4X63B

Crystal structure of prmt5:mep50 with epz015666 and sah
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
309
structure length
309
Chain Sequence
PPNAPACMERQLEAARYRSDGALLLGASSLSGRCWAGSLWLFKDPCAAPNEGFCSAGVQTEAGVADLTWVGERGILVASDSGAVELWELDENETLIVSKFCKYEHDDIVSTVSVLSSGTQAVSGSKDICIKVWDLAQQVVLSSYRAHAAQVTCVAASPHKDSVFLSCSEDNRILLWDTRCPKPASQIGCSAPGYLPTSLAWHPQQSEVFVFGDENGTVSLVDTKSTSCVLSSAVHSQCVTGLVFSPHSVPFLASLSEDCSLAVLDSSLSELFRSQAHRDFVRDATWSPLNHSLLTTVGWDHQVVHHVVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Protein arginine N-methyltransferase 5
publication title A selective inhibitor of PRMT5 with in vivo and in vitro potency in MCL models.
pubmed doi rcsb
source organism Homo sapiens
total genus 71
structure length 309
sequence length 309
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4x63B00
5IGQA 3JRPA 3HFQA 4J73A 5AMSA 5H1MA 3F3GA 3OW8A 5HQGA 3UVKA 2HXCA 1JMXB 4J84A 4CI1A 4CZVA 3W15A 1JOFA 2I0TA 3FGBA 4JXMA 1MG3A 4J79A 2H14A 2H68A 1SQ9A 3EWEA 2OK4A 2Z2PA 2OIZA 4BL0A 5CXBB 2HKMA 4FB1D 3EI3B 3C5MA 4JSNC 4YVDA 2UZXB 3SHFA 4A0AB 5CXBA 3DXMC 3DWLC 5K19A 4XYIA 2I3TA 4A0BA 1N6DA 4ZOXA 4FA4D 3UVOA 2OK6A 3PSCB 2PM9B 3FM0A 4ESGA 2EBSA 5AFU3 4G56B 3AL8B 3EI4A 2H3XA 4A7JA 2PM9A 1NEXB 5TEFA 4MK0B 5TF2A 4PXWA 2H6KA 3IKOA 3ODTA 4E5ZB 1U2VC 2AGXA 3PXSD 2CE8A 5GXIA 2P9NC 3GREA 1S4UX 2Z2NA 1P22A 4GGCA 3IJ1A 4CI2A 4D6VA 2IUQA 4JT6C 3RN1D 3JPXA 4E54B 1FWXA 5IJ8E 4CC9A 4E54A 3MZLA 3JZGA 3BWSA 1N6FA 5FKSA 3FRXA 4I79A 3K26A 3PXTD 2AGZA 2OJYA 4CY1A 2IURA 2CO0C 3I7NA 2H9NA 5FKQA 4HDJA 3OKYA 4OZUA 1OMWB 3PVUB 3IIYA 4JSVC 1QNIA 4J82A 3UVLA 2CE9A 5C2VB 5GXHA 3RRMC 4FAND 3L4MD 5SXMA 5A2Qg 2B5MA 2AH1A 4QRJA 5CXCB 5EARA 3N0EA 1PEVA 5EMJB 3RFGA 5CXCA 4U7AA 2IUVA 5H17A 4L3HD 2H47A 2BCJB 3E0CA 4PNKB 4A08A 4CZXA 4X61B 3VH0A 4H5JA 2TRCB 1OLZA 4GM9A 2H6QA 5THAA 5I5MA 4A11A 1U4CA 3JZNA 3OKWA 2PM7B 3SLED 2J57G 3PE7A 4FAVD 1RI6A 3OL2A 5CYKB 3UKRC 5IC7A 2Q7QA 3CFVA 1B9YA 1XKSA 2GNQA 3GFCA 2H13A 2H9MA 5EMKB 3RSEC 5GSAA 1MG2A 3DM0A 4OWRA 4J87A 4GGAA 3C99A 3SVWD 3C75H 4JT5C 2G99A 3MZKA 1VYHC 4GMBA 4CY5A 2J55H 4CY2A 4GZ8A 2AH0A 5FXYA 4CI3A 3IJ0A 5EMMB 3SJLD 3EI2A 5C9ZB 4A09A 4A0BB 5IT9g 3EI1A 3EI4B 3EU7A 2Z2OA 5TDHB 4NSXA 1JMZB 4A2LA 3V9FA 3DXKC 5EM2A 3UVNA 1A0RB 3RN0D 4PSWB 2OVRB 3AL9A 3J80g 2CNXA 2P9UC 4O1QD 4L3GD 4R7AB 4ES0A 4EWRA 4AOWA 1TYQC 2XU7A 3MKSB 4O3UB 2BBKH 2QC5A 4Z8LA 5C2WB 4ERYA 3B7FA 1B9XA 2IWFA 2IWKA 3SBRA 3UVMA 3SFZA 1Q47A 3F3FA 5GMKn 3IJCA 1R5MA 3OKYB 3SCYA 2H9PA 3F3PA 2AGWA 3BG1A 4J0XA 4AEZA 4Y7RA 4UI9R 2CN3A 2OVQB 3PSLA 2O9KA 4QT8A 4XYHA 3I7KA 4D0KA 5JWZA 2HESX 3IIWA 3I7LA 4GQ2P 1YFQA 5H14A 1N6EA 4J0WA 3JAMg 1MDAH 3MMYA 3SMRA 4FA9D 4ZN4A 2QXVA 4U1EI 3AFCA 5B4WA 2B5LA 4A08B 3OKTA 4L9OA 2P9LC 4Y5RD 5HE1B 3C9CA 2YNPA 3I7OA 3NVXA 1XHMA 3NVQA 5FQDA 4H5IA 2G9AA 4A11B 1ERJA 2PBIB 3V7DB 3U4YA 4ERQA 4JSXC 2IAAA 4L1QD 3RFHA 3ULEC 3AH8B 3OL2B 5EAPA 2XYIA 4GQ1A 4O9DA 4CI8A 3N0DA 5AJAA 4FA5D 1GG2B 4PC0A 1PBYB 2P9PC 3PXWD 2HJBA 3L4OD 5FKTA 1K32A 4FHLA 1L0QA 3I89A 2H6NA 4J81A 3SWSD 4J86A 2J56H 3J81g 4GQBB 5HE3B 2CN2A 4J77A 2YBAA 4QL1A 4J78A 4FWWA 3SBQA 3EI2B 3ZWLB 2I0SA 4IMMA 5K1CC 4A09B 1PGUA 2YNOA 2AGYA 3RLMD 2OVPB 4JSPC 3EG6A 2P9KC 3EI1B 4GGDA 4J8GA 3JZHA 3CFSB 5EALA 2XL3A 4IA9A 3RMZD 2GC4A 2I3SA 1NR0A 5EM2B 4J8BA 3EMHA 3UR4A 3P4FA 2UZYB 4KFMB 2P9SC 3MKQA 3UKUC 4GM3A 5I5IA 3EI3A 4A0AA 3JB9L 4ZOZA 2IUPA 4X60B 3I2NA 5HYNB 1SQJA 3AL8A 5HE2B 4A2MA 4O45A 3CIKB 2W18A 4E5ZA 2YNNA 4FA1D 4X63B 3K27A 5HE0B 2B4EA 5IGOA 2I0RA 4TZ4A 4PSXB 3VA6A 1GP2B 4CZYA 1PI6A 2P9IC 3PVWB 4LGNA 4XEIC 3DSMA 2XL2A 1GOTB 1K8KC 1TBGA 2GC7A 5FA5B 4GM8A 4LG9A 4PBZA 3SXTD 5TEEA 2PM6B 2MTAH 4ERZA 4ZOVA 4LG8A 2AGLA 3I7PA 3MXXA 3ORVD 1SHYB 2CO0A 3OTTA 5I5JA 3SBPA 2HKRA 4BH6A 3BG0A 2H9LA 4K3JB 4O3TB 4ZOYA 3I8CA 1XIPA 3KRXB 2HYEA 3I7HA 1GXRA 1JJUB 2B5NA 2HJ4A 5KDOB 3I8EA 2AQ5A 3V5WB 4X3EA 5FLXg 3VGZA 4K3ID 5IJ7E 4BUJC 3A0FA 4PBYA 3SN6B 3NVNA 5EMLB 5FKRA 3KRWB 5EAMA 5CYKA 4JD2C 2YB8B 2YMUA 4QQEA 3JROA 4CY3A 4N14A
chains in the Genus database with same CATH superfamily
5IGQA 3IULA 3JRPA 3HFQA 4NAAA 4JHNA 3IUQA 5M61A 4J73A 4AMYA 5AMSA 1TYEA 1VZ2A 5H1MA 3F3GA 3OW8A 2HU7A 4DNVA 5HQGA 3UVKA 2HXCA 1JMXB 4J84A 4CI1A 4CZVA 3W15A 1JOFA 2I0TA 3FGBA 1MG3A 4JXMA 4J79A 2H14A 2H68A 1SQ9A 3EWEA 2OK4A 1UOPA 2Z2PA 2OIZA 4IRZA 2BKLA 4BL0A 5CXBB 3EQ7A 2HKMA 4FB1D 3EI3B 3C5MA 4JSNC 4YVDA 2UZXB 3SHFA 4A0AB 5CXBA 5E6RA 3DXMC 3ZE2A 3DWLC 4WK2A 4XYIA 2I3TA 5K19A 4A0BA 1N6DA 4ZOXA 4FA4D 3UVOA 2OK6A 3PSCB 2PM9B 3FM0A 4ESGA 2EBSA 5AFU3 4G56B 3AL8B 3EI4A 2H3XA 4A7JA 2PM9A 1NEXB 5TEFA 4MK0B 1H2XA 1K3IA 5TF2A 1H2ZA 4PXWA 2H6KA 4BP8A 4AN0A 2QR5A 3IKOA 3ODTA 4E5ZB 1U2VC 2AGXA 3PXSD 3ZDZA 2CE8A 5GXIA 2P9NC 3GREA 1S4UX 2VZ3A 4L1MA 2Z2NA 1P22A 4GGCA 5M5TA 2WQ8A 3IJ1A 4JHPC 4CI2A 4D6VA 2IUQA 4JT6C 3RN1D 3JPXA 3O4JA 4E54B 1FWXA 5IJ8E 4CC9A 3T3PA 4E54A 3MZLA 3KCIA 3JZGA 3BWSA 1N6FA 5FKSA 3FRXA 4I79A 3K26A 3PXTD 2AGZA 2OJYA 1QFSA 4CY1A 2IURA 2CO0C 3I7NA 2H9NA 5FKQA 4HDJA 1UTCA 3OKYA 4OZUA 1OMWB 3PVUB 4Z7NA 4MMYA 3IIYA 4JSVC 1QNIA 2VC2A 4J82A 3UVLA 2CE9A 5C2VB 5GXHA 1UOQA 3RRMC 4FAND 3L4MD 5SXMA 5A2Qg 2B5MA 2AH1A 4QRJA 5CXCB 5EARA 2EIEA 2HU8A 3N0EA 1PEVA 5EMJB 3RFGA 5CXCA 4U7AA 2IUVA 5H17A 4L3HD 1C9IA 4O02A 1M1XA 2H47A 2BCJB 4NBMA 3E0CA 4PNKB 4A08A 4CZXA 1H2YA 4UM8A 4X61B 2HU5A 3VH0A 4H5JA 3IVMA 5FFGA 2TRCB 1OLZA 1O6FA 4GM9A 4DNWA 2H6QA 5THAA 5I5MA 4A11A 1U4CA 3JZNA 3OKWA 5E6UA 2PM7B 3SLED 5FFOA 2J57G 2QZPA 3PE7A 4FAVD 1RI6A 1GOFA 3OL2A 2VDKA 5CYKB 3UKRC 5IC7A 2Q7QA 3CFVA 4BCCA 1JTDB 1B9YA 1XKSA 2VDLA 2GNQA 3GFCA 2H13A 2H9MA 2JKXA 5EMKB 3RSEC 5GSAA 1MG2A 2XDWA 3DM0A 4OWRA 5M5SA 4J87A 4GGAA 3ZDYA 3C99A 3SVWD 3ZE1A 3C75H 4JT5C 2G99A 3MZKA 1VYHC 4GMBA 4CY5A 1O6GA 2J55H 4CY2A 1T2XA 4GZ8A 3K71A 2AH0A 1GOGA 5FXYA 4CI3A 3IJ0A 5EMMB 1BPOA 3SJLD 3EI2A 2VDQA 5C9ZB 4A09A 4A0BB 3GC3B 5IT9g 3EI1A 3EI4B 3EU7A 2Z2OA 5TDHB 4NSXA 1JMZB 4A2LA 3V9FA 3MUOA 3DXKC 5EM2A 3UVNA 1A0RB 3RN0D 4PSWB 2OVRB 3AL9A 3J80g 2CNXA 3K6SA 3NIFA 2P9UC 4O1QD 4L3GD 4R7AB 4ES0A 4EWRA 4AOWA 1TYQC 3ZE0A 2XU7A 3MKSB 4O3UB 3MVDK 2BBKH 2QC5A 2VZ1A 1U8CA 1VZ3A 2XZGA 4Z8LA 3V4VA 5C2WB 4MMXA 3B7FA 4ERYA 1B9XA 2IWFA 2IWKA 3SBRA 3UVMA 3SFZA 1Q47A 3F3FA 5GMKn 3IJCA 1R5MA 3OKYB 3SCYA 2H9PA 3F3PA 2AGWA 1YR2A 3BG1A 4J0XA 3DDUA 4AEZA 3IUJA 4Y7RA 4UI9R 1QFMA 4AMZA 2CN3A 2OVQB 3PSLA 2O9KA 3IUNA 4QT8A 3IURA 4XYHA 3I7KA 4MMZA 3IJEA 4D0KA 5JWZA 2HESX 3IIWA 3I7LA 4GQ2P 4WJKA 1L5GA 1YFQA 5H14A 1N6EA 3O4IA 4J0WA 3JAMg 1MDAH 3MMYA 3SMRA 2VDMA 4FA9D 4ZN4A 2QXVA 4U1EI 3AFCA 5B4WA 2B5LA 4A08B 4WK0A 3OKTA 4L9OA 3V4PA 2P9LC 4D9SA 4Y5RD 5HE1B 3C9CA 2YNPA 3I7OA 3NVXA 1XHMA 3NVQA 4Z7OA 3FCSA 5FQDA 4H5IA 3OF7A 2G9AA 4A11B 1ERJA 2PBIB 3V7DB 3U4YA 3K72A 4ERQA 4JSXC 2IAAA 4L1QD 3RFHA 3ULEC 3AH8B 3OL2B 5EAPA 1JV2A 1I2MB 2XYIA 4GQ1A 4O9DA 3NIDA 4CI8A 1E8MA 3N0DA 5AJAA 4FA5D 1GG2B 4PC0A 5M5UA 1PBYB 2P9PC 3PXWD 3FCUA 2EIBA 2HJBA 3L4OD 5FKTA 2EIDA 1K32A 4FHLA 3O4HA 1L0QA 3I89A 2H6NA 4J81A 3SWSD 4J86A 2J56H 1E8NA 3J81g 4GQBB 5HE3B 2CN2A 4J77A 2YBAA 4QL1A 2VDRA 4J78A 4FWWA 3SBQA 3EI2B 4DNUA 3ZWLB 2I0SA 4IMMA 5K1CC 4BCBA 4A09B 4AX4A 1PGUA 2YNOA 2AGYA 3RLMD 2OVPB 4JSPC 3EG6A 2P9KC 4RE5A 3EI1B 1UOOA 4G1EA 4GGDA 4J8GA 3JZHA 3CFSB 5EALA 2XL3A 3QHYB 4IA9A 2VDPA 2GC4A 2I3SA 1NR0A 4RE6A 3RMZD 3IUMA 5M5RA 5EM2B 4J8BA 3EMHA 3UR4A 2VDOA 3P4FA 2UZYB 4KFMB 2P9SC 2VDNA 3MKQA 3UKUC 4GM3A 4G55A 5I5IA 3EQ8A 3EI3A 1A12A 3QI0A 4A0AA 3JB9L 4ZOZA 4Z7QA 2IUPA 4NENA 4X60B 3I2NA 4UM9A 5HYNB 1SQJA 3AL8A 5C92A 3VI4A 4O2WA 5HE2B 4A2MA 4O45A 3CIKB 2W18A 4E5ZA 2YNNA 1E5TA 1H2WA 4FA1D 4X63B 2XE4A 5C86A 3K27A 5HDBA 4NC4A 5HE0B 2B4EA 5IGOA 2I0RA 4TZ4A 5M5VA 3MUNA 4PSXB 3T3MA 3VA6A 1GP2B 5E6SA 3VI3A 4CZYA 1PI6A 2P9IC 3PVWB 4LGNA 4XEIC 3DSMA 2XL2A 1GOTB 1K8KC 4WK4A 1TBGA 2GC7A 3O4GA 5FA5B 4GM8A 4LG9A 4PBZA 3GD1I 4G1MA 3SXTD 5TEEA 2PM6B 2MTAH 4ERZA 4BP9A 4ZOVA 4LG8A 2AGLA 3I7PA 3MXXA 3ORVD 1SHYB 2CO0A 3OTTA 5I5JA 3SBPA 3ZDXA 2HKRA 4BH6A 3BG0A 2H9LA 4K3JB 4O3TB 4ZOYA 3I8CA 4QAMA 1XIPA 3KRXB 2HYEA 3I7HA 1GXRA 1VE7A 1JJUB 2EICA 3EQ9A 2B5NA 4AN1A 2HJ4A 5KDOB 1VE6A 3I8EA 1C9LA 2AQ5A 3V5WB 4X3EA 5FLXg 3VGZA 4K3ID 3NIGA 5IJ7E 4BUJC 3A0FA 4PBYA 3SN6B 3NVNA 5EMLB 1GOHA 5FKRA 4BCDA 3KRWB 5EAMA 5CYKA 4JD2C 2YB8B 2YMUA 4QQEA 3JROA 4CY3A 4N14A
chains in the Genus database with same CATH topology
5IGQA 3JRPA 3HFQA 4J73A 5AMSA 5H1MA 3F3GA 3OW8A 5HQGA 3UVKA 2HXCA 1JMXB 4J84A 4CI1A 4CZVA 3W15A 1JOFA 2I0TA 3FGBA 4JXMA 1MG3A 4J79A 2H14A 2H68A 1SQ9A 3EWEA 2OK4A 2Z2PA 2OIZA 4BL0A 5CXBB 2HKMA 4FB1D 3EI3B 3C5MA 4JSNC 4YVDA 2UZXB 3SHFA 4A0AB 5CXBA 3DXMC 3DWLC 5K19A 4XYIA 2I3TA 4A0BA 1N6DA 4ZOXA 4FA4D 3UVOA 2OK6A 3PSCB 2PM9B 3FM0A 4ESGA 2EBSA 5AFU3 4G56B 3AL8B 3EI4A 2H3XA 4A7JA 2PM9A 1NEXB 5TEFA 4MK0B 5TF2A 4PXWA 2H6KA 3IKOA 3ODTA 4E5ZB 1U2VC 2AGXA 3PXSD 2CE8A 5GXIA 2P9NC 3GREA 1S4UX 2Z2NA 1P22A 4GGCA 3IJ1A 4CI2A 4D6VA 2IUQA 4JT6C 3RN1D 3JPXA 4E54B 1FWXA 5IJ8E 4CC9A 4E54A 3MZLA 3JZGA 3BWSA 1N6FA 5FKSA 3FRXA 4I79A 3K26A 3PXTD 2AGZA 2OJYA 4CY1A 2IURA 2CO0C 3I7NA 2H9NA 5FKQA 4HDJA 3OKYA 4OZUA 1OMWB 3PVUB 3IIYA 4JSVC 1QNIA 4J82A 3UVLA 2CE9A 5C2VB 5GXHA 3RRMC 4FAND 3L4MD 5SXMA 5A2Qg 2B5MA 2AH1A 4QRJA 5CXCB 5EARA 3N0EA 1PEVA 5EMJB 3RFGA 5CXCA 4U7AA 2IUVA 5H17A 4L3HD 2H47A 2BCJB 3E0CA 4PNKB 4A08A 4CZXA 4X61B 3VH0A 4H5JA 2TRCB 1OLZA 4GM9A 2H6QA 5THAA 5I5MA 4A11A 1U4CA 3JZNA 3OKWA 2PM7B 3SLED 2J57G 3PE7A 4FAVD 1RI6A 3OL2A 5CYKB 3UKRC 5IC7A 2Q7QA 3CFVA 1B9YA 1XKSA 2GNQA 3GFCA 2H13A 2H9MA 5EMKB 3RSEC 5GSAA 1MG2A 3DM0A 4OWRA 4J87A 4GGAA 3C99A 3SVWD 3C75H 4JT5C 2G99A 3MZKA 1VYHC 4GMBA 4CY5A 2J55H 4CY2A 4GZ8A 2AH0A 5FXYA 4CI3A 3IJ0A 5EMMB 3SJLD 3EI2A 5C9ZB 4A09A 4A0BB 5IT9g 3EI1A 3EI4B 3EU7A 2Z2OA 5TDHB 4NSXA 1JMZB 4A2LA 3V9FA 3DXKC 5EM2A 3UVNA 1A0RB 3RN0D 4PSWB 2OVRB 3AL9A 3J80g 2CNXA 2P9UC 4O1QD 4L3GD 4R7AB 4ES0A 4EWRA 4AOWA 1TYQC 2XU7A 3MKSB 4O3UB 2BBKH 2QC5A 4Z8LA 5C2WB 4ERYA 3B7FA 1B9XA 2IWFA 2IWKA 3SBRA 3UVMA 3SFZA 1Q47A 3F3FA 5GMKn 3IJCA 1R5MA 3OKYB 3SCYA 2H9PA 3F3PA 2AGWA 3BG1A 4J0XA 4AEZA 4Y7RA 4UI9R 2CN3A 2OVQB 3PSLA 2O9KA 4QT8A 4XYHA 3I7KA 4D0KA 5JWZA 2HESX 3IIWA 3I7LA 4GQ2P 1YFQA 5H14A 1N6EA 4J0WA 3JAMg 1MDAH 3MMYA 3SMRA 4FA9D 4ZN4A 2QXVA 4U1EI 3AFCA 5B4WA 2B5LA 4A08B 3OKTA 4L9OA 2P9LC 4Y5RD 5HE1B 3C9CA 2YNPA 3I7OA 3NVXA 1XHMA 3NVQA 5FQDA 4H5IA 2G9AA 4A11B 1ERJA 2PBIB 3V7DB 3U4YA 4ERQA 4JSXC 2IAAA 4L1QD 3RFHA 3ULEC 3AH8B 3OL2B 5EAPA 2XYIA 4GQ1A 4O9DA 4CI8A 3N0DA 5AJAA 4FA5D 1GG2B 4PC0A 1PBYB 2P9PC 3PXWD 2HJBA 3L4OD 5FKTA 1K32A 4FHLA 1L0QA 3I89A 2H6NA 4J81A 3SWSD 4J86A 2J56H 3J81g 4GQBB 5HE3B 2CN2A 4J77A 2YBAA 4QL1A 4J78A 4FWWA 3SBQA 3EI2B 3ZWLB 2I0SA 4IMMA 5K1CC 4A09B 1PGUA 2YNOA 2AGYA 3RLMD 2OVPB 4JSPC 3EG6A 2P9KC 3EI1B 4GGDA 4J8GA 3JZHA 3CFSB 5EALA 2XL3A 4IA9A 3RMZD 2GC4A 2I3SA 1NR0A 5EM2B 4J8BA 3EMHA 3UR4A 3P4FA 2UZYB 4KFMB 2P9SC 3MKQA 3UKUC 4GM3A 5I5IA 3EI3A 4A0AA 3JB9L 4ZOZA 2IUPA 4X60B 3I2NA 5HYNB 1SQJA 3AL8A 5HE2B 4A2MA 4O45A 3CIKB 2W18A 4E5ZA 2YNNA 4FA1D 4X63B 3K27A 5HE0B 2B4EA 5IGOA 2I0RA 4TZ4A 4PSXB 3VA6A 1GP2B 4CZYA 1PI6A 2P9IC 3PVWB 4LGNA 4XEIC 3DSMA 2XL2A 1GOTB 1K8KC 1TBGA 2GC7A 5FA5B 4GM8A 4LG9A 4PBZA 3SXTD 5TEEA 2PM6B 2MTAH 4ERZA 4ZOVA 4LG8A 2AGLA 3I7PA 3MXXA 3ORVD 1SHYB 2CO0A 3OTTA 5I5JA 3SBPA 2HKRA 4BH6A 3BG0A 2H9LA 4K3JB 4O3TB 4ZOYA 3I8CA 1XIPA 3KRXB 2HYEA 3I7HA 1GXRA 1JJUB 2B5NA 2HJ4A 5KDOB 3I8EA 2AQ5A 3V5WB 4X3EA 5FLXg 3VGZA 4K3ID 5IJ7E 4BUJC 3A0FA 4PBYA 3SN6B 3NVNA 5EMLB 5FKRA 3KRWB 5EAMA 5CYKA 4JD2C 2YB8B 2YMUA 4QQEA 3JROA 4CY3A 4N14A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IGQ A;  3JRP A;  3HFQ A;  4J73 A;  5AMS A;  5H1M A;  3F3G A;  3OW8 A;  5HQG A;  3UVK A;  2HXC A;  1JMX B;  4J84 A;  4CI1 A;  4CZV A;  3W15 A;  1JOF A;  2I0T A;  3FGB A;  4JXM A;  1MG3 A;  4J79 A;  2H14 A;  2H68 A;  1SQ9 A;  3EWE A;  2OK4 A;  2Z2P A;  2OIZ A;  4BL0 A;  5CXB B;  2HKM A;  4FB1 D;  3EI3 B;  3C5M A;  4JSN C;  4YVD A;  2UZX B;  3SHF A;  4A0A B;  5CXB A;  3DXM C;  3DWL C;  5K19 A;  4XYI A;  2I3T A;  4A0B A;  1N6D A;  4ZOX A;  4FA4 D;  3UVO A;  2OK6 A;  3PSC B;  2PM9 B;  3FM0 A;  4ESG A;  2EBS A;  5AFU 3;  4G56 B;  3AL8 B;  3EI4 A;  2H3X A;  4A7J A;  2PM9 A;  1NEX B;  5TEF A;  4MK0 B;  5TF2 A;  4PXW A;  2H6K A;  3IKO A;  3ODT A;  4E5Z B;  1U2V C;  2AGX A;  3PXS D;  2CE8 A;  5GXI A;  2P9N C;  3GRE A;  1S4U X;  2Z2N A;  1P22 A;  4GGC A;  3IJ1 A;  4CI2 A;  4D6V A;  2IUQ A;  4JT6 C;  3RN1 D;  3JPX A;  4E54 B;  1FWX A;  5IJ8 E;  4CC9 A;  4E54 A;  3MZL A;  3JZG A;  3BWS A;  1N6F A;  5FKS A;  3FRX A;  4I79 A;  3K26 A;  3PXT D;  2AGZ A;  2OJY A;  4CY1 A;  2IUR A;  2CO0 C;  3I7N A;  2H9N A;  5FKQ A;  4HDJ A;  3OKY A;  4OZU A;  1OMW B;  3PVU B;  3IIY A;  4JSV C;  1QNI A;  4J82 A;  3UVL A;  2CE9 A;  5C2V B;  5GXH A;  3RRM C;  4FAN D;  3L4M D;  5SXM A;  5A2Q g;  2B5M A;  2AH1 A;  4QRJ A;  5CXC B;  5EAR A;  3N0E A;  1PEV A;  5EMJ B;  3RFG A;  5CXC A;  4U7A A;  2IUV A;  5H17 A;  4L3H D;  2H47 A;  2BCJ B;  3E0C A;  4PNK B;  4A08 A;  4CZX A;  4X61 B;  3VH0 A;  4H5J A;  2TRC B;  1OLZ A;  4GM9 A;  2H6Q A;  5THA A;  5I5M A;  4A11 A;  1U4C A;  3JZN A;  3OKW A;  2PM7 B;  3SLE D;  2J57 G;  3PE7 A;  4FAV D;  1RI6 A;  3OL2 A;  5CYK B;  3UKR C;  5IC7 A;  2Q7Q A;  3CFV A;  1B9Y A;  1XKS A;  2GNQ A;  3GFC A;  2H13 A;  2H9M A;  5EMK B;  3RSE C;  5GSA A;  1MG2 A;  3DM0 A;  4OWR A;  4J87 A;  4GGA A;  3C99 A;  3SVW D;  3C75 H;  4JT5 C;  2G99 A;  3MZK A;  1VYH C;  4GMB A;  4CY5 A;  2J55 H;  4CY2 A;  4GZ8 A;  2AH0 A;  5FXY A;  4CI3 A;  3IJ0 A;  5EMM B;  3SJL D;  3EI2 A;  5C9Z B;  4A09 A;  4A0B B;  5IT9 g;  3EI1 A;  3EI4 B;  3EU7 A;  2Z2O A;  5TDH B;  4NSX A;  1JMZ B;  4A2L A;  3V9F A;  3DXK C;  5EM2 A;  3UVN A;  1A0R B;  3RN0 D;  4PSW B;  2OVR B;  3AL9 A;  3J80 g;  2CNX A;  2P9U C;  4O1Q D;  4L3G D;  4R7A B;  4ES0 A;  4EWR A;  4AOW A;  1TYQ C;  2XU7 A;  3MKS B;  4O3U B;  2BBK H;  2QC5 A;  4Z8L A;  5C2W B;  4ERY A;  3B7F A;  1B9X A;  2IWF A;  2IWK A;  3SBR A;  3UVM A;  3SFZ A;  1Q47 A;  3F3F A;  5GMK n;  3IJC A;  1R5M A;  3OKY B;  3SCY A;  2H9P A;  3F3P A;  2AGW A;  3BG1 A;  4J0X A;  4AEZ A;  4Y7R A;  4UI9 R;  2CN3 A;  2OVQ B;  3PSL A;  2O9K A;  4QT8 A;  4XYH A;  3I7K A;  4D0K A;  5JWZ A;  2HES X;  3IIW A;  3I7L A;  4GQ2 P;  1YFQ A;  5H14 A;  1N6E A;  4J0W A;  3JAM g;  1MDA H;  3MMY A;  3SMR A;  4FA9 D;  4ZN4 A;  2QXV A;  4U1E I;  3AFC A;  5B4W A;  2B5L A;  4A08 B;  3OKT A;  4L9O A;  2P9L C;  4Y5R D;  5HE1 B;  3C9C A;  2YNP A;  3I7O A;  3NVX A;  1XHM A;  3NVQ A;  5FQD A;  4H5I A;  2G9A A;  4A11 B;  1ERJ A;  2PBI B;  3V7D B;  3U4Y A;  4ERQ A;  4JSX C;  2IAA A;  4L1Q D;  3RFH A;  3ULE C;  3AH8 B;  3OL2 B;  5EAP A;  2XYI A;  4GQ1 A;  4O9D A;  4CI8 A;  3N0D A;  5AJA A;  4FA5 D;  1GG2 B;  4PC0 A;  1PBY B;  2P9P C;  3PXW D;  2HJB A;  3L4O D;  5FKT A;  1K32 A;  4FHL A;  1L0Q A;  3I89 A;  2H6N A;  4J81 A;  3SWS D;  4J86 A;  2J56 H;  3J81 g;  4GQB B;  5HE3 B;  2CN2 A;  4J77 A;  2YBA A;  4QL1 A;  4J78 A;  4FWW A;  3SBQ A;  3EI2 B;  3ZWL B;  2I0S A;  4IMM A;  5K1C C;  4A09 B;  1PGU A;  2YNO A;  2AGY A;  3RLM D;  2OVP B;  4JSP C;  3EG6 A;  2P9K C;  3EI1 B;  4GGD A;  4J8G A;  3JZH A;  3CFS B;  5EAL A;  2XL3 A;  4IA9 A;  3RMZ D;  2GC4 A;  2I3S A;  1NR0 A;  5EM2 B;  4J8B A;  3EMH A;  3UR4 A;  3P4F A;  2UZY B;  4KFM B;  2P9S C;  3MKQ A;  3UKU C;  4GM3 A;  5I5I A;  3EI3 A;  4A0A A;  3JB9 L;  4ZOZ A;  2IUP A;  4X60 B;  3I2N A;  5HYN B;  1SQJ A;  3AL8 A;  5HE2 B;  4A2M A;  4O45 A;  3CIK B;  2W18 A;  4E5Z A;  2YNN A;  4FA1 D;  4X63 B;  3K27 A;  5HE0 B;  2B4E A;  5IGO A;  2I0R A;  4TZ4 A;  4PSX B;  3VA6 A;  1GP2 B;  4CZY A;  1PI6 A;  2P9I C;  3PVW B;  4LGN A;  4XEI C;  3DSM A;  2XL2 A;  1GOT B;  1K8K C;  1TBG A;  2GC7 A;  5FA5 B;  4GM8 A;  4LG9 A;  4PBZ A;  3SXT D;  5TEE A;  2PM6 B;  2MTA H;  4ERZ A;  4ZOV A;  4LG8 A;  2AGL A;  3I7P A;  3MXX A;  3ORV D;  1SHY B;  2CO0 A;  3OTT A;  5I5J A;  3SBP A;  2HKR A;  4BH6 A;  3BG0 A;  2H9L A;  4K3J B;  4O3T B;  4ZOY A;  3I8C A;  1XIP A;  3KRX B;  2HYE A;  3I7H A;  1GXR A;  1JJU B;  2B5N A;  2HJ4 A;  5KDO B;  3I8E A;  2AQ5 A;  3V5W B;  4X3E A;  5FLX g;  3VGZ A;  4K3I D;  5IJ7 E;  4BUJ C;  3A0F A;  4PBY A;  3SN6 B;  3NVN A;  5EML B;  5FKR A;  3KRW B;  5EAM A;  5CYK A;  4JD2 C;  2YB8 B;  2YMU A;  4QQE A;  3JRO A;  4CY3 A;  4N14 A; 
#chains in the Genus database with same CATH topology
 5IGQ A;  3IUL A;  3JRP A;  3HFQ A;  4NAA A;  4JHN A;  3IUQ A;  5M61 A;  4J73 A;  4AMY A;  5AMS A;  1TYE A;  1VZ2 A;  5H1M A;  3F3G A;  3OW8 A;  2HU7 A;  4DNV A;  5HQG A;  3UVK A;  2HXC A;  1JMX B;  4J84 A;  4CI1 A;  4CZV A;  3W15 A;  1JOF A;  2I0T A;  3FGB A;  1MG3 A;  4JXM A;  4J79 A;  2H14 A;  2H68 A;  1SQ9 A;  3EWE A;  2OK4 A;  1UOP A;  2Z2P A;  2OIZ A;  4IRZ A;  2BKL A;  4BL0 A;  5CXB B;  3EQ7 A;  2HKM A;  4FB1 D;  3EI3 B;  3C5M A;  4JSN C;  4YVD A;  2UZX B;  3SHF A;  4A0A B;  5CXB A;  5E6R A;  3DXM C;  3ZE2 A;  3DWL C;  4WK2 A;  4XYI A;  2I3T A;  5K19 A;  4A0B A;  1N6D A;  4ZOX A;  4FA4 D;  3UVO A;  2OK6 A;  3PSC B;  2PM9 B;  3FM0 A;  4ESG A;  2EBS A;  5AFU 3;  4G56 B;  3AL8 B;  3EI4 A;  2H3X A;  4A7J A;  2PM9 A;  1NEX B;  5TEF A;  4MK0 B;  1H2X A;  1K3I A;  5TF2 A;  1H2Z A;  4PXW A;  2H6K A;  4BP8 A;  4AN0 A;  2QR5 A;  3IKO A;  3ODT A;  4E5Z B;  1U2V C;  2AGX A;  3PXS D;  3ZDZ A;  2CE8 A;  5GXI A;  2P9N C;  3GRE A;  1S4U X;  2VZ3 A;  4L1M A;  2Z2N A;  1P22 A;  4GGC A;  5M5T A;  2WQ8 A;  3IJ1 A;  4JHP C;  4CI2 A;  4D6V A;  2IUQ A;  4JT6 C;  3RN1 D;  3JPX A;  3O4J A;  4E54 B;  1FWX A;  5IJ8 E;  4CC9 A;  3T3P A;  4E54 A;  3MZL A;  3KCI A;  3JZG A;  3BWS A;  1N6F A;  5FKS A;  3FRX A;  4I79 A;  3K26 A;  3PXT D;  2AGZ A;  2OJY A;  1QFS A;  4CY1 A;  2IUR A;  2CO0 C;  3I7N A;  2H9N A;  5FKQ A;  4HDJ A;  1UTC A;  3OKY A;  4OZU A;  1OMW B;  3PVU B;  4Z7N A;  4MMY A;  3IIY A;  4JSV C;  1QNI A;  2VC2 A;  4J82 A;  3UVL A;  2CE9 A;  5C2V B;  5GXH A;  1UOQ A;  3RRM C;  4FAN D;  3L4M D;  5SXM A;  5A2Q g;  2B5M A;  2AH1 A;  4QRJ A;  5CXC B;  5EAR A;  2EIE A;  2HU8 A;  3N0E A;  1PEV A;  5EMJ B;  3RFG A;  5CXC A;  4U7A A;  2IUV A;  5H17 A;  4L3H D;  1C9I A;  4O02 A;  1M1X A;  2H47 A;  2BCJ B;  4NBM A;  3E0C A;  4PNK B;  4A08 A;  4CZX A;  1H2Y A;  4UM8 A;  4X61 B;  2HU5 A;  3VH0 A;  4H5J A;  3IVM A;  5FFG A;  2TRC B;  1OLZ A;  1O6F A;  4GM9 A;  4DNW A;  2H6Q A;  5THA A;  5I5M A;  4A11 A;  1U4C A;  3JZN A;  3OKW A;  5E6U A;  2PM7 B;  3SLE D;  5FFO A;  2J57 G;  2QZP A;  3PE7 A;  4FAV D;  1RI6 A;  1GOF A;  3OL2 A;  2VDK A;  5CYK B;  3UKR C;  5IC7 A;  2Q7Q A;  3CFV A;  4BCC A;  1JTD B;  1B9Y A;  1XKS A;  2VDL A;  2GNQ A;  3GFC A;  2H13 A;  2H9M A;  2JKX A;  5EMK B;  3RSE C;  5GSA A;  1MG2 A;  2XDW A;  3DM0 A;  4OWR A;  5M5S A;  4J87 A;  4GGA A;  3ZDY A;  3C99 A;  3SVW D;  3ZE1 A;  3C75 H;  4JT5 C;  2G99 A;  3MZK A;  1VYH C;  4GMB A;  4CY5 A;  1O6G A;  2J55 H;  4CY2 A;  1T2X A;  4GZ8 A;  3K71 A;  2AH0 A;  1GOG A;  5FXY A;  4CI3 A;  3IJ0 A;  5EMM B;  1BPO A;  3SJL D;  3EI2 A;  2VDQ A;  5C9Z B;  4A09 A;  4A0B B;  3GC3 B;  5IT9 g;  3EI1 A;  3EI4 B;  3EU7 A;  2Z2O A;  5TDH B;  4NSX A;  1JMZ B;  4A2L A;  3V9F A;  3MUO A;  3DXK C;  5EM2 A;  3UVN A;  1A0R B;  3RN0 D;  4PSW B;  2OVR B;  3AL9 A;  3J80 g;  2CNX A;  3K6S A;  3NIF A;  2P9U C;  4O1Q D;  4L3G D;  4R7A B;  4ES0 A;  4EWR A;  4AOW A;  1TYQ C;  3ZE0 A;  2XU7 A;  3MKS B;  4O3U B;  3MVD K;  2BBK H;  2QC5 A;  2VZ1 A;  1U8C A;  1VZ3 A;  2XZG A;  4Z8L A;  3V4V A;  5C2W B;  4MMX A;  3B7F A;  4ERY A;  1B9X A;  2IWF A;  2IWK A;  3SBR A;  3UVM A;  3SFZ A;  1Q47 A;  3F3F A;  5GMK n;  3IJC A;  1R5M A;  3OKY B;  3SCY A;  2H9P A;  3F3P A;  2AGW A;  1YR2 A;  3BG1 A;  4J0X A;  3DDU A;  4AEZ A;  3IUJ A;  4Y7R A;  4UI9 R;  1QFM A;  4AMZ A;  2CN3 A;  2OVQ B;  3PSL A;  2O9K A;  3IUN A;  4QT8 A;  3IUR A;  4XYH A;  3I7K A;  4MMZ A;  3IJE A;  4D0K A;  5JWZ A;  2HES X;  3IIW A;  3I7L A;  4GQ2 P;  4WJK A;  1L5G A;  1YFQ A;  5H14 A;  1N6E A;  3O4I A;  4J0W A;  3JAM g;  1MDA H;  3MMY A;  3SMR A;  2VDM A;  4FA9 D;  4ZN4 A;  2QXV A;  4U1E I;  3AFC A;  5B4W A;  2B5L A;  4A08 B;  4WK0 A;  3OKT A;  4L9O A;  3V4P A;  2P9L C;  4D9S A;  4Y5R D;  5HE1 B;  3C9C A;  2YNP A;  3I7O A;  3NVX A;  1XHM A;  3NVQ A;  4Z7O A;  3FCS A;  5FQD A;  4H5I A;  3OF7 A;  2G9A A;  4A11 B;  1ERJ A;  2PBI B;  3V7D B;  3U4Y A;  3K72 A;  4ERQ A;  4JSX C;  2IAA A;  4L1Q D;  3RFH A;  3ULE C;  3AH8 B;  3OL2 B;  5EAP A;  1JV2 A;  1I2M B;  2XYI A;  4GQ1 A;  4O9D A;  3NID A;  4CI8 A;  1E8M A;  3N0D A;  5AJA A;  4FA5 D;  1GG2 B;  4PC0 A;  5M5U A;  1PBY B;  2P9P C;  3PXW D;  3FCU A;  2EIB A;  2HJB A;  3L4O D;  5FKT A;  2EID A;  1K32 A;  4FHL A;  3O4H A;  1L0Q A;  3I89 A;  2H6N A;  4J81 A;  3SWS D;  4J86 A;  2J56 H;  1E8N A;  3J81 g;  4GQB B;  5HE3 B;  2CN2 A;  4J77 A;  2YBA A;  4QL1 A;  2VDR A;  4J78 A;  4FWW A;  3SBQ A;  3EI2 B;  4DNU A;  3ZWL B;  2I0S A;  4IMM A;  5K1C C;  4BCB A;  4A09 B;  4AX4 A;  1PGU A;  2YNO A;  2AGY A;  3RLM D;  2OVP B;  4JSP C;  3EG6 A;  2P9K C;  4RE5 A;  3EI1 B;  1UOO A;  4G1E A;  4GGD A;  4J8G A;  3JZH A;  3CFS B;  5EAL A;  2XL3 A;  3QHY B;  4IA9 A;  2VDP A;  2GC4 A;  2I3S A;  1NR0 A;  4RE6 A;  3RMZ D;  3IUM A;  5M5R A;  5EM2 B;  4J8B A;  3EMH A;  3UR4 A;  2VDO A;  3P4F A;  2UZY B;  4KFM B;  2P9S C;  2VDN A;  3MKQ A;  3UKU C;  4GM3 A;  4G55 A;  5I5I A;  3EQ8 A;  3EI3 A;  1A12 A;  3QI0 A;  4A0A A;  3JB9 L;  4ZOZ A;  4Z7Q A;  2IUP A;  4NEN A;  4X60 B;  3I2N A;  4UM9 A;  5HYN B;  1SQJ A;  3AL8 A;  5C92 A;  3VI4 A;  4O2W A;  5HE2 B;  4A2M A;  4O45 A;  3CIK B;  2W18 A;  4E5Z A;  2YNN A;  1E5T A;  1H2W A;  4FA1 D;  4X63 B;  2XE4 A;  5C86 A;  3K27 A;  5HDB A;  4NC4 A;  5HE0 B;  2B4E A;  5IGO A;  2I0R A;  4TZ4 A;  5M5V A;  3MUN A;  4PSX B;  3T3M A;  3VA6 A;  1GP2 B;  5E6S A;  3VI3 A;  4CZY A;  1PI6 A;  2P9I C;  3PVW B;  4LGN A;  4XEI C;  3DSM A;  2XL2 A;  1GOT B;  1K8K C;  4WK4 A;  1TBG A;  2GC7 A;  3O4G A;  5FA5 B;  4GM8 A;  4LG9 A;  4PBZ A;  3GD1 I;  4G1M A;  3SXT D;  5TEE A;  2PM6 B;  2MTA H;  4ERZ A;  4BP9 A;  4ZOV A;  4LG8 A;  2AGL A;  3I7P A;  3MXX A;  3ORV D;  1SHY B;  2CO0 A;  3OTT A;  5I5J A;  3SBP A;  3ZDX A;  2HKR A;  4BH6 A;  3BG0 A;  2H9L A;  4K3J B;  4O3T B;  4ZOY A;  3I8C A;  4QAM A;  1XIP A;  3KRX B;  2HYE A;  3I7H A;  1GXR A;  1VE7 A;  1JJU B;  2EIC A;  3EQ9 A;  2B5N A;  4AN1 A;  2HJ4 A;  5KDO B;  1VE6 A;  3I8E A;  1C9L A;  2AQ5 A;  3V5W B;  4X3E A;  5FLX g;  3VGZ A;  4K3I D;  3NIG A;  5IJ7 E;  4BUJ C;  3A0F A;  4PBY A;  3SN6 B;  3NVN A;  5EML B;  1GOH A;  5FKR A;  4BCD A;  3KRW B;  5EAM A;  5CYK A;  4JD2 C;  2YB8 B;  2YMU A;  4QQE A;  3JRO A;  4CY3 A;  4N14 A; 
#chains in the Genus database with same CATH homology
 5IGQ A;  3JRP A;  3HFQ A;  4J73 A;  5AMS A;  5H1M A;  3F3G A;  3OW8 A;  5HQG A;  3UVK A;  2HXC A;  1JMX B;  4J84 A;  4CI1 A;  4CZV A;  3W15 A;  1JOF A;  2I0T A;  3FGB A;  4JXM A;  1MG3 A;  4J79 A;  2H14 A;  2H68 A;  1SQ9 A;  3EWE A;  2OK4 A;  2Z2P A;  2OIZ A;  4BL0 A;  5CXB B;  2HKM A;  4FB1 D;  3EI3 B;  3C5M A;  4JSN C;  4YVD A;  2UZX B;  3SHF A;  4A0A B;  5CXB A;  3DXM C;  3DWL C;  5K19 A;  4XYI A;  2I3T A;  4A0B A;  1N6D A;  4ZOX A;  4FA4 D;  3UVO A;  2OK6 A;  3PSC B;  2PM9 B;  3FM0 A;  4ESG A;  2EBS A;  5AFU 3;  4G56 B;  3AL8 B;  3EI4 A;  2H3X A;  4A7J A;  2PM9 A;  1NEX B;  5TEF A;  4MK0 B;  5TF2 A;  4PXW A;  2H6K A;  3IKO A;  3ODT A;  4E5Z B;  1U2V C;  2AGX A;  3PXS D;  2CE8 A;  5GXI A;  2P9N C;  3GRE A;  1S4U X;  2Z2N A;  1P22 A;  4GGC A;  3IJ1 A;  4CI2 A;  4D6V A;  2IUQ A;  4JT6 C;  3RN1 D;  3JPX A;  4E54 B;  1FWX A;  5IJ8 E;  4CC9 A;  4E54 A;  3MZL A;  3JZG A;  3BWS A;  1N6F A;  5FKS A;  3FRX A;  4I79 A;  3K26 A;  3PXT D;  2AGZ A;  2OJY A;  4CY1 A;  2IUR A;  2CO0 C;  3I7N A;  2H9N A;  5FKQ A;  4HDJ A;  3OKY A;  4OZU A;  1OMW B;  3PVU B;  3IIY A;  4JSV C;  1QNI A;  4J82 A;  3UVL A;  2CE9 A;  5C2V B;  5GXH A;  3RRM C;  4FAN D;  3L4M D;  5SXM A;  5A2Q g;  2B5M A;  2AH1 A;  4QRJ A;  5CXC B;  5EAR A;  3N0E A;  1PEV A;  5EMJ B;  3RFG A;  5CXC A;  4U7A A;  2IUV A;  5H17 A;  4L3H D;  2H47 A;  2BCJ B;  3E0C A;  4PNK B;  4A08 A;  4CZX A;  4X61 B;  3VH0 A;  4H5J A;  2TRC B;  1OLZ A;  4GM9 A;  2H6Q A;  5THA A;  5I5M A;  4A11 A;  1U4C A;  3JZN A;  3OKW A;  2PM7 B;  3SLE D;  2J57 G;  3PE7 A;  4FAV D;  1RI6 A;  3OL2 A;  5CYK B;  3UKR C;  5IC7 A;  2Q7Q A;  3CFV A;  1B9Y A;  1XKS A;  2GNQ A;  3GFC A;  2H13 A;  2H9M A;  5EMK B;  3RSE C;  5GSA A;  1MG2 A;  3DM0 A;  4OWR A;  4J87 A;  4GGA A;  3C99 A;  3SVW D;  3C75 H;  4JT5 C;  2G99 A;  3MZK A;  1VYH C;  4GMB A;  4CY5 A;  2J55 H;  4CY2 A;  4GZ8 A;  2AH0 A;  5FXY A;  4CI3 A;  3IJ0 A;  5EMM B;  3SJL D;  3EI2 A;  5C9Z B;  4A09 A;  4A0B B;  5IT9 g;  3EI1 A;  3EI4 B;  3EU7 A;  2Z2O A;  5TDH B;  4NSX A;  1JMZ B;  4A2L A;  3V9F A;  3DXK C;  5EM2 A;  3UVN A;  1A0R B;  3RN0 D;  4PSW B;  2OVR B;  3AL9 A;  3J80 g;  2CNX A;  2P9U C;  4O1Q D;  4L3G D;  4R7A B;  4ES0 A;  4EWR A;  4AOW A;  1TYQ C;  2XU7 A;  3MKS B;  4O3U B;  2BBK H;  2QC5 A;  4Z8L A;  5C2W B;  4ERY A;  3B7F A;  1B9X A;  2IWF A;  2IWK A;  3SBR A;  3UVM A;  3SFZ A;  1Q47 A;  3F3F A;  5GMK n;  3IJC A;  1R5M A;  3OKY B;  3SCY A;  2H9P A;  3F3P A;  2AGW A;  3BG1 A;  4J0X A;  4AEZ A;  4Y7R A;  4UI9 R;  2CN3 A;  2OVQ B;  3PSL A;  2O9K A;  4QT8 A;  4XYH A;  3I7K A;  4D0K A;  5JWZ A;  2HES X;  3IIW A;  3I7L A;  4GQ2 P;  1YFQ A;  5H14 A;  1N6E A;  4J0W A;  3JAM g;  1MDA H;  3MMY A;  3SMR A;  4FA9 D;  4ZN4 A;  2QXV A;  4U1E I;  3AFC A;  5B4W A;  2B5L A;  4A08 B;  3OKT A;  4L9O A;  2P9L C;  4Y5R D;  5HE1 B;  3C9C A;  2YNP A;  3I7O A;  3NVX A;  1XHM A;  3NVQ A;  5FQD A;  4H5I A;  2G9A A;  4A11 B;  1ERJ A;  2PBI B;  3V7D B;  3U4Y A;  4ERQ A;  4JSX C;  2IAA A;  4L1Q D;  3RFH A;  3ULE C;  3AH8 B;  3OL2 B;  5EAP A;  2XYI A;  4GQ1 A;  4O9D A;  4CI8 A;  3N0D A;  5AJA A;  4FA5 D;  1GG2 B;  4PC0 A;  1PBY B;  2P9P C;  3PXW D;  2HJB A;  3L4O D;  5FKT A;  1K32 A;  4FHL A;  1L0Q A;  3I89 A;  2H6N A;  4J81 A;  3SWS D;  4J86 A;  2J56 H;  3J81 g;  4GQB B;  5HE3 B;  2CN2 A;  4J77 A;  2YBA A;  4QL1 A;  4J78 A;  4FWW A;  3SBQ A;  3EI2 B;  3ZWL B;  2I0S A;  4IMM A;  5K1C C;  4A09 B;  1PGU A;  2YNO A;  2AGY A;  3RLM D;  2OVP B;  4JSP C;  3EG6 A;  2P9K C;  3EI1 B;  4GGD A;  4J8G A;  3JZH A;  3CFS B;  5EAL A;  2XL3 A;  4IA9 A;  3RMZ D;  2GC4 A;  2I3S A;  1NR0 A;  5EM2 B;  4J8B A;  3EMH A;  3UR4 A;  3P4F A;  2UZY B;  4KFM B;  2P9S C;  3MKQ A;  3UKU C;  4GM3 A;  5I5I A;  3EI3 A;  4A0A A;  3JB9 L;  4ZOZ A;  2IUP A;  4X60 B;  3I2N A;  5HYN B;  1SQJ A;  3AL8 A;  5HE2 B;  4A2M A;  4O45 A;  3CIK B;  2W18 A;  4E5Z A;  2YNN A;  4FA1 D;  4X63 B;  3K27 A;  5HE0 B;  2B4E A;  5IGO A;  2I0R A;  4TZ4 A;  4PSX B;  3VA6 A;  1GP2 B;  4CZY A;  1PI6 A;  2P9I C;  3PVW B;  4LGN A;  4XEI C;  3DSM A;  2XL2 A;  1GOT B;  1K8K C;  1TBG A;  2GC7 A;  5FA5 B;  4GM8 A;  4LG9 A;  4PBZ A;  3SXT D;  5TEE A;  2PM6 B;  2MTA H;  4ERZ A;  4ZOV A;  4LG8 A;  2AGL A;  3I7P A;  3MXX A;  3ORV D;  1SHY B;  2CO0 A;  3OTT A;  5I5J A;  3SBP A;  2HKR A;  4BH6 A;  3BG0 A;  2H9L A;  4K3J B;  4O3T B;  4ZOY A;  3I8C A;  1XIP A;  3KRX B;  2HYE A;  3I7H A;  1GXR A;  1JJU B;  2B5N A;  2HJ4 A;  5KDO B;  3I8E A;  2AQ5 A;  3V5W B;  4X3E A;  5FLX g;  3VGZ A;  4K3I D;  5IJ7 E;  4BUJ C;  3A0F A;  4PBY A;  3SN6 B;  3NVN A;  5EML B;  5FKR A;  3KRW B;  5EAM A;  5CYK A;  4JD2 C;  2YB8 B;  2YMU A;  4QQE A;  3JRO A;  4CY3 A;  4N14 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...