4QRJA

Crystal structure of a putative 6-phosphogluconolactonase (bacuni_04672) from bacteroides uniformis atcc 8492 at 2.20 a resolution
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
345
structure length
345
Chain Sequence
DQDELAMLIGTYTNGSSKGIYTFRFNQETGTAVPLSSAALPNPSYLVPSEDGEFVYAVSEMNDSTAALSSLAFDRETGELRLLNTVPTFGADPCYVATNGREVLTANYSGGTMSVFPLQKDGTLAPADTLFQGSATGPDAIRQATPHIHCTVFSPDGKYIFATDFSADRILRFVMHPDNPIPHASLEAVGIEADSGPRHLTFSPNGKFAYLITELSGKVIAFSYDDGCLEQIQTITADTVAARGSADIHLSPDGKYLYASNRLKEDGIAIFAVNPENGTLAKVGYQPTGIHPRNFNITPNGKYLLAACRDSNVIQVYKRNEVTGLLEDTHQDIVVDMPVCVQFVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords putative 6-phosphogluconolactonase
publication title Crystal structure of a putative 6-phosphogluconolactonase (BACUNI_04672) from Bacteroides uniformis ATCC 8492 at 2.20 A resolution
rcsb
source organism Bacteroides uniformis atcc 8492
total genus 89
structure length 345
sequence length 345
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10282 Lactonase Lactonase, 7-bladed beta-propeller
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4qrjA00
2QC5A 1NEXB 5CYKA 4J87A 3C5MA 2H6KA 5IGOA 3UKRC 4PSXB 4X60B 3SLED 3V7DB 3JZNA 5CXBB 1N6FA 4O3UB 3EI4B 4Y5RD 3OKWA 4JSPC 3NVNA 4GQ1A 2MTAH 2I0TA 5FKSA 1PI6A 2B5NA 4E54A 2B5MA 2PM9B 1XHMA 5SXMA 4A7JA 3J81g 5IJ7E 5EAMA 2AH1A 4GQBB 3BWSA 3ULEC 3JB9L 2HKMA 2IURA 3EMHA 1K8KC 3PVUB 5CYKB 2YNOA 3I2NA 4X3EA 2AGWA 2I3TA 5H1MA 5HE3B 3VA6A 3OKYA 5FLXg 4A0AA 1OLZA 2XU7A 2GC7A 2J57G 5EMMB 2Z2NA 4H5JA 4A08A 3IJCA 4GZ8A 4J0WA 1JJUB 4QT8A 3JZHA 4J82A 3SXTD 2CO0A 4QQEA 2YBAA 3PSLA 3V9FA 4E54B 2AQ5A 4FB1D 5K1CC 4FHLA 2H68A 2QXVA 2UZXB 3B7FA 1PGUA 2O9KA 4I79A 3RN1D 4AOWA 4XEIC 5IC7A 2I0SA 2PBIB 2Z2OA 1GOTB 4CI1A 4ERQA 5C2VB 2IAAA 5EAPA 1JMZB 3OKYB 4A0AB 2P9PC 4J73A 1ERJA 2YNPA 2YB8B 2H9NA 4U7AA 5FQDA 5KDOB 4A08B 2H6QA 1OMWB 1SHYB 3PXTD 3U4YA 4FA4D 4J8BA 4PBYA 1TBGA 4A0BA 3L4MD 4FAND 5I5IA 1SQ9A 5K19A 2PM9A 5C2WB 1FWXA 2HXCA 3FGBA 5A2Qg 5TEFA 1PEVA 3EU7A 2XYIA 4GMBA 2Z2PA 2J56H 4R7AB 3I7KA 1XKSA 3KRWB 2H9PA 2CE9A 4CC9A 5GMKn 4J79A 3AL8A 4JD2C 4FA1D 2XL3A 4JSNC 2YNNA 4JT6C 3E0CA 4FWWA 3F3FA 2G9AA 4Y7RA 5EM2A 3PXWD 4H5IA 3SMRA 5JWZA 4CI3A 4JXMA 4JT5C 4OWRA 2AGYA 5TDHB 4A0BB 4PSWB 3DSMA 3EG6A 3EI2A 3RRMC 1P22A 3I7HA 4GGCA 4ZOVA 4UI9R 4E5ZA 4ERYA 5CXCA 3UR4A 3IJ0A 4OZUA 1YFQA 3OW8A 3AL9A 4L3HD 4BUJC 3C9CA 5C9ZB 4O1QD 4ERZA 3N0DA 3AL8B 1SQJA 1B9XA 3HFQA 4A2LA 3F3PA 2HYEA 3VGZA 4HDJA 3I89A 3JPXA 4ZOXA 5AFU3 5HYNB 4CZVA 3IKOA 5GXIA 5EM2B 2P9KC 4O45A 2OJYA 2P9UC 3JZGA 4J78A 3MZKA 5I5JA 3ODTA 3DXMC 2H9LA 1MG3A 4BL0A 2G99A 3OL2A 3VH0A 2IWFA 4O9DA 2H6NA 2H47A 3EI2B 4YVDA 4CY1A 3AFCA 5EMKB 4J77A 1JOFA 3SWSD 3SCYA 3BG1A 4E5ZB 3F3GA 5CXCB 3SHFA 3J80g 3UVKA 3SVWD 4FA9D 1B9YA 4PNKB 4NSXA 5FKQA 3RN0D 3A0FA 3RSEC 4L9OA 3ZWLB 3PE7A 4J8GA 4LG8A 2AGXA 3PXSD 3SBRA 2HKRA 2I3SA 2P9IC 1MDAH 4CI8A 3UVNA 3EI3A 3OL2B 4A11A 4L3GD 4XYHA 2OIZA 2CN2A 5FKTA 2P9NC 3I7OA 3BG0A 2HESX 4XYIA 4ZOYA 3W15A 1K32A 5TF2A 5FKRA 4ES0A 5TEEA 5IT9g 2H13A 4JSXC 4K3ID 3UVOA 1GG2B 3ORVD 3FRXA 4EWRA 4CI2A 1S4UX 3DM0A 3I7NA 3NVXA 3DXKC 2IWKA 3DWLC 3V5WB 5FXYA 3I8EA 1R5MA 3I7PA 1Q47A 2W18A 4IMMA 3CFVA 3L4OD 4IA9A 3KRXB 4PBZA 5B4WA 3MZLA 2IUQA 3IIYA 5GSAA 3PSCB 3EI3B 3NVQA 3MKQA 2J55H 4A11B 4GGDA 4BH6A 1L0QA 3EI1A 3MKSB 5IGQA 3EWEA 2Q7QA 4J0XA 4CY2A 4G56B 3IIWA 5THAA 3N0EA 4KFMB 1GXRA 4L1QD 2OVQB 3PVWB 3RLMD 3UVMA 3K27A 3SN6B 2IUVA 4MK0B 4D6VA 2I0RA 4TZ4A 4ZOZA 2UZYB 5EMLB 2OVRB 3UVLA 3CFSB 2IUPA 2AH0A 3SJLD 4CY3A 4U1EI 4J86A 2H3XA 1VYHC 4QRJA 5AMSA 2AGLA 4O3TB 4LG9A 5AJAA 3OKTA 3SBQA 2CNXA 4GM9A 1TYQC 5EALA 3JROA 2H9MA 3UKUC 3AH8B 5IJ8E 5FA5B 3JAMg 3EI1B 1U4CA 4AEZA 5HE0B 4X63B 2EBSA 2GC4A 1N6EA 2P9SC 4GM3A 4PXWA 2PM6B 3SFZA 3RFHA 1U2VC 2CE8A 1JMXB 2OK4A 4N14A 1RI6A 4QL1A 3I8CA 3RMZD 3OTTA 5I5MA 3CIKB 3FM0A 4CZYA 2OVPB 5H17A 2CN3A 5HQGA 3GFCA 2PM7B 2BBKH 5GXHA 2GNQA 4GM8A 4A09A 5EARA 2CO0C 1XIPA 4PC0A 4GGAA 3SBPA 3JRPA 2YMUA 3P4FA 5HE1B 4J84A 4CY5A 2HJBA 3C75H 5CXBA 1NR0A 3GREA 3EI4A 4FA5D 4D0KA 4CZXA 4X61B 2BCJB 4GQ2P 2B5LA 4K3JB 1N6DA 3MMYA 2H14A 5EMJB 4J81A 2OK6A 2TRCB 3RFGA 4Z8LA 2AGZA 3IJ1A 3C99A 2HJ4A 4A2MA 3I7LA 1A0RB 2P9LC 2XL2A 1MG2A 2B4EA 4ZN4A 5HE2B 4ESGA 4A09B 4LGNA 1QNIA 3K26A 1PBYB 4FAVD 4JSVC 5H14A 1GP2B 3MXXA
chains in the Genus database with same CATH superfamily
2QC5A 1NEXB 5CYKA 4J87A 4Z7NA 3C5MA 2VDNA 3EQ7A 2H6KA 1YR2A 5IGOA 1TYEA 3UKRC 4PSXB 4X60B 3SLED 3V7DB 3JZNA 5CXBB 1N6FA 4O3UB 3EI4B 4Y5RD 2VDOA 3MUNA 3OKWA 4JSPC 3NVNA 2EIDA 4GQ1A 2MTAH 2I0TA 5FKSA 1PI6A 2B5NA 4E54A 2B5MA 2PM9B 1XHMA 5SXMA 4A7JA 2EIEA 1I2MB 4L1MA 3J81g 5IJ7E 5EAMA 2AH1A 4GQBB 3BWSA 3ULEC 3GC3B 4WK4A 3JB9L 2HKMA 2IURA 3EMHA 1K8KC 3PVUB 4O2WA 5CYKB 2YNOA 3I2NA 4WK2A 4X3EA 2AGWA 2I3TA 5H1MA 5HE3B 3VA6A 3OKYA 4AMYA 5FLXg 4A0AA 1OLZA 2XU7A 2GC7A 2J57G 5EMMB 2Z2NA 4H5JA 4A08A 3IJCA 4GZ8A 4J0WA 3MUOA 1JJUB 4QT8A 3JZHA 4J82A 3VI3A 3SXTD 2CO0A 5M5TA 4QQEA 2YBAA 3PSLA 3V9FA 4E54B 2AQ5A 4FB1D 5M5RA 5K1CC 4BP9A 4FHLA 2H68A 2QXVA 2UZXB 3B7FA 3ZDZA 1PGUA 2O9KA 4I79A 3RN1D 4AOWA 1UOPA 4XEIC 5IC7A 4RE6A 2I0SA 2PBIB 1VZ2A 2Z2OA 1GOTB 4UM8A 4CI1A 4ERQA 5C2VB 2IAAA 5EAPA 1JMZB 3OKYB 4A0AB 2P9PC 4J73A 1ERJA 2YNPA 2YB8B 2H9NA 2HU7A 4U7AA 5FQDA 5KDOB 3K71A 4A08B 2H6QA 1OMWB 3FCSA 1SHYB 3PXTD 3T3MA 3U4YA 4DNVA 4FA4D 3QI0A 4J8BA 4PBYA 2EICA 5M5UA 1TBGA 1QFMA 4A0BA 3L4MD 4QAMA 5E6RA 2XZGA 1SQ9A 4FAND 5I5IA 5K19A 2XDWA 2PM9A 5C2WB 1FWXA 2HXCA 3FGBA 4WJKA 1E8NA 5A2Qg 5TEFA 1PEVA 3EU7A 2XYIA 4GMBA 4AN1A 2Z2PA 2J56H 4R7AB 3I7KA 1U8CA 1XKSA 3KRWB 2VDKA 1H2YA 2H9PA 2CE9A 4JHPC 4CC9A 5GMKn 4J79A 3AL8A 4JD2C 3IUQA 3GD1I 4BP8A 4FA1D 2XL3A 4AN0A 4JSNC 3OF7A 4MMYA 2YNNA 4JT6C 3E0CA 4FWWA 3F3FA 2G9AA 4Y7RA 5EM2A 1GOFA 3PXWD 4H5IA 3SMRA 5JWZA 4O02A 4CI3A 2EIBA 4JXMA 4JT5C 4OWRA 2AGYA 5TDHB 4A0BB 3MVDK 4PSWB 3DSMA 3EG6A 3EI2A 5FFOA 3RRMC 1P22A 3I7HA 4GGCA 4ZOVA 4UI9R 4E5ZA 4ERYA 5CXCA 3UR4A 1C9LA 1M1XA 3IJ0A 4OZUA 1BPOA 1YFQA 3OW8A 3ZE1A 3AL9A 2XE4A 3NIFA 4L3HD 4BUJC 2HU5A 3C9CA 5C9ZB 4O1QD 4ERZA 3N0DA 3AL8B 1SQJA 1B9XA 3HFQA 4A2LA 3F3PA 2HYEA 3VGZA 1H2WA 4HDJA 1JTDB 5C86A 3I89A 3JPXA 4JHNA 4ZOXA 5AFU3 5HYNB 4CZVA 5C92A 3IKOA 5GXIA 4Z7OA 5EM2B 2P9KC 5E6UA 4O45A 2OJYA 2P9UC 3JZGA 2BKLA 4J78A 3MZKA 4NC4A 5I5JA 3O4GA 3ODTA 3DXMC 2H9LA 1MG3A 4BL0A 2G99A 2VDMA 3OL2A 2WQ8A 3O4HA 3VH0A 2IWFA 4O9DA 2H6NA 2H47A 3EI2B 4YVDA 4CY1A 3AFCA 5EMKB 3IUMA 1JOFA 4J77A 3SWSD 3SCYA 3BG1A 4E5ZB 3F3GA 1H2XA 5CXCB 4DNWA 3SHFA 3J80g 3UVKA 3SVWD 4FA9D 1B9YA 4PNKB 4NSXA 5FKQA 3RN0D 3A0FA 3RSEC 4WK0A 4L9OA 1QFSA 3ZWLB 3PE7A 4J8GA 4LG8A 2AGXA 3PXSD 1JV2A 3SBRA 2HKRA 2I3SA 2P9IC 1MDAH 3ZE2A 4CI8A 3UVNA 4AMZA 2JKXA 4AX4A 1A12A 3EI3A 3OL2B 3ZDXA 4A11A 4L3GD 4XYHA 1T2XA 2OIZA 2CN2A 5FKTA 3ZE0A 2P9NC 3VI4A 3I7OA 3BG0A 2HESX 4XYIA 4ZOYA 3W15A 1K32A 5TF2A 5FKRA 4MMZA 4ES0A 5TEEA 1O6FA 5IT9g 2H13A 4JSXC 4K3ID 3UVOA 2QR5A 1GG2B 3EQ9A 2VZ3A 3ORVD 3FRXA 3O4JA 4EWRA 4CI2A 1S4UX 3DDUA 3DM0A 3I7NA 3NVXA 3DXKC 2IWKA 3DWLC 3V5WB 2VDLA 5FXYA 3I8EA 1O6GA 1R5MA 3I7PA 1UOOA 1Q47A 2W18A 4IMMA 3CFVA 3L4OD 4IA9A 3KRXB 4PBZA 5B4WA 3MZLA 2IUQA 3IIYA 3IURA 5GSAA 3PSCB 3EI3B 3NVQA 3MKQA 4BCBA 2J55H 3K72A 4A11B 5M5SA 4GGDA 4BH6A 1L0QA 4MMXA 4Z7QA 3EI1A 2VC2A 3MKSB 5IGQA 3EWEA 2Q7QA 4J0XA 4CY2A 4G56B 3IULA 3IIWA 5THAA 3N0EA 4KFMB 1GXRA 1VE7A 4L1QD 2OVQB 3PVWB 3RLMD 5M5VA 3UVMA 3K27A 3SN6B 1C9IA 2IUVA 4MK0B 4D6VA 2I0RA 4TZ4A 4ZOZA 2UZYB 5EMLB 2OVRB 3UVLA 3CFSB 3EQ8A 3IJEA 2IUPA 2AH0A 3SJLD 2VDPA 3V4PA 4CY3A 4U1EI 4J86A 2H3XA 1VYHC 4QRJA 5AMSA 4IRZA 4BCCA 3V4VA 2AGLA 4O3TB 4LG9A 5AJAA 3OKTA 4RE5A 2CNXA 3SBQA 1H2ZA 3K6SA 4GM9A 1TYQC 3FCUA 5EALA 3JROA 2H9MA 3UKUC 3AH8B 5IJ8E 5FA5B 3IUJA 3JAMg 3EI1B 1U4CA 3KCIA 4AEZA 5HE0B 4X63B 2EBSA 4NBMA 2GC4A 1N6EA 1GOGA 2P9SC 4GM3A 4PXWA 2PM6B 3SFZA 4G1MA 4DNUA 3RFHA 1U2VC 1VZ3A 2CE8A 3O4IA 1JMXB 2OK4A 4N14A 1RI6A 4QL1A 3I8CA 3RMZD 3ZDYA 4UM9A 3OTTA 5I5MA 3CIKB 3FM0A 4CZYA 2OVPB 5H17A 2CN3A 4D9SA 3IVMA 4NAAA 5HQGA 3GFCA 1E5TA 5E6SA 2PM7B 2BBKH 5GXHA 2GNQA 5FFGA 2VZ1A 4GM8A 4A09A 5EARA 2VDQA 2CO0C 3NIGA 1XIPA 4PC0A 1E8MA 1L5GA 1VE6A 4GGAA 3SBPA 3JRPA 2YMUA 3P4FA 5HE1B 4J84A 4BCDA 4CY5A 2HJBA 3C75H 5CXBA 4NENA 1NR0A 3NIDA 4G55A 3GREA 3EI4A 4FA5D 4D0KA 4CZXA 4X61B 2BCJB 4GQ2P 3IUNA 2QZPA 2B5LA 3MMYA 1N6DA 4K3JB 2H14A 5EMJB 4J81A 2OK6A 1GOHA 2TRCB 1K3IA 3RFGA 4Z8LA 3T3PA 2AGZA 2VDRA 3IJ1A 3C99A 1UTCA 2HJ4A 4A2MA 3QHYB 3I7LA 1A0RB 2P9LC 2XL2A 1MG2A 2B4EA 4ZN4A 5HE2B 5M61A 4ESGA 5HDBA 4A09B 4LGNA 1QNIA 3K26A 2HU8A 1PBYB 4FAVD 4JSVC 5H14A 1GP2B 3MXXA 1UOQA 4G1EA
chains in the Genus database with same CATH topology
2QC5A 1NEXB 5CYKA 4J87A 3C5MA 2H6KA 5IGOA 3UKRC 4PSXB 4X60B 3SLED 3V7DB 3JZNA 5CXBB 1N6FA 4O3UB 3EI4B 4Y5RD 3OKWA 4JSPC 3NVNA 4GQ1A 2MTAH 2I0TA 5FKSA 1PI6A 2B5NA 4E54A 2B5MA 2PM9B 1XHMA 5SXMA 4A7JA 3J81g 5IJ7E 5EAMA 2AH1A 4GQBB 3BWSA 3ULEC 3JB9L 2HKMA 2IURA 3EMHA 1K8KC 3PVUB 5CYKB 2YNOA 3I2NA 4X3EA 2AGWA 2I3TA 5H1MA 5HE3B 3VA6A 3OKYA 5FLXg 4A0AA 1OLZA 2XU7A 2GC7A 2J57G 5EMMB 2Z2NA 4H5JA 4A08A 3IJCA 4GZ8A 4J0WA 1JJUB 4QT8A 3JZHA 4J82A 3SXTD 2CO0A 4QQEA 2YBAA 3PSLA 3V9FA 4E54B 2AQ5A 4FB1D 5K1CC 4FHLA 2H68A 2QXVA 2UZXB 3B7FA 1PGUA 2O9KA 4I79A 3RN1D 4AOWA 4XEIC 5IC7A 2I0SA 2PBIB 2Z2OA 1GOTB 4CI1A 4ERQA 5C2VB 2IAAA 5EAPA 1JMZB 3OKYB 4A0AB 2P9PC 4J73A 1ERJA 2YNPA 2YB8B 2H9NA 4U7AA 5FQDA 5KDOB 4A08B 2H6QA 1OMWB 1SHYB 3PXTD 3U4YA 4FA4D 4J8BA 4PBYA 1TBGA 4A0BA 3L4MD 4FAND 5I5IA 1SQ9A 5K19A 2PM9A 5C2WB 1FWXA 2HXCA 3FGBA 5A2Qg 5TEFA 1PEVA 3EU7A 2XYIA 4GMBA 2Z2PA 2J56H 4R7AB 3I7KA 1XKSA 3KRWB 2H9PA 2CE9A 4CC9A 5GMKn 4J79A 3AL8A 4JD2C 4FA1D 2XL3A 4JSNC 2YNNA 4JT6C 3E0CA 4FWWA 3F3FA 2G9AA 4Y7RA 5EM2A 3PXWD 4H5IA 3SMRA 5JWZA 4CI3A 4JXMA 4JT5C 4OWRA 2AGYA 5TDHB 4A0BB 4PSWB 3DSMA 3EG6A 3EI2A 3RRMC 1P22A 3I7HA 4GGCA 4ZOVA 4UI9R 4E5ZA 4ERYA 5CXCA 3UR4A 3IJ0A 4OZUA 1YFQA 3OW8A 3AL9A 4L3HD 4BUJC 3C9CA 5C9ZB 4O1QD 4ERZA 3N0DA 3AL8B 1SQJA 1B9XA 3HFQA 4A2LA 3F3PA 2HYEA 3VGZA 4HDJA 3I89A 3JPXA 4ZOXA 5AFU3 5HYNB 4CZVA 3IKOA 5GXIA 5EM2B 2P9KC 4O45A 2OJYA 2P9UC 3JZGA 4J78A 3MZKA 5I5JA 3ODTA 3DXMC 2H9LA 1MG3A 4BL0A 2G99A 3OL2A 3VH0A 2IWFA 4O9DA 2H6NA 2H47A 3EI2B 4YVDA 4CY1A 3AFCA 5EMKB 4J77A 1JOFA 3SWSD 3SCYA 3BG1A 4E5ZB 3F3GA 5CXCB 3SHFA 3J80g 3UVKA 3SVWD 4FA9D 1B9YA 4PNKB 4NSXA 5FKQA 3RN0D 3A0FA 3RSEC 4L9OA 3ZWLB 3PE7A 4J8GA 4LG8A 2AGXA 3PXSD 3SBRA 2HKRA 2I3SA 2P9IC 1MDAH 4CI8A 3UVNA 3EI3A 3OL2B 4A11A 4L3GD 4XYHA 2OIZA 2CN2A 5FKTA 2P9NC 3I7OA 3BG0A 2HESX 4XYIA 4ZOYA 3W15A 1K32A 5TF2A 5FKRA 4ES0A 5TEEA 5IT9g 2H13A 4JSXC 4K3ID 3UVOA 1GG2B 3ORVD 3FRXA 4EWRA 4CI2A 1S4UX 3DM0A 3I7NA 3NVXA 3DXKC 2IWKA 3DWLC 3V5WB 5FXYA 3I8EA 1R5MA 3I7PA 1Q47A 2W18A 4IMMA 3CFVA 3L4OD 4IA9A 3KRXB 4PBZA 5B4WA 3MZLA 2IUQA 3IIYA 5GSAA 3PSCB 3EI3B 3NVQA 3MKQA 2J55H 4A11B 4GGDA 4BH6A 1L0QA 3EI1A 3MKSB 5IGQA 3EWEA 2Q7QA 4J0XA 4CY2A 4G56B 3IIWA 5THAA 3N0EA 4KFMB 1GXRA 4L1QD 2OVQB 3PVWB 3RLMD 3UVMA 3K27A 3SN6B 2IUVA 4MK0B 4D6VA 2I0RA 4TZ4A 4ZOZA 2UZYB 5EMLB 2OVRB 3UVLA 3CFSB 2IUPA 2AH0A 3SJLD 4CY3A 4U1EI 4J86A 2H3XA 1VYHC 4QRJA 5AMSA 2AGLA 4O3TB 4LG9A 5AJAA 3OKTA 3SBQA 2CNXA 4GM9A 1TYQC 5EALA 3JROA 2H9MA 3UKUC 3AH8B 5IJ8E 5FA5B 3JAMg 3EI1B 1U4CA 4AEZA 5HE0B 4X63B 2EBSA 2GC4A 1N6EA 2P9SC 4GM3A 4PXWA 2PM6B 3SFZA 3RFHA 1U2VC 2CE8A 1JMXB 2OK4A 4N14A 1RI6A 4QL1A 3I8CA 3RMZD 3OTTA 5I5MA 3CIKB 3FM0A 4CZYA 2OVPB 5H17A 2CN3A 5HQGA 3GFCA 2PM7B 2BBKH 5GXHA 2GNQA 4GM8A 4A09A 5EARA 2CO0C 1XIPA 4PC0A 4GGAA 3SBPA 3JRPA 2YMUA 3P4FA 5HE1B 4J84A 4CY5A 2HJBA 3C75H 5CXBA 1NR0A 3GREA 3EI4A 4FA5D 4D0KA 4CZXA 4X61B 2BCJB 4GQ2P 2B5LA 4K3JB 1N6DA 3MMYA 2H14A 5EMJB 4J81A 2OK6A 2TRCB 3RFGA 4Z8LA 2AGZA 3IJ1A 3C99A 2HJ4A 4A2MA 3I7LA 1A0RB 2P9LC 2XL2A 1MG2A 2B4EA 4ZN4A 5HE2B 4ESGA 4A09B 4LGNA 1QNIA 3K26A 1PBYB 4FAVD 4JSVC 5H14A 1GP2B 3MXXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QC5 A;  1NEX B;  5CYK A;  4J87 A;  3C5M A;  2H6K A;  5IGO A;  3UKR C;  4PSX B;  4X60 B;  3SLE D;  3V7D B;  3JZN A;  5CXB B;  1N6F A;  4O3U B;  3EI4 B;  4Y5R D;  3OKW A;  4JSP C;  3NVN A;  4GQ1 A;  2MTA H;  2I0T A;  5FKS A;  1PI6 A;  2B5N A;  4E54 A;  2B5M A;  2PM9 B;  1XHM A;  5SXM A;  4A7J A;  3J81 g;  5IJ7 E;  5EAM A;  2AH1 A;  4GQB B;  3BWS A;  3ULE C;  3JB9 L;  2HKM A;  2IUR A;  3EMH A;  1K8K C;  3PVU B;  5CYK B;  2YNO A;  3I2N A;  4X3E A;  2AGW A;  2I3T A;  5H1M A;  5HE3 B;  3VA6 A;  3OKY A;  5FLX g;  4A0A A;  1OLZ A;  2XU7 A;  2GC7 A;  2J57 G;  5EMM B;  2Z2N A;  4H5J A;  4A08 A;  3IJC A;  4GZ8 A;  4J0W A;  1JJU B;  4QT8 A;  3JZH A;  4J82 A;  3SXT D;  2CO0 A;  4QQE A;  2YBA A;  3PSL A;  3V9F A;  4E54 B;  2AQ5 A;  4FB1 D;  5K1C C;  4FHL A;  2H68 A;  2QXV A;  2UZX B;  3B7F A;  1PGU A;  2O9K A;  4I79 A;  3RN1 D;  4AOW A;  4XEI C;  5IC7 A;  2I0S A;  2PBI B;  2Z2O A;  1GOT B;  4CI1 A;  4ERQ A;  5C2V B;  2IAA A;  5EAP A;  1JMZ B;  3OKY B;  4A0A B;  2P9P C;  4J73 A;  1ERJ A;  2YNP A;  2YB8 B;  2H9N A;  4U7A A;  5FQD A;  5KDO B;  4A08 B;  2H6Q A;  1OMW B;  1SHY B;  3PXT D;  3U4Y A;  4FA4 D;  4J8B A;  4PBY A;  1TBG A;  4A0B A;  3L4M D;  4FAN D;  5I5I A;  1SQ9 A;  5K19 A;  2PM9 A;  5C2W B;  1FWX A;  2HXC A;  3FGB A;  5A2Q g;  5TEF A;  1PEV A;  3EU7 A;  2XYI A;  4GMB A;  2Z2P A;  2J56 H;  4R7A B;  3I7K A;  1XKS A;  3KRW B;  2H9P A;  2CE9 A;  4CC9 A;  5GMK n;  4J79 A;  3AL8 A;  4JD2 C;  4FA1 D;  2XL3 A;  4JSN C;  2YNN A;  4JT6 C;  3E0C A;  4FWW A;  3F3F A;  2G9A A;  4Y7R A;  5EM2 A;  3PXW D;  4H5I A;  3SMR A;  5JWZ A;  4CI3 A;  4JXM A;  4JT5 C;  4OWR A;  2AGY A;  5TDH B;  4A0B B;  4PSW B;  3DSM A;  3EG6 A;  3EI2 A;  3RRM C;  1P22 A;  3I7H A;  4GGC A;  4ZOV A;  4UI9 R;  4E5Z A;  4ERY A;  5CXC A;  3UR4 A;  3IJ0 A;  4OZU A;  1YFQ A;  3OW8 A;  3AL9 A;  4L3H D;  4BUJ C;  3C9C A;  5C9Z B;  4O1Q D;  4ERZ A;  3N0D A;  3AL8 B;  1SQJ A;  1B9X A;  3HFQ A;  4A2L A;  3F3P A;  2HYE A;  3VGZ A;  4HDJ A;  3I89 A;  3JPX A;  4ZOX A;  5AFU 3;  5HYN B;  4CZV A;  3IKO A;  5GXI A;  5EM2 B;  2P9K C;  4O45 A;  2OJY A;  2P9U C;  3JZG A;  4J78 A;  3MZK A;  5I5J A;  3ODT A;  3DXM C;  2H9L A;  1MG3 A;  4BL0 A;  2G99 A;  3OL2 A;  3VH0 A;  2IWF A;  4O9D A;  2H6N A;  2H47 A;  3EI2 B;  4YVD A;  4CY1 A;  3AFC A;  5EMK B;  4J77 A;  1JOF A;  3SWS D;  3SCY A;  3BG1 A;  4E5Z B;  3F3G A;  5CXC B;  3SHF A;  3J80 g;  3UVK A;  3SVW D;  4FA9 D;  1B9Y A;  4PNK B;  4NSX A;  5FKQ A;  3RN0 D;  3A0F A;  3RSE C;  4L9O A;  3ZWL B;  3PE7 A;  4J8G A;  4LG8 A;  2AGX A;  3PXS D;  3SBR A;  2HKR A;  2I3S A;  2P9I C;  1MDA H;  4CI8 A;  3UVN A;  3EI3 A;  3OL2 B;  4A11 A;  4L3G D;  4XYH A;  2OIZ A;  2CN2 A;  5FKT A;  2P9N C;  3I7O A;  3BG0 A;  2HES X;  4XYI A;  4ZOY A;  3W15 A;  1K32 A;  5TF2 A;  5FKR A;  4ES0 A;  5TEE A;  5IT9 g;  2H13 A;  4JSX C;  4K3I D;  3UVO A;  1GG2 B;  3ORV D;  3FRX A;  4EWR A;  4CI2 A;  1S4U X;  3DM0 A;  3I7N A;  3NVX A;  3DXK C;  2IWK A;  3DWL C;  3V5W B;  5FXY A;  3I8E A;  1R5M A;  3I7P A;  1Q47 A;  2W18 A;  4IMM A;  3CFV A;  3L4O D;  4IA9 A;  3KRX B;  4PBZ A;  5B4W A;  3MZL A;  2IUQ A;  3IIY A;  5GSA A;  3PSC B;  3EI3 B;  3NVQ A;  3MKQ A;  2J55 H;  4A11 B;  4GGD A;  4BH6 A;  1L0Q A;  3EI1 A;  3MKS B;  5IGQ A;  3EWE A;  2Q7Q A;  4J0X A;  4CY2 A;  4G56 B;  3IIW A;  5THA A;  3N0E A;  4KFM B;  1GXR A;  4L1Q D;  2OVQ B;  3PVW B;  3RLM D;  3UVM A;  3K27 A;  3SN6 B;  2IUV A;  4MK0 B;  4D6V A;  2I0R A;  4TZ4 A;  4ZOZ A;  2UZY B;  5EML B;  2OVR B;  3UVL A;  3CFS B;  2IUP A;  2AH0 A;  3SJL D;  4CY3 A;  4U1E I;  4J86 A;  2H3X A;  1VYH C;  4QRJ A;  5AMS A;  2AGL A;  4O3T B;  4LG9 A;  5AJA A;  3OKT A;  3SBQ A;  2CNX A;  4GM9 A;  1TYQ C;  5EAL A;  3JRO A;  2H9M A;  3UKU C;  3AH8 B;  5IJ8 E;  5FA5 B;  3JAM g;  3EI1 B;  1U4C A;  4AEZ A;  5HE0 B;  4X63 B;  2EBS A;  2GC4 A;  1N6E A;  2P9S C;  4GM3 A;  4PXW A;  2PM6 B;  3SFZ A;  3RFH A;  1U2V C;  2CE8 A;  1JMX B;  2OK4 A;  4N14 A;  1RI6 A;  4QL1 A;  3I8C A;  3RMZ D;  3OTT A;  5I5M A;  3CIK B;  3FM0 A;  4CZY A;  2OVP B;  5H17 A;  2CN3 A;  5HQG A;  3GFC A;  2PM7 B;  2BBK H;  5GXH A;  2GNQ A;  4GM8 A;  4A09 A;  5EAR A;  2CO0 C;  1XIP A;  4PC0 A;  4GGA A;  3SBP A;  3JRP A;  2YMU A;  3P4F A;  5HE1 B;  4J84 A;  4CY5 A;  2HJB A;  3C75 H;  5CXB A;  1NR0 A;  3GRE A;  3EI4 A;  4FA5 D;  4D0K A;  4CZX A;  4X61 B;  2BCJ B;  4GQ2 P;  2B5L A;  4K3J B;  1N6D A;  3MMY A;  2H14 A;  5EMJ B;  4J81 A;  2OK6 A;  2TRC B;  3RFG A;  4Z8L A;  2AGZ A;  3IJ1 A;  3C99 A;  2HJ4 A;  4A2M A;  3I7L A;  1A0R B;  2P9L C;  2XL2 A;  1MG2 A;  2B4E A;  4ZN4 A;  5HE2 B;  4ESG A;  4A09 B;  4LGN A;  1QNI A;  3K26 A;  1PBY B;  4FAV D;  4JSV C;  5H14 A;  1GP2 B;  3MXX A; 
#chains in the Genus database with same CATH topology
 2QC5 A;  1NEX B;  5CYK A;  4J87 A;  4Z7N A;  3C5M A;  2VDN A;  3EQ7 A;  2H6K A;  1YR2 A;  5IGO A;  1TYE A;  3UKR C;  4PSX B;  4X60 B;  3SLE D;  3V7D B;  3JZN A;  5CXB B;  1N6F A;  4O3U B;  3EI4 B;  4Y5R D;  2VDO A;  3MUN A;  3OKW A;  4JSP C;  3NVN A;  2EID A;  4GQ1 A;  2MTA H;  2I0T A;  5FKS A;  1PI6 A;  2B5N A;  4E54 A;  2B5M A;  2PM9 B;  1XHM A;  5SXM A;  4A7J A;  2EIE A;  1I2M B;  4L1M A;  3J81 g;  5IJ7 E;  5EAM A;  2AH1 A;  4GQB B;  3BWS A;  3ULE C;  3GC3 B;  4WK4 A;  3JB9 L;  2HKM A;  2IUR A;  3EMH A;  1K8K C;  3PVU B;  4O2W A;  5CYK B;  2YNO A;  3I2N A;  4WK2 A;  4X3E A;  2AGW A;  2I3T A;  5H1M A;  5HE3 B;  3VA6 A;  3OKY A;  4AMY A;  5FLX g;  4A0A A;  1OLZ A;  2XU7 A;  2GC7 A;  2J57 G;  5EMM B;  2Z2N A;  4H5J A;  4A08 A;  3IJC A;  4GZ8 A;  4J0W A;  3MUO A;  1JJU B;  4QT8 A;  3JZH A;  4J82 A;  3VI3 A;  3SXT D;  2CO0 A;  5M5T A;  4QQE A;  2YBA A;  3PSL A;  3V9F A;  4E54 B;  2AQ5 A;  4FB1 D;  5M5R A;  5K1C C;  4BP9 A;  4FHL A;  2H68 A;  2QXV A;  2UZX B;  3B7F A;  3ZDZ A;  1PGU A;  2O9K A;  4I79 A;  3RN1 D;  4AOW A;  1UOP A;  4XEI C;  5IC7 A;  4RE6 A;  2I0S A;  2PBI B;  1VZ2 A;  2Z2O A;  1GOT B;  4UM8 A;  4CI1 A;  4ERQ A;  5C2V B;  2IAA A;  5EAP A;  1JMZ B;  3OKY B;  4A0A B;  2P9P C;  4J73 A;  1ERJ A;  2YNP A;  2YB8 B;  2H9N A;  2HU7 A;  4U7A A;  5FQD A;  5KDO B;  3K71 A;  4A08 B;  2H6Q A;  1OMW B;  3FCS A;  1SHY B;  3PXT D;  3T3M A;  3U4Y A;  4DNV A;  4FA4 D;  3QI0 A;  4J8B A;  4PBY A;  2EIC A;  5M5U A;  1TBG A;  1QFM A;  4A0B A;  3L4M D;  4QAM A;  5E6R A;  2XZG A;  1SQ9 A;  4FAN D;  5I5I A;  5K19 A;  2XDW A;  2PM9 A;  5C2W B;  1FWX A;  2HXC A;  3FGB A;  4WJK A;  1E8N A;  5A2Q g;  5TEF A;  1PEV A;  3EU7 A;  2XYI A;  4GMB A;  4AN1 A;  2Z2P A;  2J56 H;  4R7A B;  3I7K A;  1U8C A;  1XKS A;  3KRW B;  2VDK A;  1H2Y A;  2H9P A;  2CE9 A;  4JHP C;  4CC9 A;  5GMK n;  4J79 A;  3AL8 A;  4JD2 C;  3IUQ A;  3GD1 I;  4BP8 A;  4FA1 D;  2XL3 A;  4AN0 A;  4JSN C;  3OF7 A;  4MMY A;  2YNN A;  4JT6 C;  3E0C A;  4FWW A;  3F3F A;  2G9A A;  4Y7R A;  5EM2 A;  1GOF A;  3PXW D;  4H5I A;  3SMR A;  5JWZ A;  4O02 A;  4CI3 A;  2EIB A;  4JXM A;  4JT5 C;  4OWR A;  2AGY A;  5TDH B;  4A0B B;  3MVD K;  4PSW B;  3DSM A;  3EG6 A;  3EI2 A;  5FFO A;  3RRM C;  1P22 A;  3I7H A;  4GGC A;  4ZOV A;  4UI9 R;  4E5Z A;  4ERY A;  5CXC A;  3UR4 A;  1C9L A;  1M1X A;  3IJ0 A;  4OZU A;  1BPO A;  1YFQ A;  3OW8 A;  3ZE1 A;  3AL9 A;  2XE4 A;  3NIF A;  4L3H D;  4BUJ C;  2HU5 A;  3C9C A;  5C9Z B;  4O1Q D;  4ERZ A;  3N0D A;  3AL8 B;  1SQJ A;  1B9X A;  3HFQ A;  4A2L A;  3F3P A;  2HYE A;  3VGZ A;  1H2W A;  4HDJ A;  1JTD B;  5C86 A;  3I89 A;  3JPX A;  4JHN A;  4ZOX A;  5AFU 3;  5HYN B;  4CZV A;  5C92 A;  3IKO A;  5GXI A;  4Z7O A;  5EM2 B;  2P9K C;  5E6U A;  4O45 A;  2OJY A;  2P9U C;  3JZG A;  2BKL A;  4J78 A;  3MZK A;  4NC4 A;  5I5J A;  3O4G A;  3ODT A;  3DXM C;  2H9L A;  1MG3 A;  4BL0 A;  2G99 A;  2VDM A;  3OL2 A;  2WQ8 A;  3O4H A;  3VH0 A;  2IWF A;  4O9D A;  2H6N A;  2H47 A;  3EI2 B;  4YVD A;  4CY1 A;  3AFC A;  5EMK B;  3IUM A;  1JOF A;  4J77 A;  3SWS D;  3SCY A;  3BG1 A;  4E5Z B;  3F3G A;  1H2X A;  5CXC B;  4DNW A;  3SHF A;  3J80 g;  3UVK A;  3SVW D;  4FA9 D;  1B9Y A;  4PNK B;  4NSX A;  5FKQ A;  3RN0 D;  3A0F A;  3RSE C;  4WK0 A;  4L9O A;  1QFS A;  3ZWL B;  3PE7 A;  4J8G A;  4LG8 A;  2AGX A;  3PXS D;  1JV2 A;  3SBR A;  2HKR A;  2I3S A;  2P9I C;  1MDA H;  3ZE2 A;  4CI8 A;  3UVN A;  4AMZ A;  2JKX A;  4AX4 A;  1A12 A;  3EI3 A;  3OL2 B;  3ZDX A;  4A11 A;  4L3G D;  4XYH A;  1T2X A;  2OIZ A;  2CN2 A;  5FKT A;  3ZE0 A;  2P9N C;  3VI4 A;  3I7O A;  3BG0 A;  2HES X;  4XYI A;  4ZOY A;  3W15 A;  1K32 A;  5TF2 A;  5FKR A;  4MMZ A;  4ES0 A;  5TEE A;  1O6F A;  5IT9 g;  2H13 A;  4JSX C;  4K3I D;  3UVO A;  2QR5 A;  1GG2 B;  3EQ9 A;  2VZ3 A;  3ORV D;  3FRX A;  3O4J A;  4EWR A;  4CI2 A;  1S4U X;  3DDU A;  3DM0 A;  3I7N A;  3NVX A;  3DXK C;  2IWK A;  3DWL C;  3V5W B;  2VDL A;  5FXY A;  3I8E A;  1O6G A;  1R5M A;  3I7P A;  1UOO A;  1Q47 A;  2W18 A;  4IMM A;  3CFV A;  3L4O D;  4IA9 A;  3KRX B;  4PBZ A;  5B4W A;  3MZL A;  2IUQ A;  3IIY A;  3IUR A;  5GSA A;  3PSC B;  3EI3 B;  3NVQ A;  3MKQ A;  4BCB A;  2J55 H;  3K72 A;  4A11 B;  5M5S A;  4GGD A;  4BH6 A;  1L0Q A;  4MMX A;  4Z7Q A;  3EI1 A;  2VC2 A;  3MKS B;  5IGQ A;  3EWE A;  2Q7Q A;  4J0X A;  4CY2 A;  4G56 B;  3IUL A;  3IIW A;  5THA A;  3N0E A;  4KFM B;  1GXR A;  1VE7 A;  4L1Q D;  2OVQ B;  3PVW B;  3RLM D;  5M5V A;  3UVM A;  3K27 A;  3SN6 B;  1C9I A;  2IUV A;  4MK0 B;  4D6V A;  2I0R A;  4TZ4 A;  4ZOZ A;  2UZY B;  5EML B;  2OVR B;  3UVL A;  3CFS B;  3EQ8 A;  3IJE A;  2IUP A;  2AH0 A;  3SJL D;  2VDP A;  3V4P A;  4CY3 A;  4U1E I;  4J86 A;  2H3X A;  1VYH C;  4QRJ A;  5AMS A;  4IRZ A;  4BCC A;  3V4V A;  2AGL A;  4O3T B;  4LG9 A;  5AJA A;  3OKT A;  4RE5 A;  2CNX A;  3SBQ A;  1H2Z A;  3K6S A;  4GM9 A;  1TYQ C;  3FCU A;  5EAL A;  3JRO A;  2H9M A;  3UKU C;  3AH8 B;  5IJ8 E;  5FA5 B;  3IUJ A;  3JAM g;  3EI1 B;  1U4C A;  3KCI A;  4AEZ A;  5HE0 B;  4X63 B;  2EBS A;  4NBM A;  2GC4 A;  1N6E A;  1GOG A;  2P9S C;  4GM3 A;  4PXW A;  2PM6 B;  3SFZ A;  4G1M A;  4DNU A;  3RFH A;  1U2V C;  1VZ3 A;  2CE8 A;  3O4I A;  1JMX B;  2OK4 A;  4N14 A;  1RI6 A;  4QL1 A;  3I8C A;  3RMZ D;  3ZDY A;  4UM9 A;  3OTT A;  5I5M A;  3CIK B;  3FM0 A;  4CZY A;  2OVP B;  5H17 A;  2CN3 A;  4D9S A;  3IVM A;  4NAA A;  5HQG A;  3GFC A;  1E5T A;  5E6S A;  2PM7 B;  2BBK H;  5GXH A;  2GNQ A;  5FFG A;  2VZ1 A;  4GM8 A;  4A09 A;  5EAR A;  2VDQ A;  2CO0 C;  3NIG A;  1XIP A;  4PC0 A;  1E8M A;  1L5G A;  1VE6 A;  4GGA A;  3SBP A;  3JRP A;  2YMU A;  3P4F A;  5HE1 B;  4J84 A;  4BCD A;  4CY5 A;  2HJB A;  3C75 H;  5CXB A;  4NEN A;  1NR0 A;  3NID A;  4G55 A;  3GRE A;  3EI4 A;  4FA5 D;  4D0K A;  4CZX A;  4X61 B;  2BCJ B;  4GQ2 P;  3IUN A;  2QZP A;  2B5L A;  3MMY A;  1N6D A;  4K3J B;  2H14 A;  5EMJ B;  4J81 A;  2OK6 A;  1GOH A;  2TRC B;  1K3I A;  3RFG A;  4Z8L A;  3T3P A;  2AGZ A;  2VDR A;  3IJ1 A;  3C99 A;  1UTC A;  2HJ4 A;  4A2M A;  3QHY B;  3I7L A;  1A0R B;  2P9L C;  2XL2 A;  1MG2 A;  2B4E A;  4ZN4 A;  5HE2 B;  5M61 A;  4ESG A;  5HDB A;  4A09 B;  4LGN A;  1QNI A;  3K26 A;  2HU8 A;  1PBY B;  4FAV D;  4JSV C;  5H14 A;  1GP2 B;  3MXX A;  1UOQ A;  4G1E A; 
#chains in the Genus database with same CATH homology
 2QC5 A;  1NEX B;  5CYK A;  4J87 A;  3C5M A;  2H6K A;  5IGO A;  3UKR C;  4PSX B;  4X60 B;  3SLE D;  3V7D B;  3JZN A;  5CXB B;  1N6F A;  4O3U B;  3EI4 B;  4Y5R D;  3OKW A;  4JSP C;  3NVN A;  4GQ1 A;  2MTA H;  2I0T A;  5FKS A;  1PI6 A;  2B5N A;  4E54 A;  2B5M A;  2PM9 B;  1XHM A;  5SXM A;  4A7J A;  3J81 g;  5IJ7 E;  5EAM A;  2AH1 A;  4GQB B;  3BWS A;  3ULE C;  3JB9 L;  2HKM A;  2IUR A;  3EMH A;  1K8K C;  3PVU B;  5CYK B;  2YNO A;  3I2N A;  4X3E A;  2AGW A;  2I3T A;  5H1M A;  5HE3 B;  3VA6 A;  3OKY A;  5FLX g;  4A0A A;  1OLZ A;  2XU7 A;  2GC7 A;  2J57 G;  5EMM B;  2Z2N A;  4H5J A;  4A08 A;  3IJC A;  4GZ8 A;  4J0W A;  1JJU B;  4QT8 A;  3JZH A;  4J82 A;  3SXT D;  2CO0 A;  4QQE A;  2YBA A;  3PSL A;  3V9F A;  4E54 B;  2AQ5 A;  4FB1 D;  5K1C C;  4FHL A;  2H68 A;  2QXV A;  2UZX B;  3B7F A;  1PGU A;  2O9K A;  4I79 A;  3RN1 D;  4AOW A;  4XEI C;  5IC7 A;  2I0S A;  2PBI B;  2Z2O A;  1GOT B;  4CI1 A;  4ERQ A;  5C2V B;  2IAA A;  5EAP A;  1JMZ B;  3OKY B;  4A0A B;  2P9P C;  4J73 A;  1ERJ A;  2YNP A;  2YB8 B;  2H9N A;  4U7A A;  5FQD A;  5KDO B;  4A08 B;  2H6Q A;  1OMW B;  1SHY B;  3PXT D;  3U4Y A;  4FA4 D;  4J8B A;  4PBY A;  1TBG A;  4A0B A;  3L4M D;  4FAN D;  5I5I A;  1SQ9 A;  5K19 A;  2PM9 A;  5C2W B;  1FWX A;  2HXC A;  3FGB A;  5A2Q g;  5TEF A;  1PEV A;  3EU7 A;  2XYI A;  4GMB A;  2Z2P A;  2J56 H;  4R7A B;  3I7K A;  1XKS A;  3KRW B;  2H9P A;  2CE9 A;  4CC9 A;  5GMK n;  4J79 A;  3AL8 A;  4JD2 C;  4FA1 D;  2XL3 A;  4JSN C;  2YNN A;  4JT6 C;  3E0C A;  4FWW A;  3F3F A;  2G9A A;  4Y7R A;  5EM2 A;  3PXW D;  4H5I A;  3SMR A;  5JWZ A;  4CI3 A;  4JXM A;  4JT5 C;  4OWR A;  2AGY A;  5TDH B;  4A0B B;  4PSW B;  3DSM A;  3EG6 A;  3EI2 A;  3RRM C;  1P22 A;  3I7H A;  4GGC A;  4ZOV A;  4UI9 R;  4E5Z A;  4ERY A;  5CXC A;  3UR4 A;  3IJ0 A;  4OZU A;  1YFQ A;  3OW8 A;  3AL9 A;  4L3H D;  4BUJ C;  3C9C A;  5C9Z B;  4O1Q D;  4ERZ A;  3N0D A;  3AL8 B;  1SQJ A;  1B9X A;  3HFQ A;  4A2L A;  3F3P A;  2HYE A;  3VGZ A;  4HDJ A;  3I89 A;  3JPX A;  4ZOX A;  5AFU 3;  5HYN B;  4CZV A;  3IKO A;  5GXI A;  5EM2 B;  2P9K C;  4O45 A;  2OJY A;  2P9U C;  3JZG A;  4J78 A;  3MZK A;  5I5J A;  3ODT A;  3DXM C;  2H9L A;  1MG3 A;  4BL0 A;  2G99 A;  3OL2 A;  3VH0 A;  2IWF A;  4O9D A;  2H6N A;  2H47 A;  3EI2 B;  4YVD A;  4CY1 A;  3AFC A;  5EMK B;  4J77 A;  1JOF A;  3SWS D;  3SCY A;  3BG1 A;  4E5Z B;  3F3G A;  5CXC B;  3SHF A;  3J80 g;  3UVK A;  3SVW D;  4FA9 D;  1B9Y A;  4PNK B;  4NSX A;  5FKQ A;  3RN0 D;  3A0F A;  3RSE C;  4L9O A;  3ZWL B;  3PE7 A;  4J8G A;  4LG8 A;  2AGX A;  3PXS D;  3SBR A;  2HKR A;  2I3S A;  2P9I C;  1MDA H;  4CI8 A;  3UVN A;  3EI3 A;  3OL2 B;  4A11 A;  4L3G D;  4XYH A;  2OIZ A;  2CN2 A;  5FKT A;  2P9N C;  3I7O A;  3BG0 A;  2HES X;  4XYI A;  4ZOY A;  3W15 A;  1K32 A;  5TF2 A;  5FKR A;  4ES0 A;  5TEE A;  5IT9 g;  2H13 A;  4JSX C;  4K3I D;  3UVO A;  1GG2 B;  3ORV D;  3FRX A;  4EWR A;  4CI2 A;  1S4U X;  3DM0 A;  3I7N A;  3NVX A;  3DXK C;  2IWK A;  3DWL C;  3V5W B;  5FXY A;  3I8E A;  1R5M A;  3I7P A;  1Q47 A;  2W18 A;  4IMM A;  3CFV A;  3L4O D;  4IA9 A;  3KRX B;  4PBZ A;  5B4W A;  3MZL A;  2IUQ A;  3IIY A;  5GSA A;  3PSC B;  3EI3 B;  3NVQ A;  3MKQ A;  2J55 H;  4A11 B;  4GGD A;  4BH6 A;  1L0Q A;  3EI1 A;  3MKS B;  5IGQ A;  3EWE A;  2Q7Q A;  4J0X A;  4CY2 A;  4G56 B;  3IIW A;  5THA A;  3N0E A;  4KFM B;  1GXR A;  4L1Q D;  2OVQ B;  3PVW B;  3RLM D;  3UVM A;  3K27 A;  3SN6 B;  2IUV A;  4MK0 B;  4D6V A;  2I0R A;  4TZ4 A;  4ZOZ A;  2UZY B;  5EML B;  2OVR B;  3UVL A;  3CFS B;  2IUP A;  2AH0 A;  3SJL D;  4CY3 A;  4U1E I;  4J86 A;  2H3X A;  1VYH C;  4QRJ A;  5AMS A;  2AGL A;  4O3T B;  4LG9 A;  5AJA A;  3OKT A;  3SBQ A;  2CNX A;  4GM9 A;  1TYQ C;  5EAL A;  3JRO A;  2H9M A;  3UKU C;  3AH8 B;  5IJ8 E;  5FA5 B;  3JAM g;  3EI1 B;  1U4C A;  4AEZ A;  5HE0 B;  4X63 B;  2EBS A;  2GC4 A;  1N6E A;  2P9S C;  4GM3 A;  4PXW A;  2PM6 B;  3SFZ A;  3RFH A;  1U2V C;  2CE8 A;  1JMX B;  2OK4 A;  4N14 A;  1RI6 A;  4QL1 A;  3I8C A;  3RMZ D;  3OTT A;  5I5M A;  3CIK B;  3FM0 A;  4CZY A;  2OVP B;  5H17 A;  2CN3 A;  5HQG A;  3GFC A;  2PM7 B;  2BBK H;  5GXH A;  2GNQ A;  4GM8 A;  4A09 A;  5EAR A;  2CO0 C;  1XIP A;  4PC0 A;  4GGA A;  3SBP A;  3JRP A;  2YMU A;  3P4F A;  5HE1 B;  4J84 A;  4CY5 A;  2HJB A;  3C75 H;  5CXB A;  1NR0 A;  3GRE A;  3EI4 A;  4FA5 D;  4D0K A;  4CZX A;  4X61 B;  2BCJ B;  4GQ2 P;  2B5L A;  4K3J B;  1N6D A;  3MMY A;  2H14 A;  5EMJ B;  4J81 A;  2OK6 A;  2TRC B;  3RFG A;  4Z8L A;  2AGZ A;  3IJ1 A;  3C99 A;  2HJ4 A;  4A2M A;  3I7L A;  1A0R B;  2P9L C;  2XL2 A;  1MG2 A;  2B4E A;  4ZN4 A;  5HE2 B;  4ESG A;  4A09 B;  4LGN A;  1QNI A;  3K26 A;  1PBY B;  4FAV D;  4JSV C;  5H14 A;  1GP2 B;  3MXX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...