA9A 4Y7RA 3N0DA 3EI3A 4PXWA 3UR4A 5CXBB 5EALA 3CIKB 2EBSA 4JSXC 3GFCA 3ODTA 4CI2A 2P9IC 4J8BA 3V5WB 2I0TA 5C9ZB 3C75H 2P9PC 3OKTA 4O3TB 4ZN4A 4A08A 4KFMB 3BG1A 3DWLC 3MMYA 2IWFA 1MDAH 4YVDA 4PSXB 3PXSD 2B4EA 2CO0C 4EWRA 5GXHA 3AL8A 3JPXA 5I5MA 1XHMA 3SFZA 5FQDA 2MTAH 1U4CA 1MG2A 4MK0B 3I2NA 5FKRA 5IC7A 4ESGA 2Z2PA 3OKYB 5EMLB 4L9OA 2P9SC 3VH0A 2PM7B 4FA5D 1SHYB 1VYHC 2Z2OA 4Z8LA 4O9DA 3V9FA 3IJCA 1N6FA 4LG8A 1SQ9A 4OZUA 4QL1A 3GREA 3F3FA 3DXMC 5IJ8E 3PSCB 3BWSA 4JT6C 2AGWA 5FKSA 3MZLA 2PM9A 1PGUA 2H68A 3UVLA 3AFCA 3MKQA 5B4WA 4Y5RD 2AGZA 2GNQA 3B7FA 4XYHA 3DXKC 3FM0A 3RMZD 4LG9A 3K26A 4K3JB 4PBYA 2OJYA 3NVQA 2YNPA 5FA5B 3PXWD 1NR0A 4A0AA 5AFU3 5FKQA 4BL0A 1GG2B 5CXCB 5EMMB 4UI9R 3OL2B 2I0RA 5EAPA 2B5MA 3EMHA 3AH8B 5JWZA 4A09B 2G9AA 1R5MA 2H9NA 1B9XA 2H13A 1JOFA 1TBGA 4A2MA 3F3PA 3PSLA 4JXMA 5EMJB 3RN1D 2YMUA 4GM3A 4ERZA 4X60B 4A0BB 4CY1A 4PC0A 5HE2B 4J84A 4X63B 5AJAA 2XYIA 3JZHA 2YNNA 2HXCA 4G56B 3RN0D 4A11A 4GM8A 4J0XA 4GGCA 2CE8A 2B5LA 2OVQB 2CN2A 5GXIA 1Q47A 2PBIB 4N14A 3K27A 4TZ4A 4L1QD 2Q7QA 4E54B 2H6NA 4J77A 4OWRA 4A7JA 2CNXA 3U4YA 1NEXB 2H6KA 2AGYA 3ORVD 3I8EA 3EI3B 4CC9A 4AOWA 4GZ8A 4IMMA 4J0WA 4FAVD 3EI2A 1OLZA 3AL9A 4E5ZA 2YBAA 4XYIA 3J81g 1XKSA 3JZNA 3PE7A 2OIZA 1JJUB 3I7HA 3UKRC 5EARA 5H17A 2IAAA 5HE0B 3J80g 4A08B 4A2LA 2P9UC 5HYNB 5TDHB 2HJBA 2J55H 4O45A 3SCYA 2QXVA 3KRWB 1A0RB 1JMXB 3AL8B 4FA4D 4H5IA 2IWKA 2XL3A 3RSEC 1TYQC 4BH6A 1GXRA 5IGOA 4D6VA 4JSVC 5HE1B 3IJ0A 3I89A 3VA6A 2HYEA 5KDOB 5FLXg 3HFQA 4GGDA 3C99A 1N6EA 4J82A 5IGQA 3I8CA 4JD2C 1RI6A 3RFGA 2HKMA 2PM9B 3EI4A 4ZOYA 4PSWB 3JRPA 4CZXA 1N6DA 4GMBA 4U7AA 3SVWD 2H9LA 3PVWB 2CE9A 5FKTA 5TEEA 1XIPA 4A0AB 3JROA 4CY5A 3OKWA 3W15A 4CY3A 4J86A 3OW8A 1MG3A 4D0KA 2I3TA 3EWEA 3I7KA 3IIYA 4CI3A 3CFSB 3IJ1A 3C9CA 2J57G 4FA9D 2XU7A 3EI1A 5K19A 3UVNA 3L4MD 2J56H 4JSPC 1PBYB 3SWSD 4FWWA 3IKOA 2OK4A 4JT5C 2YB8B 5EM2A 3N0EA 1U2VC 5THAA 5CYKA 4FA1D 4CI8A 2HESX 2IUQA 2TRCB 1L0QA 2I3SA 1K32A 1P22A 2YNOA 2AQ5A 4A11B 2BBKH 5IJ7E 3L4OD 3DM0A 5TEFA 5I5IA 3C5MA 3SMRA 3UVMA 4QRJA 3FRXA 2AH1A 5EAMA 3RFHA 3ULEC 5H14A 4X3EA 3UVKA 3SBQA 4O1QD 5FXYA 4GQ2P 3CFVA 1GOTB 3MZKA 2QC5A 4GQBB 5CXBA 5IT9g 5TF2A 2OK6A 1YFQA 2UZXB 3F3GA 5AMSA 3RLMD 4FHLA 4GM9A 4FAND 2G99A 4HDJA 3FGBA 3EI2B 5GSAA 4E5ZB 5HE3B 1PEVA 4PNKB 2HJ4A 4J87A 3SHFA 4ZOZA 2H47A 1JMZB 2UZYB 3VGZA 2H9MA 4ZOVA 4H5JA 2BCJB 4XEIC 2B5NA 4O3UB 1OMWB 3SN6B 1QNIA 4U1EI 5A2Qg 2CN3A 2XL2A 4QT8A 4J81A 3OKYA 3UVOA 3PXTD 4R7AB 4CZVA 1ERJA 2GC4A 4K3ID 3SBPA 5C2VB 4PBZA 4LGNA 2H9PA 3UKUC 3V7DB 1GP2B 3JAMg 4J79A 4ES0A 1SQJA 2H14A 2O9KA 1S4UX 5HQGA 3MXXA 3RRMC 2GC7A 2H3XA 1B9YA 2W18A 3JZGA 3I7LA 3BG0A 2CO0A 3EI4B 3MKSB 4I79A 5K1CC 3SJLD 3I7OA 3IIWA 3ZWLB 4QQEA 1FWXA 1K8KC 5GMKn 4ERQA 5EMKB 5CXCA 5C2WB 3OL2A 3NVXA 3EG6A 2H6QA 2AH0A 4X61B 4CI1A 2Z2NA 4A09A 3P4FA 5H1MA 4FB1D 3KRXB 4CY2A 3EU7A 4GQ1A 4J8GA 4J78A 4J73A 4A0BA 4BUJC 4L3HD 4L3GD 3SXTD 3EI1B 2P9NC 4ZOXA 2IUPA 3PVUB 3NVNA 3JB9L 2PM6B 2I0SA 3A0FA 5EM2B 3I7NA 2OVRB 3DSMA 2AGLA 5CYKB 4JSNC 4GGAA 3SBRA 1PI6A 2P9KC 3SLED 3E0CA 5SXMA 4AEZA 2AGXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5I5J A;  4E54 A;  2IUR A;  4ERY A;  4CZY A;  4NSX A;  2OVP B;  2IUV A;  3OTT A;  3I7P A;  2P9L C;  2HKR A;  4IA9 A;  4Y7R A;  3N0D A;  3EI3 A;  4PXW A;  3UR4 A;  5CXB B;  5EAL A;  3CIK B;  2EBS A;  4JSX C;  3GFC A;  3ODT A;  4CI2 A;  2P9I C;  4J8B A;  3V5W B;  2I0T A;  5C9Z B;  3C75 H;  2P9P C;  3OKT A;  4O3T B;  4ZN4 A;  4A08 A;  4KFM B;  3BG1 A;  3DWL C;  3MMY A;  2IWF A;  1MDA H;  4YVD A;  4PSX B;  3PXS D;  2B4E A;  2CO0 C;  4EWR A;  5GXH A;  3AL8 A;  3JPX A;  5I5M A;  1XHM A;  3SFZ A;  5FQD A;  2MTA H;  1U4C A;  1MG2 A;  4MK0 B;  3I2N A;  5FKR A;  5IC7 A;  4ESG A;  2Z2P A;  3OKY B;  5EML B;  4L9O A;  2P9S C;  3VH0 A;  2PM7 B;  4FA5 D;  1SHY B;  1VYH C;  2Z2O A;  4Z8L A;  4O9D A;  3V9F A;  3IJC A;  1N6F A;  4LG8 A;  1SQ9 A;  4OZU A;  4QL1 A;  3GRE A;  3F3F A;  3DXM C;  5IJ8 E;  3PSC B;  3BWS A;  4JT6 C;  2AGW A;  5FKS A;  3MZL A;  2PM9 A;  1PGU A;  2H68 A;  3UVL A;  3AFC A;  3MKQ A;  5B4W A;  4Y5R D;  2AGZ A;  2GNQ A;  3B7F A;  4XYH A;  3DXK C;  3FM0 A;  3RMZ D;  4LG9 A;  3K26 A;  4K3J B;  4PBY A;  2OJY A;  3NVQ A;  2YNP A;  5FA5 B;  3PXW D;  1NR0 A;  4A0A A;  5AFU 3;  5FKQ A;  4BL0 A;  1GG2 B;  5CXC B;  5EMM B;  4UI9 R;  3OL2 B;  2I0R A;  5EAP A;  2B5M A;  3EMH A;  3AH8 B;  5JWZ A;  4A09 B;  2G9A A;  1R5M A;  2H9N A;  1B9X A;  2H13 A;  1JOF A;  1TBG A;  4A2M A;  3F3P A;  3PSL A;  4JXM A;  5EMJ B;  3RN1 D;  2YMU A;  4GM3 A;  4ERZ A;  4X60 B;  4A0B B;  4CY1 A;  4PC0 A;  5HE2 B;  4J84 A;  4X63 B;  5AJA A;  2XYI A;  3JZH A;  2YNN A;  2HXC A;  4G56 B;  3RN0 D;  4A11 A;  4GM8 A;  4J0X A;  4GGC A;  2CE8 A;  2B5L A;  2OVQ B;  2CN2 A;  5GXI A;  1Q47 A;  2PBI B;  4N14 A;  3K27 A;  4TZ4 A;  4L1Q D;  2Q7Q A;  4E54 B;  2H6N A;  4J77 A;  4OWR A;  4A7J A;  2CNX A;  3U4Y A;  1NEX B;  2H6K A;  2AGY A;  3ORV D;  3I8E A;  3EI3 B;  4CC9 A;  4AOW A;  4GZ8 A;  4IMM A;  4J0W A;  4FAV D;  3EI2 A;  1OLZ A;  3AL9 A;  4E5Z A;  2YBA A;  4XYI A;  3J81 g;  1XKS A;  3JZN A;  3PE7 A;  2OIZ A;  1JJU B;  3I7H A;  3UKR C;  5EAR A;  5H17 A;  2IAA A;  5HE0 B;  3J80 g;  4A08 B;  4A2L A;  2P9U C;  5HYN B;  5TDH B;  2HJB A;  2J55 H;  4O45 A;  3SCY A;  2QXV A;  3KRW B;  1A0R B;  1JMX B;  3AL8 B;  4FA4 D;  4H5I A;  2IWK A;  2XL3 A;  3RSE C;  1TYQ C;  4BH6 A;  1GXR A;  5IGO A;  4D6V A;  4JSV C;  5HE1 B;  3IJ0 A;  3I89 A;  3VA6 A;  2HYE A;  5KDO B;  5FLX g;  3HFQ A;  4GGD A;  3C99 A;  1N6E A;  4J82 A;  5IGQ A;  3I8C A;  4JD2 C;  1RI6 A;  3RFG A;  2HKM A;  2PM9 B;  3EI4 A;  4ZOY A;  4PSW B;  3JRP A;  4CZX A;  1N6D A;  4GMB A;  4U7A A;  3SVW D;  2H9L A;  3PVW B;  2CE9 A;  5FKT A;  5TEE A;  1XIP A;  4A0A B;  3JRO A;  4CY5 A;  3OKW A;  3W15 A;  4CY3 A;  4J86 A;  3OW8 A;  1MG3 A;  4D0K A;  2I3T A;  3EWE A;  3I7K A;  3IIY A;  4CI3 A;  3CFS B;  3IJ1 A;  3C9C A;  2J57 G;  4FA9 D;  2XU7 A;  3EI1 A;  5K19 A;  3UVN A;  3L4M D;  2J56 H;  4JSP C;  1PBY B;  3SWS D;  4FWW A;  3IKO A;  2OK4 A;  4JT5 C;  2YB8 B;  5EM2 A;  3N0E A;  1U2V C;  5THA A;  5CYK A;  4FA1 D;  4CI8 A;  2HES X;  2IUQ A;  2TRC B;  1L0Q A;  2I3S A;  1K32 A;  1P22 A;  2YNO A;  2AQ5 A;  4A11 B;  2BBK H;  5IJ7 E;  3L4O D;  3DM0 A;  5TEF A;  5I5I A;  3C5M A;  3SMR A;  3UVM A;  4QRJ A;  3FRX A;  2AH1 A;  5EAM A;  3RFH A;  3ULE C;  5H14 A;  4X3E A;  3UVK A;  3SBQ A;  4O1Q D;  5FXY A;  4GQ2 P;  3CFV A;  1GOT B;  3MZK A;  2QC5 A;  4GQB B;  5CXB A;  5IT9 g;  5TF2 A;  2OK6 A;  1YFQ A;  2UZX B;  3F3G A;  5AMS A;  3RLM D;  4FHL A;  4GM9 A;  4FAN D;  2G99 A;  4HDJ A;  3FGB A;  3EI2 B;  5GSA A;  4E5Z B;  5HE3 B;  1PEV A;  4PNK B;  2HJ4 A;  4J87 A;  3SHF A;  4ZOZ A;  2H47 A;  1JMZ B;  2UZY B;  3VGZ A;  2H9M A;  4ZOV A;  4H5J A;  2BCJ B;  4XEI C;  2B5N A;  4O3U B;  1OMW B;  3SN6 B;  1QNI A;  4U1E I;  5A2Q g;  2CN3 A;  2XL2 A;  4QT8 A;  4J81 A;  3OKY A;  3UVO A;  3PXT D;  4R7A B;  4CZV A;  1ERJ A;  2GC4 A;  4K3I D;  3SBP A;  5C2V B;  4PBZ A;  4LGN A;  2H9P A;  3UKU C;  3V7D B;  1GP2 B;  3JAM g;  4J79 A;  4ES0 A;  1SQJ A;  2H14 A;  2O9K A;  1S4U X;  5HQG A;  3MXX A;  3RRM C;  2GC7 A;  2H3X A;  1B9Y A;  2W18 A;  3JZG A;  3I7L A;  3BG0 A;  2CO0 A;  3EI4 B;  3MKS B;  4I79 A;  5K1C C;  3SJL D;  3I7O A;  3IIW A;  3ZWL B;  4QQE A;  1FWX A;  1K8K C;  5GMK n;  4ERQ A;  5EMK B;  5CXC A;  5C2W B;  3OL2 A;  3NVX A;  3EG6 A;  2H6Q A;  2AH0 A;  4X61 B;  4CI1 A;  2Z2N A;  4A09 A;  3P4F A;  5H1M A;  4FB1 D;  3KRX B;  4CY2 A;  3EU7 A;  4GQ1 A;  4J8G A;  4J78 A;  4J73 A;  4A0B A;  4BUJ C;  4L3H D;  4L3G D;  3SXT D;  3EI1 B;  2P9N C;  4ZOX A;  2IUP A;  3PVU B;  3NVN A;  3JB9 L;  2PM6 B;  2I0S A;  3A0F A;  5EM2 B;  3I7N A;  2OVR B;  3DSM A;  2AGL A;  5CYK B;  4JSN C;  4GGA A;  3SBR A;  1PI6 A;  2P9K C;  3SLE D;  3E0C A;  5SXM A;  4AEZ A;  2AGX A; 
#chains in the Genus database with same CATH topology
 5I5J A;  4E54 A;  2IUR A;  3NIF A;  4G55 A;  4ERY A;  4CZY A;  3O4I A;  4NSX A;  2OVP B;  2IUV A;  3IUL A;  3OTT A;  3I7P A;  2P9L C;  2HKR A;  4IA9 A;  4Y7R A;  3N0D A;  3EI3 A;  4PXW A;  3UR4 A;  5CXB B;  5EAL A;  3CIK B;  2EBS A;  4JSX C;  3GFC A;  4NEN A;  3ODT A;  4CI2 A;  2P9I C;  3IVM A;  4J8B A;  3V5W B;  3K72 A;  2I0T A;  5C9Z B;  3C75 H;  2P9P C;  3OKT A;  4O3T B;  4ZN4 A;  4A08 A;  4JHP C;  4KFM B;  4O02 A;  3BG1 A;  3DWL C;  3MMY A;  2EIC A;  2IWF A;  1VE6 A;  4WK0 A;  1MDA H;  4UM9 A;  1JTD B;  3ZDZ A;  4YVD A;  1VZ2 A;  4PSX B;  3PXS D;  2B4E A;  2CO0 C;  4EWR A;  5GXH A;  3AL8 A;  3JPX A;  5I5M A;  1XHM A;  3SFZ A;  4O2W A;  5FQD A;  2MTA H;  3ZE2 A;  1U4C A;  1MG2 A;  4MK0 B;  3I2N A;  3IUN A;  2JKX A;  5FKR A;  5IC7 A;  4ESG A;  2Z2P A;  3OKY B;  5EML B;  3O4J A;  4L9O A;  3ZE0 A;  2P9S C;  3VH0 A;  4NBM A;  2PM7 B;  4FA5 D;  1H2Y A;  1VYH C;  1SHY B;  2Z2O A;  1VE7 A;  4O9D A;  4Z8L A;  3V9F A;  3IJC A;  1N6F A;  4LG8 A;  2VDR A;  1SQ9 A;  4OZU A;  4QL1 A;  3GRE A;  3F3F A;  3DXM C;  5IJ8 E;  3PSC B;  3BWS A;  4JT6 C;  2VDL A;  4RE5 A;  2AGW A;  2VDN A;  3MZL A;  2PM9 A;  5FKS A;  1PGU A;  2H68 A;  3UVL A;  3AFC A;  4NAA A;  4D9S A;  3MKQ A;  5B4W A;  4Y5R D;  2AGZ A;  1O6F A;  2GNQ A;  3B7F A;  4XYH A;  3MUN A;  3DXK C;  3FM0 A;  3RMZ D;  4LG9 A;  3K26 A;  4K3J B;  4PBY A;  2OJY A;  3NVQ A;  1O6G A;  2YNP A;  5FA5 B;  3PXW D;  1NR0 A;  4DNV A;  4A0A A;  5AFU 3;  5FKQ A;  4BL0 A;  1GG2 B;  5CXC B;  5EMM B;  4UI9 R;  3MUO A;  3ZE1 A;  3OL2 B;  2I0R A;  5EAP A;  2B5M A;  3EMH A;  3NID A;  3AH8 B;  5JWZ A;  4A09 B;  2G9A A;  4BP8 A;  1R5M A;  2H9N A;  1JV2 A;  1B9X A;  2H13 A;  1JOF A;  1TBG A;  4A2M A;  3F3P A;  3PSL A;  3QHY B;  4JXM A;  5EMJ B;  2VDQ A;  3RN1 D;  2YMU A;  4GM3 A;  4ERZ A;  4X60 B;  4A0B B;  4Z7Q A;  4AN0 A;  4CY1 A;  4PC0 A;  5HE2 B;  4J84 A;  4X63 B;  5AJA A;  2XYI A;  3JZH A;  3V4V A;  2YNN A;  2HXC A;  4G56 B;  3RN0 D;  4A11 A;  4GM8 A;  4J0X A;  4GGC A;  2CE8 A;  2HU8 A;  2B5L A;  5M5V A;  2QR5 A;  2OVQ B;  2CN2 A;  5GXI A;  1Q47 A;  3ZDX A;  2PBI B;  4N14 A;  3K27 A;  4TZ4 A;  2QZP A;  3FCU A;  2Q7Q A;  1GOF A;  4L1Q D;  4E54 B;  2H6N A;  4J77 A;  4OWR A;  4A7J A;  2CNX A;  4WK2 A;  2VDO A;  3U4Y A;  1NEX B;  2H6K A;  1U8C A;  2AGY A;  3ORV D;  3I8E A;  3EI3 B;  4CC9 A;  4AOW A;  4GZ8 A;  4IMM A;  4J0W A;  4FAV D;  3EI2 A;  1OLZ A;  3AL9 A;  4UM8 A;  4E5Z A;  2YBA A;  4XYI A;  3J81 g;  1XKS A;  3JZN A;  3PE7 A;  2OIZ A;  1JJU B;  3IUR A;  1A12 A;  3I7H A;  5EAR A;  3UKR C;  5H17 A;  1K3I A;  2IAA A;  5HE0 B;  4RE6 A;  3J80 g;  4A08 B;  4A2L A;  2P9U C;  5HYN B;  5TDH B;  2HJB A;  2J55 H;  3QI0 A;  4O45 A;  3SCY A;  4MMY A;  5C86 A;  4JHN A;  2QXV A;  3KRW B;  1A0R B;  1JMX B;  1GOH A;  3AL8 B;  2WQ8 A;  5FFO A;  4FA4 D;  4H5I A;  2IWK A;  2XL3 A;  3RSE C;  1TYQ C;  4BH6 A;  3K71 A;  1GXR A;  5IGO A;  1UOQ A;  4D6V A;  1E8M A;  3DDU A;  4JSV C;  4QAM A;  5M61 A;  5HE1 B;  3IJ0 A;  3MVD K;  2HU7 A;  3I89 A;  3VA6 A;  1E8N A;  5KDO B;  2HYE A;  5FLX g;  3HFQ A;  3EQ7 A;  3C99 A;  4GGD A;  1N6E A;  4J82 A;  5IGQ A;  3I8C A;  4JD2 C;  1RI6 A;  3O4H A;  2HKM A;  3RFG A;  1M1X A;  3K6S A;  1L5G A;  2PM9 B;  3EI4 A;  4DNW A;  4ZOY A;  4PSW B;  3JRP A;  4CZX A;  1N6D A;  4GMB A;  4U7A A;  3SVW D;  5M5R A;  1UOO A;  3IUQ A;  2H9L A;  1H2Z A;  3PVW B;  2CE9 A;  5FKT A;  3EQ8 A;  5TEE A;  1GOG A;  1QFM A;  3VI4 A;  1XIP A;  5M5S A;  4NC4 A;  1UTC A;  4A0A B;  3JRO A;  5E6S A;  4CY5 A;  3OKW A;  3W15 A;  4BCB A;  4J86 A;  4CY3 A;  3OW8 A;  1MG3 A;  2EID A;  4D0K A;  2I3T A;  3EWE A;  3I7K A;  3IIY A;  1UOP A;  3CFS B;  2HU5 A;  3IJ1 A;  3C9C A;  3ZDY A;  5C92 A;  4CI3 A;  2J57 G;  4FA9 D;  2VC2 A;  2XU7 A;  3EI1 A;  5K19 A;  3UVN A;  3L4M D;  2J56 H;  4JSP C;  1PBY B;  3SWS D;  4FWW A;  3IKO A;  4L1M A;  2OK4 A;  4JT5 C;  2YB8 B;  5EM2 A;  3N0E A;  2VZ3 A;  1U2V C;  5THA A;  5CYK A;  4G1M A;  4FA1 D;  4CI8 A;  2HES X;  2IUQ A;  2TRC B;  1L0Q A;  2I3S A;  1K32 A;  1P22 A;  1QFS A;  2YNO A;  2AQ5 A;  4A11 B;  2BBK H;  5IJ7 E;  1YR2 A;  2VDK A;  4DNU A;  3L4O D;  3NIG A;  3DM0 A;  5TEF A;  5I5I A;  3C5M A;  3SMR A;  2VDP A;  3UVM A;  4QRJ A;  3FRX A;  2AH1 A;  5EAM A;  3FCS A;  3RFH A;  3ULE C;  5H14 A;  4X3E A;  3UVK A;  3SBQ A;  4O1Q D;  5FXY A;  4GQ2 P;  1BPO A;  3CFV A;  1GOT B;  3MZK A;  2QC5 A;  4GQB B;  5CXB A;  2XE4 A;  5IT9 g;  5TF2 A;  2OK6 A;  1YFQ A;  4WK4 A;  2UZX B;  3F3G A;  3IUM A;  5AMS A;  4FHL A;  4GM9 A;  3RLM D;  4FAN D;  2G99 A;  4HDJ A;  3FGB A;  3EI2 B;  5GSA A;  3OF7 A;  4E5Z B;  2EIE A;  5HE3 B;  1PEV A;  4PNK B;  1E5T A;  2HJ4 A;  4J87 A;  3SHF A;  4ZOZ A;  2H47 A;  1JMZ B;  1VZ3 A;  2UZY B;  3VGZ A;  2H9M A;  4ZOV A;  4H5J A;  2BCJ B;  4WJK A;  4XEI C;  2B5N A;  4O3U B;  1OMW B;  3SN6 B;  1QNI A;  4U1E I;  1H2X A;  5A2Q g;  2CN3 A;  2XL2 A;  4QT8 A;  2EIB A;  4J81 A;  3OKY A;  4G1E A;  3PXT D;  3UVO A;  4AX4 A;  4AN1 A;  4R7A B;  4CZV A;  1ERJ A;  2GC4 A;  4K3I D;  4IRZ A;  3SBP A;  5C2V B;  4PBZ A;  4LGN A;  2H9P A;  3VI3 A;  3V4P A;  3UKU C;  3V7D B;  1GP2 B;  3JAM g;  4J79 A;  5FFG A;  3T3P A;  4ES0 A;  3KCI A;  1SQJ A;  2H14 A;  2O9K A;  1C9I A;  1S4U X;  3T3M A;  5HQG A;  3MXX A;  3RRM C;  2GC7 A;  2H3X A;  1B9Y A;  3GD1 I;  3JZG A;  2W18 A;  3I7L A;  3BG0 A;  2CO0 A;  5M5T A;  1H2W A;  3IUJ A;  3EI4 B;  3MKS B;  4I79 A;  5K1C C;  3SJL D;  3I7O A;  3IIW A;  2VDM A;  4QQE A;  3ZWL B;  4BCC A;  1FWX A;  2XDW A;  1K8K C;  1I2M B;  3EQ9 A;  4ERQ A;  5GMK n;  5EMK B;  5CXC A;  1TYE A;  5C2W B;  3OL2 A;  3NVX A;  3IJE A;  5M5U A;  3EG6 A;  4BCD A;  2H6Q A;  2AH0 A;  4X61 B;  4CI1 A;  2Z2N A;  4A09 A;  3P4F A;  5H1M A;  4FB1 D;  2VZ1 A;  3KRX B;  4CY2 A;  3EU7 A;  3GC3 B;  2XZG A;  1C9L A;  4GQ1 A;  5E6U A;  4J8G A;  4J78 A;  4J73 A;  4MMX A;  4A0B A;  4BUJ C;  4L3H D;  1T2X A;  4L3G D;  5E6R A;  3SXT D;  4BP9 A;  3EI1 B;  3O4G A;  4Z7N A;  2P9N C;  4ZOX A;  2IUP A;  3PVU B;  3NVN A;  5HDB A;  3JB9 L;  2PM6 B;  2I0S A;  3A0F A;  5EM2 B;  4AMY A;  3I7N A;  2OVR B;  3DSM A;  4MMZ A;  2AGL A;  2BKL A;  5CYK B;  4JSN C;  4AMZ A;  4GGA A;  3SBR A;  1PI6 A;  4Z7O A;  2P9K C;  3SLE D;  3E0C A;  5SXM A;  4AEZ A;  2AGX A; 
#chains in the Genus database with same CATH homology
 5I5J A;  4E54 A;  2IUR A;  4ERY A;  4CZY A;  4NSX A;  2OVP B;  2IUV A;  3OTT A;  3I7P A;  2P9L C;  2HKR A;  4IA9 A;  4Y7R A;  3N0D A;  3EI3 A;  4PXW A;  3UR4 A;  5CXB B;  5EAL A;  3CIK B;  2EBS A;  4JSX C;  3GFC A;  3ODT A;  4CI2 A;  2P9I C;  4J8B A;  3V5W B;  2I0T A;  5C9Z B;  3C75 H;  2P9P C;  3OKT A;  4O3T B;  4ZN4 A;  4A08 A;  4KFM B;  3BG1 A;  3DWL C;  3MMY A;  2IWF A;  1MDA H;  4YVD A;  4PSX B;  3PXS D;  2B4E A;  2CO0 C;  4EWR A;  5GXH A;  3AL8 A;  3JPX A;  5I5M A;  1XHM A;  3SFZ A;  5FQD A;  2MTA H;  1U4C A;  1MG2 A;  4MK0 B;  3I2N A;  5FKR A;  5IC7 A;  4ESG A;  2Z2P A;  3OKY B;  5EML B;  4L9O A;  2P9S C;  3VH0 A;  2PM7 B;  4FA5 D;  1SHY B;  1VYH C;  2Z2O A;  4Z8L A;  4O9D A;  3V9F A;  3IJC A;  1N6F A;  4LG8 A;  1SQ9 A;  4OZU A;  4QL1 A;  3GRE A;  3F3F A;  3DXM C;  5IJ8 E;  3PSC B;  3BWS A;  4JT6 C;  2AGW A;  5FKS A;  3MZL A;  2PM9 A;  1PGU A;  2H68 A;  3UVL A;  3AFC A;  3MKQ A;  5B4W A;  4Y5R D;  2AGZ A;  2GNQ A;  3B7F A;  4XYH A;  3DXK C;  3FM0 A;  3RMZ D;  4LG9 A;  3K26 A;  4K3J B;  4PBY A;  2OJY A;  3NVQ A;  2YNP A;  5FA5 B;  3PXW D;  1NR0 A;  4A0A A;  5AFU 3;  5FKQ A;  4BL0 A;  1GG2 B;  5CXC B;  5EMM B;  4UI9 R;  3OL2 B;  2I0R A;  5EAP A;  2B5M A;  3EMH A;  3AH8 B;  5JWZ A;  4A09 B;  2G9A A;  1R5M A;  2H9N A;  1B9X A;  2H13 A;  1JOF A;  1TBG A;  4A2M A;  3F3P A;  3PSL A;  4JXM A;  5EMJ B;  3RN1 D;  2YMU A;  4GM3 A;  4ERZ A;  4X60 B;  4A0B B;  4CY1 A;  4PC0 A;  5HE2 B;  4J84 A;  4X63 B;  5AJA A;  2XYI A;  3JZH A;  2YNN A;  2HXC A;  4G56 B;  3RN0 D;  4A11 A;  4GM8 A;  4J0X A;  4GGC A;  2CE8 A;  2B5L A;  2OVQ B;  2CN2 A;  5GXI A;  1Q47 A;  2PBI B;  4N14 A;  3K27 A;  4TZ4 A;  4L1Q D;  2Q7Q A;  4E54 B;  2H6N A;  4J77 A;  4OWR A;  4A7J A;  2CNX A;  3U4Y A;  1NEX B;  2H6K A;  2AGY A;  3ORV D;  3I8E A;  3EI3 B;  4CC9 A;  4AOW A;  4GZ8 A;  4IMM A;  4J0W A;  4FAV D;  3EI2 A;  1OLZ A;  3AL9 A;  4E5Z A;  2YBA A;  4XYI A;  3J81 g;  1XKS A;  3JZN A;  3PE7 A;  2OIZ A;  1JJU B;  3I7H A;  3UKR C;  5EAR A;  5H17 A;  2IAA A;  5HE0 B;  3J80 g;  4A08 B;  4A2L A;  2P9U C;  5HYN B;  5TDH B;  2HJB A;  2J55 H;  4O45 A;  3SCY A;  2QXV A;  3KRW B;  1A0R B;  1JMX B;  3AL8 B;  4FA4 D;  4H5I A;  2IWK A;  2XL3 A;  3RSE C;  1TYQ C;  4BH6 A;  1GXR A;  5IGO A;  4D6V A;  4JSV C;  5HE1 B;  3IJ0 A;  3I89 A;  3VA6 A;  2HYE A;  5KDO B;  5FLX g;  3HFQ A;  4GGD A;  3C99 A;  1N6E A;  4J82 A;  5IGQ A;  3I8C A;  4JD2 C;  1RI6 A;  3RFG A;  2HKM A;  2PM9 B;  3EI4 A;  4ZOY A;  4PSW B;  3JRP A;  4CZX A;  1N6D A;  4GMB A;  4U7A A;  3SVW D;  2H9L A;  3PVW B;  2CE9 A;  5FKT A;  5TEE A;  1XIP A;  4A0A B;  3JRO A;  4CY5 A;  3OKW A;  3W15 A;  4CY3 A;  4J86 A;  3OW8 A;  1MG3 A;  4D0K A;  2I3T A;  3EWE A;  3I7K A;  3IIY A;  4CI3 A;  3CFS B;  3IJ1 A;  3C9C A;  2J57 G;  4FA9 D;  2XU7 A;  3EI1 A;  5K19 A;  3UVN A;  3L4M D;  2J56 H;  4JSP C;  1PBY B;  3SWS D;  4FWW A;  3IKO A;  2OK4 A;  4JT5 C;  2YB8 B;  5EM2 A;  3N0E A;  1U2V C;  5THA A;  5CYK A;  4FA1 D;  4CI8 A;  2HES X;  2IUQ A;  2TRC B;  1L0Q A;  2I3S A;  1K32 A;  1P22 A;  2YNO A;  2AQ5 A;  4A11 B;  2BBK H;  5IJ7 E;  3L4O D;  3DM0 A;  5TEF A;  5I5I A;  3C5M A;  3SMR A;  3UVM A;  4QRJ A;  3FRX A;  2AH1 A;  5EAM A;  3RFH A;  3ULE C;  5H14 A;  4X3E A;  3UVK A;  3SBQ A;  4O1Q D;  5FXY A;  4GQ2 P;  3CFV A;  1GOT B;  3MZK A;  2QC5 A;  4GQB B;  5CXB A;  5IT9 g;  5TF2 A;  2OK6 A;  1YFQ A;  2UZX B;  3F3G A;  5AMS A;  3RLM D;  4FHL A;  4GM9 A;  4FAN D;  2G99 A;  4HDJ A;  3FGB A;  3EI2 B;  5GSA A;  4E5Z B;  5HE3 B;  1PEV A;  4PNK B;  2HJ4 A;  4J87 A;  3SHF A;  4ZOZ A;  2H47 A;  1JMZ B;  2UZY B;  3VGZ A;  2H9M A;  4ZOV A;  4H5J A;  2BCJ B;  4XEI C;  2B5N A;  4O3U B;  1OMW B;  3SN6 B;  1QNI A;  4U1E I;  5A2Q g;  2CN3 A;  2XL2 A;  4QT8 A;  4J81 A;  3OKY A;  3UVO A;  3PXT D;  4R7A B;  4CZV A;  1ERJ A;  2GC4 A;  4K3I D;  3SBP A;  5C2V B;  4PBZ A;  4LGN A;  2H9P A;  3UKU C;  3V7D B;  1GP2 B;  3JAM g;  4J79 A;  4ES0 A;  1SQJ A;  2H14 A;  2O9K A;  1S4U X;  5HQG A;  3MXX A;  3RRM C;  2GC7 A;  2H3X A;  1B9Y A;  2W18 A;  3JZG A;  3I7L A;  3BG0 A;  2CO0 A;  3EI4 B;  3MKS B;  4I79 A;  5K1C C;  3SJL D;  3I7O A;  3IIW A;  3ZWL B;  4QQE A;  1FWX A;  1K8K C;  5GMK n;  4ERQ A;  5EMK B;  5CXC A;  5C2W B;  3OL2 A;  3NVX A;  3EG6 A;  2H6Q A;  2AH0 A;  4X61 B;  4CI1 A;  2Z2N A;  4A09 A;  3P4F A;  5H1M A;  4FB1 D;  3KRX B;  4CY2 A;  3EU7 A;  4GQ1 A;  4J8G A;  4J78 A;  4J73 A;  4A0B A;  4BUJ C;  4L3H D;  4L3G D;  3SXT D;  3EI1 B;  2P9N C;  4ZOX A;  2IUP A;  3PVU B;  3NVN A;  3JB9 L;  2PM6 B;  2I0S A;  3A0F A;  5EM2 B;  3I7N A;  2OVR B;  3DSM A;  2AGL A;  5CYK B;  4JSN C;  4GGA A;  3SBR A;  1PI6 A;  2P9K C;  3SLE D;  3E0C A;  5SXM A;  4AEZ A;  2AGX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...