4QRJA

Crystal structure of a putative 6-phosphogluconolactonase (bacuni_04672) from bacteroides uniformis atcc 8492 at 2.20 a resolution
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
345
structure length
345
Chain Sequence
DQDELAMLIGTYTNGSSKGIYTFRFNQETGTAVPLSSAALPNPSYLVPSEDGEFVYAVSEMNDSTAALSSLAFDRETGELRLLNTVPTFGADPCYVATNGREVLTANYSGGTMSVFPLQKDGTLAPADTLFQGSATGPDAIRQATPHIHCTVFSPDGKYIFATDFSADRILRFVMHPDNPIPHASLEAVGIEADSGPRHLTFSPNGKFAYLITELSGKVIAFSYDDGCLEQIQTITADTVAARGSADIHLSPDGKYLYASNRLKEDGIAIFAVNPENGTLAKVGYQPTGIHPRNFNITPNGKYLLAACRDSNVIQVYKRNEVTGLLEDTHQDIVVDMPVCVQFVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a putative 6-phosphogluconolactonase (BACUNI_04672) from Bacteroides uniformis ATCC 8492 at 2.20 A resolution
rcsb
source organism Bacteroides uniformis atcc 8492
molecule tags Hydrolase
molecule keywords putative 6-phosphogluconolactonase
total genus 89
structure length 345
sequence length 345
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10282 Lactonase Lactonase, 7-bladed beta-propeller
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4qrjA00
4FA4D 4GGDA 2UZYB 2XL2A 3B7FA 3UVOA 4FA1D 4A0AA 2AGXA 4U7AA 3F3GA 3PVWB 3I7PA 2H47A 3AL9A 4TZ4A 5C9ZB 3EMHA 4L3GD 3OL2B 4GQBB 3DM0A 4QL1A 4G56B 3JPXA 4A2MA 4JD2C 2H3XA 5HE3B 3UVKA 4JSXC 5CYKB 4CZYA 4A2LA 2AGZA 3FM0A 4OZUA 3NVXA 3N0EA 2XYIA 2I0RA 2Z2OA 2J56H 2P9UC 4CY5A 3I7LA 3I8EA 3MXXA 4A11A 2GC7A 3KRXB 3RN0D 4PC0A 3PXTD 1N6FA 3ULEC 5GMKn 4GGAA 4FB1D 1R5MA 3L4OD 2IUQA 5TDHB 4R7AB 5CXBB 3F3FA 3BWSA 4KFMB 4J0WA 1MG3A 2EBSA 3W15A 2YMUA 2CN3A 2HJBA 3FRXA 5FKSA 4ZOXA 4A09B 5C2WB 3OKWA 1B9YA 3KRWB 1XHMA 4ZN4A 3RFHA 4JSNC 5IC7A 3N0DA 2H9PA 4ERQA 2P9IC 4MK0B 5KDOB 3CFVA 4PXWA 3I7KA 4J82A 3C9CA 4GGCA 4IMMA 1SQJA 3V7DB 1S4UX 4J86A 1XKSA 4FA9D 4Y7RA 4ZOVA 4CZXA 3F3PA 4J79A 5AJAA 2B5LA 5EARA 5IJ8E 3EI4A 2H6QA 4ESGA 4X61B 3NVNA 3IIYA 5H1MA 4PBYA 5EMLB 2QC5A 1VYHC 3P4FA 2J57G 5A2Qg 1B9XA 2PM7B 3SVWD 5CXCB 1P22A 4D6VA 4J78A 2H13A 2P9NC 3DSMA 4HDJA 4QRJA 2G9AA 3AL8B 4FAVD 3EWEA 2AQ5A 3DXMC 2QXVA 3AL8A 4LGNA 3MKSB 2OVRB 1K32A 3MMYA 3BG1A 2CO0A 2IWKA 2AGWA 2IWFA 4JT5C 2Z2PA 1NEXB 3V5WB 4CY1A 3C99A 5I5JA 3K27A 3SBQA 4X63B 3I7HA 3C5MA 2H9LA 3JB9L 1YFQA 5HQGA 3MKQA 1SQ9A 4XEIC 3SLED 2PM9B 2CNXA 5AMSA 4J73A 3EG6A 3PSCB 4A11B 3ODTA 2GC4A 1XIPA 4A0BA 2O9KA 5EALA 5FKQA 4J81A 1PBYB 4EWRA 1RI6A 3V9FA 4E54B 4J8BA 2H68A 1OLZA 4GZ8A 1OMWB 3UKRC 4D0KA 4JSVC 3ZWLB 1QNIA 3OTTA 5EMMB 1PEVA 4A09A 1FWXA 2P9SC 4GM8A 4J87A 2HKMA 2OJYA 2H14A 3IKOA 3SXTD 3C75H 5CXBA 3U4YA 2TRCB 1ERJA 2OVQB 3I7OA 2H9MA 1A0RB 4O3TB 4PSXB 3HFQA 4A7JA 2MTAH 5IT9g 1GG2B 4E54A 2I0SA 4QQEA 1N6EA 5CXCA 4A0BB 1MDAH 2P9KC 5FQDA 1JMZB 4JSPC 2PM9A 4H5JA 4ERZA 2J55H 3EI4B 4LG9A 5CYKA 4ES0A 4YVDA 4GM9A 5K1CC 3JZHA 4U1EI 1GP2B 2P9PC 3VH0A 2IAAA 3RSEC 3SBPA 3PXSD 3BG0A 1K8KC 5TEEA 4PNKB 2W18A 4FA5D 3I7NA 3GREA 4O45A 4NSXA 3RN1D 3SWSD 3PE7A 4BUJC 1L0QA 3SHFA 2YNOA 4AEZA 2Z2NA 3ORVD 2HXCA 5FA5B 2Q7QA 1JJUB 4J77A 5HE0B 4CY3A 1PGUA 2AGYA 2CO0C 2IUVA 4O3UB 4JT6C 3EI2B 2BCJB 5H17A 1TBGA 2XU7A 4PBZA 3EI1B 5HE1B 5I5MA 2PBIB 5FLXg 4XYIA 1U2VC 4Y5RD 3J81g 4K3JB 3I8CA 4BH6A 3DWLC 2XL3A 4J8GA 3UVMA 5FKTA 4J0XA 4E5ZA 5FXYA 3RLMD 4CZVA 1NR0A 4K3ID 3SJLD 4CI3A 4FAND 2HJ4A 3SMRA 3IJ0A 2AH1A 5I5IA 2OVPB 3CFSB 3UKUC 3I2NA 3EU7A 5IJ7E 3IJ1A 3IJCA 2CN2A 3OKYB 5EM2A 3AH8B 2HESX 4X3EA 2B4EA 4Z8LA 3GFCA 4A08A 4AOWA 3UVNA 2BBKH 4O1QD 3EI3A 1GOTB 3OW8A 4I79A 1Q47A 5C2VB 4GQ1A 4UI9R 3A0FA 3I89A 1SHYB 4CI2A 3VGZA 3E0CA 2H6NA 3JZGA 1JOFA 5HYNB 2IURA 4XYHA 4L9OA 3OL2A 5EMJB 5H14A 5TF2A 4OWRA 4CC9A 4ZOYA 5JWZA 4CI1A 4PSWB 4ZOZA 3SBRA 1U4CA 3NVQA 1JMXB 3VA6A 3OKTA 3L4MD 2B5NA 3PXWD 5SXMA 4L3HD 4QT8A 4A0AB 2IUPA 4IA9A 4X60B 5THAA 5EAMA 4E5ZB 1MG2A 2YNNA 3EI3B 3K26A 3AFCA 3JZNA 5TEFA 4A08B 2CE9A 5FKRA 2GNQA 2YBAA 2OK4A 3SFZA 2OIZA 3JRPA 4N14A 3OKYA 5EM2B 1GXRA 3JAMg 2YNPA 5AFU3 3IIWA 2I3TA 2OK6A 3SN6B 3EI1A 5K19A 3RFGA 2AH0A 4J84A 2YB8B 5B4WA 3J80g 1TYQC 1PI6A 2AGLA 2I0TA 2HKRA 3RRMC 3CIKB 4GM3A 1N6DA 2B5MA 3SCYA 4ERYA 3FGBA 3UR4A 4H5IA 5GXHA 5IGQA 3PSLA 2H6KA 2I3SA 3MZLA 4FWWA 3MZKA 5GXIA 4JXMA 2H9NA 3UVLA 2HYEA 4GQ2P 4BL0A 4O9DA 4CI8A 5HE2B 2UZXB 5EAPA 3DXKC 3JROA 3PVUB 2PM6B 2G99A 5GSAA 2P9LC 2CE8A 4LG8A 4L1QD 3EI2A 5EMKB 3RMZD 4CY2A 4GMBA 4FHLA 5IGOA
chains in the Genus database with same CATH superfamily
4FA4D 4GGDA 2UZYB 2XL2A 4AMZA 3B7FA 3UVOA 1TYEA 1U8CA 4FA1D 3IVMA 4A0AA 2AGXA 4U7AA 4G55A 3F3GA 3PVWB 3I7PA 1H2ZA 3IJEA 2H47A 3AL9A 4TZ4A 5C9ZB 2VDQA 3EMHA 3NIFA 4L3GD 3OL2B 4GQBB 3IURA 1O6FA 3DM0A 4QL1A 4G56B 3JPXA 4A2MA 2VZ1A 4RE5A 1E5TA 4JD2C 2H3XA 5HE3B 3UVKA 4JSXC 5M5VA 5CYKB 4CZYA 4A2LA 2AGZA 3FM0A 4OZUA 4AX4A 3NVXA 5M5RA 3N0EA 4QAMA 2XYIA 2I0RA 2Z2OA 2J56H 2P9UC 4CY5A 3I7LA 5HDBA 2QR5A 3I8EA 3MXXA 4A11A 2GC7A 3KRXB 3RN0D 4PC0A 3PXTD 1N6FA 3ULEC 5GMKn 4GGAA 4FB1D 1UOQA 1R5MA 3L4OD 2IUQA 5TDHB 4R7AB 3F3FA 5CXBB 3BWSA 4KFMB 4J0WA 4AN0A 1MG3A 2EBSA 3W15A 5C86A 2YMUA 2CN3A 2HJBA 3FRXA 3O4HA 3O4GA 2EIDA 5FKSA 3MUOA 4ZOXA 4A09B 5C2WB 3OKWA 1B9YA 3K6SA 3KRWB 1UOPA 3K71A 1XHMA 4ZN4A 3RFHA 4JSNC 4WK0A 5IC7A 4Z7OA 3N0DA 2H9PA 4ERQA 2P9IC 4MK0B 5KDOB 3CFVA 4PXWA 2WQ8A 3I7KA 4RE6A 4J82A 3C9CA 4GGCA 4IMMA 1SQJA 3V7DB 1S4UX 4J86A 1XKSA 4FA9D 4Y7RA 4ZOVA 4CZXA 3F3PA 4DNWA 4J79A 5AJAA 4AN1A 2B5LA 5EARA 5IJ8E 4UM9A 3EI4A 2H6QA 2HU7A 4ESGA 4X61B 3NVNA 3IIYA 5H1MA 3ZDYA 4PBYA 5EMLB 2QC5A 1VYHC 3P4FA 2J57G 5A2Qg 1B9XA 2PM7B 3SVWD 5CXCB 1P22A 4D6VA 4J78A 3EQ9A 2H13A 2P9NC 3DSMA 4HDJA 2VDKA 4QRJA 2G9AA 3AL8B 3OF7A 4FAVD 4Z7QA 3EWEA 2AQ5A 3DXMC 2QXVA 3AL8A 1UOOA 4LGNA 1L5GA 3MKSB 2OVRB 1K32A 3MMYA 3BG1A 3K72A 2CO0A 3QHYB 2IWKA 3MVDK 2AGWA 2IWFA 4JT5C 2Z2PA 1NEXB 3V5WB 3ZE1A 4CY1A 3C99A 2HU5A 5I5JA 3K27A 3SBQA 4X63B 3I7HA 3C5MA 2H9LA 3JB9L 1YFQA 2VDRA 5HQGA 3MKQA 4NENA 1T2XA 1SQ9A 4XEIC 4NC4A 3SLED 2PM9B 2CNXA 5AMSA 4J73A 3EG6A 3PSCB 4A11B 3ODTA 5M5TA 2GC4A 1XIPA 4A0BA 2O9KA 5EALA 5FKQA 4J81A 4L1MA 1PBYB 4EWRA 1RI6A 3V9FA 4E54B 3T3MA 2EIEA 4J8BA 3V4VA 2H68A 1OLZA 4GZ8A 1OMWB 3UKRC 4D0KA 1H2XA 3FCUA 4JSVC 3ZWLB 1QNIA 3OTTA 5EMMB 1PEVA 4A09A 1FWXA 2P9SC 4GM8A 4J87A 2HKMA 2OJYA 2VC2A 2H14A 3IKOA 3SXTD 3C75H 5CXBA 3U4YA 2TRCB 1ERJA 2OVQB 3I7OA 2H9MA 1A0RB 4O3TB 4BCDA 4PSXB 3HFQA 4A7JA 2MTAH 2XE4A 5IT9g 1GG2B 4IRZA 3KCIA 4E54A 2I0SA 2QZPA 3O4JA 4QQEA 1N6EA 5CXCA 4A0BB 1MDAH 2P9KC 5FQDA 1JMZB 4JSPC 3T3PA 2PM9A 3V4PA 4H5JA 1M1XA 2BKLA 4ERZA 1C9LA 2J55H 3EI4B 4NAAA 1VZ2A 3EQ8A 4LG9A 4BCBA 5FFOA 4D9SA 5CYKA 2XZGA 4O02A 4ES0A 4YVDA 4GM9A 1GOFA 5K1CC 3JZHA 4U1EI 1GP2B 2P9PC 4G1EA 3NIDA 3VH0A 2IAAA 3ZDXA 3RSEC 3SBPA 3PXSD 3BG0A 1JV2A 1K8KC 5TEEA 4PNKB 2W18A 4FA5D 3I7NA 3GREA 4O45A 2VDNA 4NSXA 3RN1D 3SWSD 3PE7A 4BUJC 1L0QA 3SHFA 2YNOA 4AEZA 2Z2NA 3ORVD 4JHPC 5C92A 5E6RA 1A12A 2HXCA 5FA5B 2Q7QA 2VDPA 1JJUB 4J77A 5HE0B 2VDOA 4CY3A 3EQ7A 1PGUA 2AGYA 4DNVA 2CO0C 2IUVA 4O3UB 3ZDZA 4JT6C 3EI2B 2BCJB 5H17A 5M5SA 1TBGA 2XU7A 4PBZA 1E8NA 3EI1B 5M5UA 5HE1B 5I5MA 2PBIB 5E6SA 4Z7NA 5FLXg 4XYIA 3DDUA 1U2VC 4Y5RD 3J81g 4K3JB 3I8CA 4BH6A 4O2WA 1VZ3A 3DWLC 2XL3A 4J8GA 3UVMA 5FKTA 4J0XA 1GOGA 3ZE0A 4E5ZA 5FXYA 3RLMD 4CZVA 5E6UA 1NR0A 4K3ID 3SJLD 4CI3A 4FAND 2HJ4A 3SMRA 3IJ0A 2AH1A 5I5IA 2OVPB 3CFSB 3UKUC 3I2NA 3EU7A 5IJ7E 3GD1I 3IJ1A 3IJCA 3MUNA 2CN2A 3OKYB 5EM2A 1E8MA 3AH8B 3VI4A 2HESX 4WK2A 4X3EA 2B4EA 4Z8LA 3GFCA 4A08A 4AOWA 3UVNA 4BP8A 2BBKH 4NBMA 3IUMA 4O1QD 3EI3A 1GOTB 3OW8A 4I79A 1Q47A 3FCSA 5FFGA 5C2VB 4GQ1A 4UI9R 4DNUA 3A0FA 3I89A 1SHYB 4CI2A 3VGZA 3E0CA 2H6NA 1GOHA 3GC3B 2HU8A 1JOFA 3JZGA 1UTCA 5HYNB 2IURA 1QFSA 4XYHA 4L9OA 3OL2A 5EMJB 5H14A 5TF2A 4OWRA 4CC9A 3VI3A 4ZOYA 5JWZA 3IULA 4CI1A 4PSWB 4ZOZA 3SBRA 2EICA 1U4CA 3NVQA 1JMXB 3VA6A 3OKTA 3L4MD 1BPOA 2B5NA 3PXWD 4UM8A 3IUNA 4MMZA 5SXMA 4L3HD 1K3IA 4QT8A 4A0AB 2IUPA 4IA9A 4X60B 3ZE2A 5THAA 4BCCA 5EAMA 4E5ZB 1MG2A 4MMXA 1VE6A 2YNNA 3EI3B 3K26A 3AFCA 1JTDB 1C9IA 1H2YA 3JZNA 5TEFA 4A08B 2CE9A 5FKRA 4WK4A 2JKXA 4G1MA 2GNQA 2YBAA 2OK4A 3SFZA 2OIZA 3JRPA 4N14A 3OKYA 5EM2B 1GXRA 3JAMg 4WJKA 2YNPA 5AFU3 3IIWA 2I3TA 2OK6A 3QI0A 4MMYA 3SN6B 3EI1A 5K19A 3RFGA 2EIBA 4BP9A 1I2MB 1YR2A 2AH0A 4J84A 2YB8B 5B4WA 3J80g 1TYQC 2XDWA 1PI6A 2VZ3A 2AGLA 2I0TA 2HKRA 3RRMC 1VE7A 3CIKB 4GM3A 5M61A 1O6GA 1N6DA 2B5MA 3SCYA 4ERYA 2VDMA 3FGBA 3UR4A 4H5IA 5GXHA 5IGQA 3PSLA 2H6KA 2I3SA 3MZLA 3O4IA 4FWWA 3MZKA 5GXIA 3IUQA 4JXMA 2H9NA 3UVLA 3NIGA 2HYEA 4GQ2P 1H2WA 4BL0A 1QFMA 4O9DA 4CI8A 5HE2B 2UZXB 5EAPA 3DXKC 3JROA 3PVUB 2VDLA 2PM6B 2G99A 5GSAA 2P9LC 4AMYA 4JHNA 2CE8A 4LG8A 4L1QD 3EI2A 5EMKB 3RMZD 4CY2A 3IUJA 4FHLA 4GMBA 5IGOA
chains in the Genus database with same CATH topology
4FA4D 4GGDA 2UZYB 2XL2A 3B7FA 3UVOA 4FA1D 4A0AA 2AGXA 4U7AA 3F3GA 3PVWB 3I7PA 2H47A 3AL9A 4TZ4A 5C9ZB 3EMHA 4L3GD 3OL2B 4GQBB 3DM0A 4QL1A 4G56B 3JPXA 4A2MA 4JD2C 2H3XA 5HE3B 3UVKA 4JSXC 5CYKB 4CZYA 4A2LA 2AGZA 3FM0A 4OZUA 3NVXA 3N0EA 2XYIA 2I0RA 2Z2OA 2J56H 2P9UC 4CY5A 3I7LA 3I8EA 3MXXA 4A11A 2GC7A 3KRXB 3RN0D 4PC0A 3PXTD 1N6FA 3ULEC 5GMKn 4GGAA 4FB1D 1R5MA 3L4OD 2IUQA 5TDHB 4R7AB 5CXBB 3F3FA 3BWSA 4KFMB 4J0WA 1MG3A 2EBSA 3W15A 2YMUA 2CN3A 2HJBA 3FRXA 5FKSA 4ZOXA 4A09B 5C2WB 3OKWA 1B9YA 3KRWB 1XHMA 4ZN4A 3RFHA 4JSNC 5IC7A 3N0DA 2H9PA 4ERQA 2P9IC 4MK0B 5KDOB 3CFVA 4PXWA 3I7KA 4J82A 3C9CA 4GGCA 4IMMA 1SQJA 3V7DB 1S4UX 4J86A 1XKSA 4FA9D 4Y7RA 4ZOVA 4CZXA 3F3PA 4J79A 5AJAA 2B5LA 5EARA 5IJ8E 3EI4A 2H6QA 4ESGA 4X61B 3NVNA 3IIYA 5H1MA 4PBYA 5EMLB 2QC5A 1VYHC 3P4FA 2J57G 5A2Qg 1B9XA 2PM7B 3SVWD 5CXCB 1P22A 4D6VA 4J78A 2H13A 2P9NC 3DSMA 4HDJA 4QRJA 2G9AA 3AL8B 4FAVD 3EWEA 2AQ5A 3DXMC 2QXVA 3AL8A 4LGNA 3MKSB 2OVRB 1K32A 3MMYA 3BG1A 2CO0A 2IWKA 2AGWA 2IWFA 4JT5C 2Z2PA 1NEXB 3V5WB 4CY1A 3C99A 5I5JA 3K27A 3SBQA 4X63B 3I7HA 3C5MA 2H9LA 3JB9L 1YFQA 5HQGA 3MKQA 1SQ9A 4XEIC 3SLED 2PM9B 2CNXA 5AMSA 4J73A 3EG6A 3PSCB 4A11B 3ODTA 2GC4A 1XIPA 4A0BA 2O9KA 5EALA 5FKQA 4J81A 1PBYB 4EWRA 1RI6A 3V9FA 4E54B 4J8BA 2H68A 1OLZA 4GZ8A 1OMWB 3UKRC 4D0KA 4JSVC 3ZWLB 1QNIA 3OTTA 5EMMB 1PEVA 4A09A 1FWXA 2P9SC 4GM8A 4J87A 2HKMA 2OJYA 2H14A 3IKOA 3SXTD 3C75H 5CXBA 3U4YA 2TRCB 1ERJA 2OVQB 3I7OA 2H9MA 1A0RB 4O3TB 4PSXB 3HFQA 4A7JA 2MTAH 5IT9g 1GG2B 4E54A 2I0SA 4QQEA 1N6EA 5CXCA 4A0BB 1MDAH 2P9KC 5FQDA 1JMZB 4JSPC 2PM9A 4H5JA 4ERZA 2J55H 3EI4B 4LG9A 5CYKA 4ES0A 4YVDA 4GM9A 5K1CC 3JZHA 4U1EI 1GP2B 2P9PC 3VH0A 2IAAA 3RSEC 3SBPA 3PXSD 3BG0A 1K8KC 5TEEA 4PNKB 2W18A 4FA5D 3I7NA 3GREA 4O45A 4NSXA 3RN1D 3SWSD 3PE7A 4BUJC 1L0QA 3SHFA 2YNOA 4AEZA 2Z2NA 3ORVD 2HXCA 5FA5B 2Q7QA 1JJUB 4J77A 5HE0B 4CY3A 1PGUA 2AGYA 2CO0C 2IUVA 4O3UB 4JT6C 3EI2B 2BCJB 5H17A 1TBGA 2XU7A 4PBZA 3EI1B 5HE1B 5I5MA 2PBIB 5FLXg 4XYIA 1U2VC 4Y5RD 3J81g 4K3JB 3I8CA 4BH6A 3DWLC 2XL3A 4J8GA 3UVMA 5FKTA 4J0XA 4E5ZA 5FXYA 3RLMD 4CZVA 1NR0A 4K3ID 3SJLD 4CI3A 4FAND 2HJ4A 3SMRA 3IJ0A 2AH1A 5I5IA 2OVPB 3CFSB 3UKUC 3I2NA 3EU7A 5IJ7E 3IJ1A 3IJCA 2CN2A 3OKYB 5EM2A 3AH8B 2HESX 4X3EA 2B4EA 4Z8LA 3GFCA 4A08A 4AOWA 3UVNA 2BBKH 4O1QD 3EI3A 1GOTB 3OW8A 4I79A 1Q47A 5C2VB 4GQ1A 4UI9R 3A0FA 3I89A 1SHYB 4CI2A 3VGZA 3E0CA 2H6NA 3JZGA 1JOFA 5HYNB 2IURA 4XYHA 4L9OA 3OL2A 5EMJB 5H14A 5TF2A 4OWRA 4CC9A 4ZOYA 5JWZA 4CI1A 4PSWB 4ZOZA 3SBRA 1U4CA 3NVQA 1JMXB 3VA6A 3OKTA 3L4MD 2B5NA 3PXWD 5SXMA 4L3HD 4QT8A 4A0AB 2IUPA 4IA9A 4X60B 5THAA 5EAMA 4E5ZB 1MG2A 2YNNA 3EI3B 3K26A 3AFCA 3JZNA 5TEFA 4A08B 2CE9A 5FKRA 2GNQA 2YBAA 2OK4A 3SFZA 2OIZA 3JRPA 4N14A 3OKYA 5EM2B 1GXRA 3JAMg 2YNPA 5AFU3 3IIWA 2I3TA 2OK6A 3SN6B 3EI1A 5K19A 3RFGA 2AH0A 4J84A 2YB8B 5B4WA 3J80g 1TYQC 1PI6A 2AGLA 2I0TA 2HKRA 3RRMC 3CIKB 4GM3A 1N6DA 2B5MA 3SCYA 4ERYA 3FGBA 3UR4A 4H5IA 5GXHA 5IGQA 3PSLA 2H6KA 2I3SA 3MZLA 4FWWA 3MZKA 5GXIA 4JXMA 2H9NA 3UVLA 2HYEA 4GQ2P 4BL0A 4O9DA 4CI8A 5HE2B 2UZXB 5EAPA 3DXKC 3JROA 3PVUB 2PM6B 2G99A 5GSAA 2P9LC 2CE8A 4LG8A 4L1QD 3EI2A 5EMKB 3RMZD 4CY2A 4GMBA 4FHLA 5IGOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FA4 D;  4GGD A;  2UZY B;  2XL2 A;  3B7F A;  3UVO A;  4FA1 D;  4A0A A;  2AGX A;  4U7A A;  3F3G A;  3PVW B;  3I7P A;  2H47 A;  3AL9 A;  4TZ4 A;  5C9Z B;  3EMH A;  4L3G D;  3OL2 B;  4GQB B;  3DM0 A;  4QL1 A;  4G56 B;  3JPX A;  4A2M A;  4JD2 C;  2H3X A;  5HE3 B;  3UVK A;  4JSX C;  5CYK B;  4CZY A;  4A2L A;  2AGZ A;  3FM0 A;  4OZU A;  3NVX A;  3N0E A;  2XYI A;  2I0R A;  2Z2O A;  2J56 H;  2P9U C;  4CY5 A;  3I7L A;  3I8E A;  3MXX A;  4A11 A;  2GC7 A;  3KRX B;  3RN0 D;  4PC0 A;  3PXT D;  1N6F A;  3ULE C;  5GMK n;  4GGA A;  4FB1 D;  1R5M A;  3L4O D;  2IUQ A;  5TDH B;  4R7A B;  5CXB B;  3F3F A;  3BWS A;  4KFM B;  4J0W A;  1MG3 A;  2EBS A;  3W15 A;  2YMU A;  2CN3 A;  2HJB A;  3FRX A;  5FKS A;  4ZOX A;  4A09 B;  5C2W B;  3OKW A;  1B9Y A;  3KRW B;  1XHM A;  4ZN4 A;  3RFH A;  4JSN C;  5IC7 A;  3N0D A;  2H9P A;  4ERQ A;  2P9I C;  4MK0 B;  5KDO B;  3CFV A;  4PXW A;  3I7K A;  4J82 A;  3C9C A;  4GGC A;  4IMM A;  1SQJ A;  3V7D B;  1S4U X;  4J86 A;  1XKS A;  4FA9 D;  4Y7R A;  4ZOV A;  4CZX A;  3F3P A;  4J79 A;  5AJA A;  2B5L A;  5EAR A;  5IJ8 E;  3EI4 A;  2H6Q A;  4ESG A;  4X61 B;  3NVN A;  3IIY A;  5H1M A;  4PBY A;  5EML B;  2QC5 A;  1VYH C;  3P4F A;  2J57 G;  5A2Q g;  1B9X A;  2PM7 B;  3SVW D;  5CXC B;  1P22 A;  4D6V A;  4J78 A;  2H13 A;  2P9N C;  3DSM A;  4HDJ A;  4QRJ A;  2G9A A;  3AL8 B;  4FAV D;  3EWE A;  2AQ5 A;  3DXM C;  2QXV A;  3AL8 A;  4LGN A;  3MKS B;  2OVR B;  1K32 A;  3MMY A;  3BG1 A;  2CO0 A;  2IWK A;  2AGW A;  2IWF A;  4JT5 C;  2Z2P A;  1NEX B;  3V5W B;  4CY1 A;  3C99 A;  5I5J A;  3K27 A;  3SBQ A;  4X63 B;  3I7H A;  3C5M A;  2H9L A;  3JB9 L;  1YFQ A;  5HQG A;  3MKQ A;  1SQ9 A;  4XEI C;  3SLE D;  2PM9 B;  2CNX A;  5AMS A;  4J73 A;  3EG6 A;  3PSC B;  4A11 B;  3ODT A;  2GC4 A;  1XIP A;  4A0B A;  2O9K A;  5EAL A;  5FKQ A;  4J81 A;  1PBY B;  4EWR A;  1RI6 A;  3V9F A;  4E54 B;  4J8B A;  2H68 A;  1OLZ A;  4GZ8 A;  1OMW B;  3UKR C;  4D0K A;  4JSV C;  3ZWL B;  1QNI A;  3OTT A;  5EMM B;  1PEV A;  4A09 A;  1FWX A;  2P9S C;  4GM8 A;  4J87 A;  2HKM A;  2OJY A;  2H14 A;  3IKO A;  3SXT D;  3C75 H;  5CXB A;  3U4Y A;  2TRC B;  1ERJ A;  2OVQ B;  3I7O A;  2H9M A;  1A0R B;  4O3T B;  4PSX B;  3HFQ A;  4A7J A;  2MTA H;  5IT9 g;  1GG2 B;  4E54 A;  2I0S A;  4QQE A;  1N6E A;  5CXC A;  4A0B B;  1MDA H;  2P9K C;  5FQD A;  1JMZ B;  4JSP C;  2PM9 A;  4H5J A;  4ERZ A;  2J55 H;  3EI4 B;  4LG9 A;  5CYK A;  4ES0 A;  4YVD A;  4GM9 A;  5K1C C;  3JZH A;  4U1E I;  1GP2 B;  2P9P C;  3VH0 A;  2IAA A;  3RSE C;  3SBP A;  3PXS D;  3BG0 A;  1K8K C;  5TEE A;  4PNK B;  2W18 A;  4FA5 D;  3I7N A;  3GRE A;  4O45 A;  4NSX A;  3RN1 D;  3SWS D;  3PE7 A;  4BUJ C;  1L0Q A;  3SHF A;  2YNO A;  4AEZ A;  2Z2N A;  3ORV D;  2HXC A;  5FA5 B;  2Q7Q A;  1JJU B;  4J77 A;  5HE0 B;  4CY3 A;  1PGU A;  2AGY A;  2CO0 C;  2IUV A;  4O3U B;  4JT6 C;  3EI2 B;  2BCJ B;  5H17 A;  1TBG A;  2XU7 A;  4PBZ A;  3EI1 B;  5HE1 B;  5I5M A;  2PBI B;  5FLX g;  4XYI A;  1U2V C;  4Y5R D;  3J81 g;  4K3J B;  3I8C A;  4BH6 A;  3DWL C;  2XL3 A;  4J8G A;  3UVM A;  5FKT A;  4J0X A;  4E5Z A;  5FXY A;  3RLM D;  4CZV A;  1NR0 A;  4K3I D;  3SJL D;  4CI3 A;  4FAN D;  2HJ4 A;  3SMR A;  3IJ0 A;  2AH1 A;  5I5I A;  2OVP B;  3CFS B;  3UKU C;  3I2N A;  3EU7 A;  5IJ7 E;  3IJ1 A;  3IJC A;  2CN2 A;  3OKY B;  5EM2 A;  3AH8 B;  2HES X;  4X3E A;  2B4E A;  4Z8L A;  3GFC A;  4A08 A;  4AOW A;  3UVN A;  2BBK H;  4O1Q D;  3EI3 A;  1GOT B;  3OW8 A;  4I79 A;  1Q47 A;  5C2V B;  4GQ1 A;  4UI9 R;  3A0F A;  3I89 A;  1SHY B;  4CI2 A;  3VGZ A;  3E0C A;  2H6N A;  3JZG A;  1JOF A;  5HYN B;  2IUR A;  4XYH A;  4L9O A;  3OL2 A;  5EMJ B;  5H14 A;  5TF2 A;  4OWR A;  4CC9 A;  4ZOY A;  5JWZ A;  4CI1 A;  4PSW B;  4ZOZ A;  3SBR A;  1U4C A;  3NVQ A;  1JMX B;  3VA6 A;  3OKT A;  3L4M D;  2B5N A;  3PXW D;  5SXM A;  4L3H D;  4QT8 A;  4A0A B;  2IUP A;  4IA9 A;  4X60 B;  5THA A;  5EAM A;  4E5Z B;  1MG2 A;  2YNN A;  3EI3 B;  3K26 A;  3AFC A;  3JZN A;  5TEF A;  4A08 B;  2CE9 A;  5FKR A;  2GNQ A;  2YBA A;  2OK4 A;  3SFZ A;  2OIZ A;  3JRP A;  4N14 A;  3OKY A;  5EM2 B;  1GXR A;  3JAM g;  2YNP A;  5AFU 3;  3IIW A;  2I3T A;  2OK6 A;  3SN6 B;  3EI1 A;  5K19 A;  3RFG A;  2AH0 A;  4J84 A;  2YB8 B;  5B4W A;  3J80 g;  1TYQ C;  1PI6 A;  2AGL A;  2I0T A;  2HKR A;  3RRM C;  3CIK B;  4GM3 A;  1N6D A;  2B5M A;  3SCY A;  4ERY A;  3FGB A;  3UR4 A;  4H5I A;  5GXH A;  5IGQ A;  3PSL A;  2H6K A;  2I3S A;  3MZL A;  4FWW A;  3MZK A;  5GXI A;  4JXM A;  2H9N A;  3UVL A;  2HYE A;  4GQ2 P;  4BL0 A;  4O9D A;  4CI8 A;  5HE2 B;  2UZX B;  5EAP A;  3DXK C;  3JRO A;  3PVU B;  2PM6 B;  2G99 A;  5GSA A;  2P9L C;  2CE8 A;  4LG8 A;  4L1Q D;  3EI2 A;  5EMK B;  3RMZ D;  4CY2 A;  4GMB A;  4FHL A;  5IGO A; 
#chains in the Genus database with same CATH topology
 4FA4 D;  4GGD A;  2UZY B;  2XL2 A;  4AMZ A;  3B7F A;  3UVO A;  1TYE A;  1U8C A;  4FA1 D;  3IVM A;  4A0A A;  2AGX A;  4U7A A;  4G55 A;  3F3G A;  3PVW B;  3I7P A;  1H2Z A;  3IJE A;  2H47 A;  3AL9 A;  4TZ4 A;  5C9Z B;  2VDQ A;  3EMH A;  3NIF A;  4L3G D;  3OL2 B;  4GQB B;  3IUR A;  1O6F A;  3DM0 A;  4QL1 A;  4G56 B;  3JPX A;  4A2M A;  2VZ1 A;  4RE5 A;  1E5T A;  4JD2 C;  2H3X A;  5HE3 B;  3UVK A;  4JSX C;  5M5V A;  5CYK B;  4CZY A;  4A2L A;  2AGZ A;  3FM0 A;  4OZU A;  4AX4 A;  3NVX A;  5M5R A;  3N0E A;  4QAM A;  2XYI A;  2I0R A;  2Z2O A;  2J56 H;  2P9U C;  4CY5 A;  3I7L A;  5HDB A;  2QR5 A;  3I8E A;  3MXX A;  4A11 A;  2GC7 A;  3KRX B;  3RN0 D;  4PC0 A;  3PXT D;  1N6F A;  3ULE C;  5GMK n;  4GGA A;  4FB1 D;  1UOQ A;  1R5M A;  3L4O D;  2IUQ A;  5TDH B;  4R7A B;  3F3F A;  5CXB B;  3BWS A;  4KFM B;  4J0W A;  4AN0 A;  1MG3 A;  2EBS A;  3W15 A;  5C86 A;  2YMU A;  2CN3 A;  2HJB A;  3FRX A;  3O4H A;  3O4G A;  2EID A;  5FKS A;  3MUO A;  4ZOX A;  4A09 B;  5C2W B;  3OKW A;  1B9Y A;  3K6S A;  3KRW B;  1UOP A;  3K71 A;  1XHM A;  4ZN4 A;  3RFH A;  4JSN C;  4WK0 A;  5IC7 A;  4Z7O A;  3N0D A;  2H9P A;  4ERQ A;  2P9I C;  4MK0 B;  5KDO B;  3CFV A;  4PXW A;  2WQ8 A;  3I7K A;  4RE6 A;  4J82 A;  3C9C A;  4GGC A;  4IMM A;  1SQJ A;  3V7D B;  1S4U X;  4J86 A;  1XKS A;  4FA9 D;  4Y7R A;  4ZOV A;  4CZX A;  3F3P A;  4DNW A;  4J79 A;  5AJA A;  4AN1 A;  2B5L A;  5EAR A;  5IJ8 E;  4UM9 A;  3EI4 A;  2H6Q A;  2HU7 A;  4ESG A;  4X61 B;  3NVN A;  3IIY A;  5H1M A;  3ZDY A;  4PBY A;  5EML B;  2QC5 A;  1VYH C;  3P4F A;  2J57 G;  5A2Q g;  1B9X A;  2PM7 B;  3SVW D;  5CXC B;  1P22 A;  4D6V A;  4J78 A;  3EQ9 A;  2H13 A;  2P9N C;  3DSM A;  4HDJ A;  2VDK A;  4QRJ A;  2G9A A;  3AL8 B;  3OF7 A;  4FAV D;  4Z7Q A;  3EWE A;  2AQ5 A;  3DXM C;  2QXV A;  3AL8 A;  1UOO A;  4LGN A;  1L5G A;  3MKS B;  2OVR B;  1K32 A;  3MMY A;  3BG1 A;  3K72 A;  2CO0 A;  3QHY B;  2IWK A;  3MVD K;  2AGW A;  2IWF A;  4JT5 C;  2Z2P A;  1NEX B;  3V5W B;  3ZE1 A;  4CY1 A;  3C99 A;  2HU5 A;  5I5J A;  3K27 A;  3SBQ A;  4X63 B;  3I7H A;  3C5M A;  2H9L A;  3JB9 L;  1YFQ A;  2VDR A;  5HQG A;  3MKQ A;  4NEN A;  1T2X A;  1SQ9 A;  4XEI C;  4NC4 A;  3SLE D;  2PM9 B;  2CNX A;  5AMS A;  4J73 A;  3EG6 A;  3PSC B;  4A11 B;  3ODT A;  5M5T A;  2GC4 A;  1XIP A;  4A0B A;  2O9K A;  5EAL A;  5FKQ A;  4J81 A;  4L1M A;  1PBY B;  4EWR A;  1RI6 A;  3V9F A;  4E54 B;  3T3M A;  2EIE A;  4J8B A;  3V4V A;  2H68 A;  1OLZ A;  4GZ8 A;  1OMW B;  3UKR C;  4D0K A;  1H2X A;  3FCU A;  4JSV C;  3ZWL B;  1QNI A;  3OTT A;  5EMM B;  1PEV A;  4A09 A;  1FWX A;  2P9S C;  4GM8 A;  4J87 A;  2HKM A;  2OJY A;  2VC2 A;  2H14 A;  3IKO A;  3SXT D;  3C75 H;  5CXB A;  3U4Y A;  2TRC B;  1ERJ A;  2OVQ B;  3I7O A;  2H9M A;  1A0R B;  4O3T B;  4BCD A;  4PSX B;  3HFQ A;  4A7J A;  2MTA H;  2XE4 A;  5IT9 g;  1GG2 B;  4IRZ A;  3KCI A;  4E54 A;  2I0S A;  2QZP A;  3O4J A;  4QQE A;  1N6E A;  5CXC A;  4A0B B;  1MDA H;  2P9K C;  5FQD A;  1JMZ B;  4JSP C;  3T3P A;  2PM9 A;  3V4P A;  4H5J A;  1M1X A;  2BKL A;  4ERZ A;  1C9L A;  2J55 H;  3EI4 B;  4NAA A;  1VZ2 A;  3EQ8 A;  4LG9 A;  4BCB A;  5FFO A;  4D9S A;  5CYK A;  2XZG A;  4O02 A;  4ES0 A;  4YVD A;  4GM9 A;  1GOF A;  5K1C C;  3JZH A;  4U1E I;  1GP2 B;  2P9P C;  4G1E A;  3NID A;  3VH0 A;  2IAA A;  3ZDX A;  3RSE C;  3SBP A;  3PXS D;  3BG0 A;  1JV2 A;  1K8K C;  5TEE A;  4PNK B;  2W18 A;  4FA5 D;  3I7N A;  3GRE A;  4O45 A;  2VDN A;  4NSX A;  3RN1 D;  3SWS D;  3PE7 A;  4BUJ C;  1L0Q A;  3SHF A;  2YNO A;  4AEZ A;  2Z2N A;  3ORV D;  4JHP C;  5C92 A;  5E6R A;  1A12 A;  2HXC A;  5FA5 B;  2Q7Q A;  2VDP A;  1JJU B;  4J77 A;  5HE0 B;  2VDO A;  4CY3 A;  3EQ7 A;  1PGU A;  2AGY A;  4DNV A;  2CO0 C;  2IUV A;  4O3U B;  3ZDZ A;  4JT6 C;  3EI2 B;  2BCJ B;  5H17 A;  5M5S A;  1TBG A;  2XU7 A;  4PBZ A;  1E8N A;  3EI1 B;  5M5U A;  5HE1 B;  5I5M A;  2PBI B;  5E6S A;  4Z7N A;  5FLX g;  4XYI A;  3DDU A;  1U2V C;  4Y5R D;  3J81 g;  4K3J B;  3I8C A;  4BH6 A;  4O2W A;  1VZ3 A;  3DWL C;  2XL3 A;  4J8G A;  3UVM A;  5FKT A;  4J0X A;  1GOG A;  3ZE0 A;  4E5Z A;  5FXY A;  3RLM D;  4CZV A;  5E6U A;  1NR0 A;  4K3I D;  3SJL D;  4CI3 A;  4FAN D;  2HJ4 A;  3SMR A;  3IJ0 A;  2AH1 A;  5I5I A;  2OVP B;  3CFS B;  3UKU C;  3I2N A;  3EU7 A;  5IJ7 E;  3GD1 I;  3IJ1 A;  3IJC A;  3MUN A;  2CN2 A;  3OKY B;  5EM2 A;  1E8M A;  3AH8 B;  3VI4 A;  2HES X;  4WK2 A;  4X3E A;  2B4E A;  4Z8L A;  3GFC A;  4A08 A;  4AOW A;  3UVN A;  4BP8 A;  2BBK H;  4NBM A;  3IUM A;  4O1Q D;  3EI3 A;  1GOT B;  3OW8 A;  4I79 A;  1Q47 A;  3FCS A;  5FFG A;  5C2V B;  4GQ1 A;  4UI9 R;  4DNU A;  3A0F A;  3I89 A;  1SHY B;  4CI2 A;  3VGZ A;  3E0C A;  2H6N A;  1GOH A;  3GC3 B;  2HU8 A;  1JOF A;  3JZG A;  1UTC A;  5HYN B;  2IUR A;  1QFS A;  4XYH A;  4L9O A;  3OL2 A;  5EMJ B;  5H14 A;  5TF2 A;  4OWR A;  4CC9 A;  3VI3 A;  4ZOY A;  5JWZ A;  3IUL A;  4CI1 A;  4PSW B;  4ZOZ A;  3SBR A;  2EIC A;  1U4C A;  3NVQ A;  1JMX B;  3VA6 A;  3OKT A;  3L4M D;  1BPO A;  2B5N A;  3PXW D;  4UM8 A;  3IUN A;  4MMZ A;  5SXM A;  4L3H D;  1K3I A;  4QT8 A;  4A0A B;  2IUP A;  4IA9 A;  4X60 B;  3ZE2 A;  5THA A;  4BCC A;  5EAM A;  4E5Z B;  1MG2 A;  4MMX A;  1VE6 A;  2YNN A;  3EI3 B;  3K26 A;  3AFC A;  1JTD B;  1C9I A;  1H2Y A;  3JZN A;  5TEF A;  4A08 B;  2CE9 A;  5FKR A;  4WK4 A;  2JKX A;  4G1M A;  2GNQ A;  2YBA A;  2OK4 A;  3SFZ A;  2OIZ A;  3JRP A;  4N14 A;  3OKY A;  5EM2 B;  1GXR A;  3JAM g;  4WJK A;  2YNP A;  5AFU 3;  3IIW A;  2I3T A;  2OK6 A;  3QI0 A;  4MMY A;  3SN6 B;  3EI1 A;  5K19 A;  3RFG A;  2EIB A;  4BP9 A;  1I2M B;  1YR2 A;  2AH0 A;  4J84 A;  2YB8 B;  5B4W A;  3J80 g;  1TYQ C;  2XDW A;  1PI6 A;  2VZ3 A;  2AGL A;  2I0T A;  2HKR A;  3RRM C;  1VE7 A;  3CIK B;  4GM3 A;  5M61 A;  1O6G A;  1N6D A;  2B5M A;  3SCY A;  4ERY A;  2VDM A;  3FGB A;  3UR4 A;  4H5I A;  5GXH A;  5IGQ A;  3PSL A;  2H6K A;  2I3S A;  3MZL A;  3O4I A;  4FWW A;  3MZK A;  5GXI A;  3IUQ A;  4JXM A;  2H9N A;  3UVL A;  3NIG A;  2HYE A;  4GQ2 P;  1H2W A;  4BL0 A;  1QFM A;  4O9D A;  4CI8 A;  5HE2 B;  2UZX B;  5EAP A;  3DXK C;  3JRO A;  3PVU B;  2VDL A;  2PM6 B;  2G99 A;  5GSA A;  2P9L C;  4AMY A;  4JHN A;  2CE8 A;  4LG8 A;  4L1Q D;  3EI2 A;  5EMK B;  3RMZ D;  4CY2 A;  3IUJ A;  4FHL A;  4GMB A;  5IGO A; 
#chains in the Genus database with same CATH homology
 4FA4 D;  4GGD A;  2UZY B;  2XL2 A;  3B7F A;  3UVO A;  4FA1 D;  4A0A A;  2AGX A;  4U7A A;  3F3G A;  3PVW B;  3I7P A;  2H47 A;  3AL9 A;  4TZ4 A;  5C9Z B;  3EMH A;  4L3G D;  3OL2 B;  4GQB B;  3DM0 A;  4QL1 A;  4G56 B;  3JPX A;  4A2M A;  4JD2 C;  2H3X A;  5HE3 B;  3UVK A;  4JSX C;  5CYK B;  4CZY A;  4A2L A;  2AGZ A;  3FM0 A;  4OZU A;  3NVX A;  3N0E A;  2XYI A;  2I0R A;  2Z2O A;  2J56 H;  2P9U C;  4CY5 A;  3I7L A;  3I8E A;  3MXX A;  4A11 A;  2GC7 A;  3KRX B;  3RN0 D;  4PC0 A;  3PXT D;  1N6F A;  3ULE C;  5GMK n;  4GGA A;  4FB1 D;  1R5M A;  3L4O D;  2IUQ A;  5TDH B;  4R7A B;  5CXB B;  3F3F A;  3BWS A;  4KFM B;  4J0W A;  1MG3 A;  2EBS A;  3W15 A;  2YMU A;  2CN3 A;  2HJB A;  3FRX A;  5FKS A;  4ZOX A;  4A09 B;  5C2W B;  3OKW A;  1B9Y A;  3KRW B;  1XHM A;  4ZN4 A;  3RFH A;  4JSN C;  5IC7 A;  3N0D A;  2H9P A;  4ERQ A;  2P9I C;  4MK0 B;  5KDO B;  3CFV A;  4PXW A;  3I7K A;  4J82 A;  3C9C A;  4GGC A;  4IMM A;  1SQJ A;  3V7D B;  1S4U X;  4J86 A;  1XKS A;  4FA9 D;  4Y7R A;  4ZOV A;  4CZX A;  3F3P A;  4J79 A;  5AJA A;  2B5L A;  5EAR A;  5IJ8 E;  3EI4 A;  2H6Q A;  4ESG A;  4X61 B;  3NVN A;  3IIY A;  5H1M A;  4PBY A;  5EML B;  2QC5 A;  1VYH C;  3P4F A;  2J57 G;  5A2Q g;  1B9X A;  2PM7 B;  3SVW D;  5CXC B;  1P22 A;  4D6V A;  4J78 A;  2H13 A;  2P9N C;  3DSM A;  4HDJ A;  4QRJ A;  2G9A A;  3AL8 B;  4FAV D;  3EWE A;  2AQ5 A;  3DXM C;  2QXV A;  3AL8 A;  4LGN A;  3MKS B;  2OVR B;  1K32 A;  3MMY A;  3BG1 A;  2CO0 A;  2IWK A;  2AGW A;  2IWF A;  4JT5 C;  2Z2P A;  1NEX B;  3V5W B;  4CY1 A;  3C99 A;  5I5J A;  3K27 A;  3SBQ A;  4X63 B;  3I7H A;  3C5M A;  2H9L A;  3JB9 L;  1YFQ A;  5HQG A;  3MKQ A;  1SQ9 A;  4XEI C;  3SLE D;  2PM9 B;  2CNX A;  5AMS A;  4J73 A;  3EG6 A;  3PSC B;  4A11 B;  3ODT A;  2GC4 A;  1XIP A;  4A0B A;  2O9K A;  5EAL A;  5FKQ A;  4J81 A;  1PBY B;  4EWR A;  1RI6 A;  3V9F A;  4E54 B;  4J8B A;  2H68 A;  1OLZ A;  4GZ8 A;  1OMW B;  3UKR C;  4D0K A;  4JSV C;  3ZWL B;  1QNI A;  3OTT A;  5EMM B;  1PEV A;  4A09 A;  1FWX A;  2P9S C;  4GM8 A;  4J87 A;  2HKM A;  2OJY A;  2H14 A;  3IKO A;  3SXT D;  3C75 H;  5CXB A;  3U4Y A;  2TRC B;  1ERJ A;  2OVQ B;  3I7O A;  2H9M A;  1A0R B;  4O3T B;  4PSX B;  3HFQ A;  4A7J A;  2MTA H;  5IT9 g;  1GG2 B;  4E54 A;  2I0S A;  4QQE A;  1N6E A;  5CXC A;  4A0B B;  1MDA H;  2P9K C;  5FQD A;  1JMZ B;  4JSP C;  2PM9 A;  4H5J A;  4ERZ A;  2J55 H;  3EI4 B;  4LG9 A;  5CYK A;  4ES0 A;  4YVD A;  4GM9 A;  5K1C C;  3JZH A;  4U1E I;  1GP2 B;  2P9P C;  3VH0 A;  2IAA A;  3RSE C;  3SBP A;  3PXS D;  3BG0 A;  1K8K C;  5TEE A;  4PNK B;  2W18 A;  4FA5 D;  3I7N A;  3GRE A;  4O45 A;  4NSX A;  3RN1 D;  3SWS D;  3PE7 A;  4BUJ C;  1L0Q A;  3SHF A;  2YNO A;  4AEZ A;  2Z2N A;  3ORV D;  2HXC A;  5FA5 B;  2Q7Q A;  1JJU B;  4J77 A;  5HE0 B;  4CY3 A;  1PGU A;  2AGY A;  2CO0 C;  2IUV A;  4O3U B;  4JT6 C;  3EI2 B;  2BCJ B;  5H17 A;  1TBG A;  2XU7 A;  4PBZ A;  3EI1 B;  5HE1 B;  5I5M A;  2PBI B;  5FLX g;  4XYI A;  1U2V C;  4Y5R D;  3J81 g;  4K3J B;  3I8C A;  4BH6 A;  3DWL C;  2XL3 A;  4J8G A;  3UVM A;  5FKT A;  4J0X A;  4E5Z A;  5FXY A;  3RLM D;  4CZV A;  1NR0 A;  4K3I D;  3SJL D;  4CI3 A;  4FAN D;  2HJ4 A;  3SMR A;  3IJ0 A;  2AH1 A;  5I5I A;  2OVP B;  3CFS B;  3UKU C;  3I2N A;  3EU7 A;  5IJ7 E;  3IJ1 A;  3IJC A;  2CN2 A;  3OKY B;  5EM2 A;  3AH8 B;  2HES X;  4X3E A;  2B4E A;  4Z8L A;  3GFC A;  4A08 A;  4AOW A;  3UVN A;  2BBK H;  4O1Q D;  3EI3 A;  1GOT B;  3OW8 A;  4I79 A;  1Q47 A;  5C2V B;  4GQ1 A;  4UI9 R;  3A0F A;  3I89 A;  1SHY B;  4CI2 A;  3VGZ A;  3E0C A;  2H6N A;  3JZG A;  1JOF A;  5HYN B;  2IUR A;  4XYH A;  4L9O A;  3OL2 A;  5EMJ B;  5H14 A;  5TF2 A;  4OWR A;  4CC9 A;  4ZOY A;  5JWZ A;  4CI1 A;  4PSW B;  4ZOZ A;  3SBR A;  1U4C A;  3NVQ A;  1JMX B;  3VA6 A;  3OKT A;  3L4M D;  2B5N A;  3PXW D;  5SXM A;  4L3H D;  4QT8 A;  4A0A B;  2IUP A;  4IA9 A;  4X60 B;  5THA A;  5EAM A;  4E5Z B;  1MG2 A;  2YNN A;  3EI3 B;  3K26 A;  3AFC A;  3JZN A;  5TEF A;  4A08 B;  2CE9 A;  5FKR A;  2GNQ A;  2YBA A;  2OK4 A;  3SFZ A;  2OIZ A;  3JRP A;  4N14 A;  3OKY A;  5EM2 B;  1GXR A;  3JAM g;  2YNP A;  5AFU 3;  3IIW A;  2I3T A;  2OK6 A;  3SN6 B;  3EI1 A;  5K19 A;  3RFG A;  2AH0 A;  4J84 A;  2YB8 B;  5B4W A;  3J80 g;  1TYQ C;  1PI6 A;  2AGL A;  2I0T A;  2HKR A;  3RRM C;  3CIK B;  4GM3 A;  1N6D A;  2B5M A;  3SCY A;  4ERY A;  3FGB A;  3UR4 A;  4H5I A;  5GXH A;  5IGQ A;  3PSL A;  2H6K A;  2I3S A;  3MZL A;  4FWW A;  3MZK A;  5GXI A;  4JXM A;  2H9N A;  3UVL A;  2HYE A;  4GQ2 P;  4BL0 A;  4O9D A;  4CI8 A;  5HE2 B;  2UZX B;  5EAP A;  3DXK C;  3JRO A;  3PVU B;  2PM6 B;  2G99 A;  5GSA A;  2P9L C;  2CE8 A;  4LG8 A;  4L1Q D;  3EI2 A;  5EMK B;  3RMZ D;  4CY2 A;  4GMB A;  4FHL A;  5IGO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...