3GC3B

Crystal structure of arrestin2s and clathrin
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
354
structure length
349
Chain Sequence
QILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKGAQVVIIDMNDPSNPIRRPISADSAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMTDDVTFWKWISLNTVALVTDNAVYHWSMEGESQPVKMFDRHSSLAGCQIINYRTDAKQKWLLLTGISAQRVVGAMQLYSVDRKVSQPIEGHAASFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTGNQPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISGETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITNVLQNPDLALRMAVRNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endocytosis
molecule keywords Beta-arrestin-1
publication title Structure of an arrestin2-clathrin complex reveals a novel clathrin binding domain that modulates receptor trafficking.
pubmed doi rcsb
source organism Bos taurus
total genus 86
structure length 349
sequence length 354
ec nomenclature
pdb deposition date 2009-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01394 Clathrin_propel Clathrin propeller repeat
B PF09268 Clathrin-link Clathrin, heavy-chain linker
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.110 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Clathrin heavy-chain terminal domain 3gc3B00
5M5TA 1C9LA 5M5RA 1C9IA 5M5VA 3GD1I 5M5UA 2XZGA 3GC3B 5M5SA 5M61A 1BPOA 4G55A 1UTCA
chains in the Genus database with same CATH superfamily
2GNQA 3ZE2A 2VDLA 2QC5A 1U2VC 3PVWB 2QR5A 4L9OA 1UOOA 4WJKA 2IWKA 4J87A 5C2VB 3UVOA 4J0XA 4FHLA 4ZOVA 4QQEA 1N6EA 3IKOA 2YB8B 1O6FA 2XL3A 3SCYA 4GMBA 5E6UA 5CXCA 3O4IA 4GGAA 3SJLD 4CY5A 4ZOYA 5M5TA 4K3ID 3VH0A 4CC9A 3A0FA 4H5IA 4JSNC 1JTDB 4J82A 3E0CA 3EQ8A 4NBMA 3SN6B 1GXRA 1N6FA 4A08A 3NVNA 3V9FA 3IULA 2OVPB 2OJYA 3MUNA 3CFVA 1XIPA 3IJCA 4JT5C 4L1MA 4O3TB 1VZ2A 3I7KA 3IUMA 3ZE0A 2HU7A 5SXMA 3BG1A 4OZUA 4QRJA 3AL8B 5CXBA 1A12A 4ES0A 5GMKn 4LG8A 4TZ4A 5TEFA 4E5ZB 3IIYA 4J8GA 5EMMB 4PBYA 1PGUA 2W18A 4O9DA 4AEZA 2H9LA 3N0EA 5A2Qg 2AGWA 4U1EI 4WK2A 4BCDA 3MKQA 3EI2A 4CY3A 3VI3A 4E54B 1GOFA 1OMWB 2XZGA 1L5GA 3FCSA 4ERZA 4AMZA 3RFGA 1QFSA 3EMHA 3HFQA 1I2MB 2Z2OA 4A11B 2VDMA 4X60B 2HJ4A 4A0BB 3ZDZA 3KCIA 3I8CA 4L1QD 2YNNA 5H1MA 1UTCA 2H9NA 2O9KA 5M5RA 5GSAA 2EIEA 3NVXA 2H13A 3OL2B 3MZKA 5FKSA 2CN3A 2J55H 4FWWA 4DNUA 4G1EA 4JXMA 2CO0C 4AN0A 4FAVD 3C9CA 3EU7A 2AGXA 3OKTA 5I5MA 5TDHB 2YMUA 4IRZA 2MTAH 3UKRC 3SLED 5HDBA 3UR4A 2P9KC 5HE0B 4BL0A 4A7JA 1L0QA 2AGZA 4Z7NA 3EQ9A 4MK0B 2G9AA 1TYEA 4XYIA 5FFGA 4AMYA 2OVQB 3DWLC 4ERQA 4RE5A 5E6SA 4A2MA 3OW8A 4PBZA 1A0RB 4H5JA 3RN0D 3EI4A 4ZN4A 3SMRA 4G55A 1R5MA 5K1CC 5C92A 4IA9A 3GC3B 3C75H 2AQ5A 4J81A 3DM0A 2P9SC 4MMXA 2HU8A 4MMYA 4DNWA 4JHPC 2H9PA 3O4GA 3UVMA 3CFSB 3OKWA 4BP9A 2H9MA 1SQ9A 3MMYA 1MG2A 3AH8B 4QL1A 4FA9D 3L4OD 4O2WA 3DDUA 5EARA 3MZLA 5CXCB 3B7FA 4RE6A 1C9IA 4QT8A 1PEVA 1E8NA 4O45A 4UM8A 2OVRB 1JMXB 1C9LA 2IUQA 4GGDA 3PSCB 2PM9A 2I3SA 1H2WA 4O1QD 4Y5RD 2Z2PA 4A08B 4X61B 3VA6A 2BCJB 2BBKH 3W15A 3C5MA 2B5LA 2I0RA 4A09A 4NSXA 4Z8LA 1RI6A 3UVNA 4GQBB 4A2LA 5I5JA 4GGCA 5E6RA 3K27A 4JD2C 5CXBB 3OKYB 3U4YA 3QI0A 1H2ZA 3I2NA 3JRPA 3DSMA 4NC4A 1M1XA 2CNXA 2I0SA 4CI8A 4AOWA 3UVLA 3L4MD 4BCBA 3GD1I 3F3FA 3O4JA 4UM9A 1B9YA 3MKSB 4BCCA 5TEEA 4HDJA 2CE8A 3EI2B 3ZDYA 3RFHA 3V7DB 3VI4A 1S4UX 2HESX 2YBAA 2OK6A 4PSWB 3ZWLB 3OKYA 2GC4A 3AL9A 3PSLA 4KFMB 3C99A 3EI3A 4FA5D 2HKRA 4JSVC 3SBQA 4J77A 2XDWA 2VDNA 3OTTA 3K71A 2P9UC 1PBYB 4NAAA 1GOTB 4J73A 4J79A 4LG9A 4Z7QA 2I3TA 5FKQA 2IUPA 4O3UB 2AGYA 1YR2A 3JB9L 2HJBA 2VZ1A 4JSXC 3RRMC 2H3XA 2OIZA 4WK0A 5C9ZB 5M5UA 3NIDA 1PI6A 4QAMA 3EWEA 3SXTD 2VDOA 3GREA 2XL2A 3I7NA 2H47A 4FA4D 2H6QA 5IJ7E 1XHMA 1UOQA 1FWXA 1E5TA 4N14A 5IC7A 1ERJA 3IIWA 1Q47A 4BUJC 3KRXB 4K3JB 5CYKB 4IMMA 2IURA 4PXWA 2H6NA 5HE2B 2VDQA 5AJAA 3ULEC 1YFQA 3QHYB 4PSXB 2PM7B 5K19A 3EI4B 4CZYA 5M61A 5FQDA 2B4EA 1QNIA 2AH0A 2CO0A 5THAA 2EIBA 3EI1A 2XU7A 2CN2A 1K32A 5CYKA 3UKUC 3PE7A 2H6KA 2P9IC 2VDRA 3MUOA 2IWFA 4GQ1A 4NENA 3J81g 4EWRA 3NVQA 4FB1D 3MXXA 2BKLA 5B4WA 4ESGA 2UZYB 3PXTD 4A0AB 5EMJB 4AN1A 2PBIB 5EAMA 3SWSD 2PM9B 1TBGA 1JJUB 5HYNB 2Z2NA 2AH1A 3SBPA 3MVDK 2HU5A 4JSPC 3SBRA 1TYQC 4FA1D 5AFU3 4A09B 4J78A 4CI3A 3T3MA 4L3HD 2EIDA 2VZ3A 1GP2B 3EQ7A 3GFCA 5JWZA 3PVUB 2H68A 4A0AA 2B5NA 3PXWD 2VDKA 3K72A 2P9LC 4FAND 1GOHA 1U4CA 3BG0A 1VYHC 3JAMg 4GQ2P 5EM2A 5TF2A 3CIKB 3SVWD 1O6GA 1E8MA 3JZGA 5EALA 4CZVA 1NEXB 1VE7A 1K3IA 4J86A 4R7AB 3EI3B 5EMLB 1JOFA 5FLXg 5HE3B 3EG6A 4XYHA 5H17A 1OLZA 3PXSD 4AX4A 2HKMA 2QXVA 5I5IA 3JROA 4ERYA 3IVMA 5GXHA 3AFCA 2JKXA 3I7HA 5GXIA 4XEIC 2P9PC 3K26A 3ODTA 4LGNA 3V4VA 3VGZA 3UVKA 2VC2A 5IGOA 1K8KC 3RN1D 3J80g 1T2XA 1VZ3A 1U8CA 3FRXA 2UZXB 3I7PA 5EMKB 4JT6C 4Y7RA 2PM6B 4YVDA 5H14A 3ZE1A 4D0KA 4CZXA 4ZOZA 3RLMD 4CY2A 3I89A 3V4PA 3I7OA 3NIFA 4J84A 4O02A 3IJ1A 3JZHA 3NIGA 4BP8A 3IUNA 3JPXA 2J56H 5IGQA 5KDOB 4G56B 5FKRA 2G99A 3IUQA 4GM8A 2YNOA 1MG3A 5IT9g 3EI1B 1H2XA 2HXCA 1JV2A 3I7LA 4I79A 5HE1B 1JMZB 5EAPA 3V5WB 4MMZA 3JZNA 2QZPA 4GM3A 1H2YA 2HYEA 4X63B 3AL8A 3ZDXA 4E5ZA 4X3EA 5C2WB 2P9NC 3N0DA 4J8BA 4CI2A 1SHYB 4G1MA 3FM0A 3FGBA 5FA5B 5AMSA 4JHNA 2IAAA 2J57G 4D9SA 5IJ8E 2WQ8A 4E54A 2GC7A 4WK4A 2XYIA 4L3GD 3RMZD 3IJ0A 1MDAH 2CE9A 5HQGA 4GZ8A 4D6VA 4J0WA 3I8EA 3SFZA 3ORVD 4GM9A 5FKTA 4A11A 2VDPA 4PNKB 4A0BA 3K6SA 1XKSA 1NR0A 4CY1A 3FCUA 3BWSA 3OL2A 3T3PA 4BH6A 2I0TA 5EM2B 3DXKC 1GOGA 5C86A 3OF7A 3IJEA 2Q7QA 1BPOA 2B5MA 3O4HA 4CI1A 2IUVA 1UOPA 3DXMC 2XE4A 5FXYA 1P22A 5FFOA 4Z7OA 2YNPA 4UI9R 3SHFA 5M5SA 1GG2B 3F3PA 2EBSA 4U7AA 4ZOXA 1N6DA 4PC0A 3RSEC 5M5VA 4OWRA 3KRWB 2TRCB 3IUJA 3F3GA 1VE6A 1QFMA 3IURA 2AGLA 2H14A 2EICA 3P4FA 4DNVA 1B9XA 1SQJA 2OK4A
chains in the Genus database with same CATH topology
5M5TA 1C9LA 5M5RA 1C9IA 5M5VA 3GD1I 5M5UA 2XZGA 3GC3B 5M5SA 5M61A 1BPOA 4G55A 1UTCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5M5T A;  1C9L A;  5M5R A;  1C9I A;  5M5V A;  3GD1 I;  5M5U A;  2XZG A;  3GC3 B;  5M5S A;  5M61 A;  1BPO A;  4G55 A;  1UTC A; 
#chains in the Genus database with same CATH topology
 2GNQ A;  3ZE2 A;  2VDL A;  2QC5 A;  1U2V C;  3PVW B;  2QR5 A;  4L9O A;  1UOO A;  4WJK A;  2IWK A;  4J87 A;  5C2V B;  3UVO A;  4J0X A;  4FHL A;  4ZOV A;  4QQE A;  1N6E A;  3IKO A;  2YB8 B;  1O6F A;  2XL3 A;  3SCY A;  4GMB A;  5E6U A;  5CXC A;  3O4I A;  4GGA A;  3SJL D;  4CY5 A;  4ZOY A;  5M5T A;  4K3I D;  3VH0 A;  4CC9 A;  3A0F A;  4H5I A;  4JSN C;  1JTD B;  4J82 A;  3E0C A;  3EQ8 A;  4NBM A;  3SN6 B;  1GXR A;  1N6F A;  4A08 A;  3NVN A;  3V9F A;  3IUL A;  2OVP B;  2OJY A;  3MUN A;  3CFV A;  1XIP A;  3IJC A;  4JT5 C;  4L1M A;  4O3T B;  1VZ2 A;  3I7K A;  3IUM A;  3ZE0 A;  2HU7 A;  5SXM A;  3BG1 A;  4OZU A;  4QRJ A;  3AL8 B;  5CXB A;  1A12 A;  4ES0 A;  5GMK n;  4LG8 A;  4TZ4 A;  5TEF A;  4E5Z B;  3IIY A;  4J8G A;  5EMM B;  4PBY A;  1PGU A;  2W18 A;  4O9D A;  4AEZ A;  2H9L A;  3N0E A;  5A2Q g;  2AGW A;  4U1E I;  4WK2 A;  4BCD A;  3MKQ A;  3EI2 A;  4CY3 A;  3VI3 A;  4E54 B;  1GOF A;  1OMW B;  2XZG A;  1L5G A;  3FCS A;  4ERZ A;  4AMZ A;  3RFG A;  1QFS A;  3EMH A;  3HFQ A;  1I2M B;  2Z2O A;  4A11 B;  2VDM A;  4X60 B;  2HJ4 A;  4A0B B;  3ZDZ A;  3KCI A;  3I8C A;  4L1Q D;  2YNN A;  5H1M A;  1UTC A;  2H9N A;  2O9K A;  5M5R A;  5GSA A;  2EIE A;  3NVX A;  2H13 A;  3OL2 B;  3MZK A;  5FKS A;  2CN3 A;  2J55 H;  4FWW A;  4DNU A;  4G1E A;  4JXM A;  2CO0 C;  4AN0 A;  4FAV D;  3C9C A;  3EU7 A;  2AGX A;  3OKT A;  5I5M A;  5TDH B;  2YMU A;  4IRZ A;  2MTA H;  3UKR C;  3SLE D;  5HDB A;  3UR4 A;  2P9K C;  5HE0 B;  4BL0 A;  4A7J A;  1L0Q A;  2AGZ A;  4Z7N A;  3EQ9 A;  4MK0 B;  2G9A A;  1TYE A;  4XYI A;  5FFG A;  4AMY A;  2OVQ B;  3DWL C;  4ERQ A;  4RE5 A;  5E6S A;  4A2M A;  3OW8 A;  4PBZ A;  1A0R B;  4H5J A;  3RN0 D;  3EI4 A;  4ZN4 A;  3SMR A;  4G55 A;  1R5M A;  5K1C C;  5C92 A;  4IA9 A;  3GC3 B;  3C75 H;  2AQ5 A;  4J81 A;  3DM0 A;  2P9S C;  4MMX A;  2HU8 A;  4MMY A;  4DNW A;  4JHP C;  2H9P A;  3O4G A;  3UVM A;  3CFS B;  3OKW A;  4BP9 A;  2H9M A;  1SQ9 A;  3MMY A;  1MG2 A;  3AH8 B;  4QL1 A;  4FA9 D;  3L4O D;  4O2W A;  3DDU A;  5EAR A;  3MZL A;  5CXC B;  3B7F A;  4RE6 A;  1C9I A;  4QT8 A;  1PEV A;  1E8N A;  4O45 A;  4UM8 A;  2OVR B;  1JMX B;  1C9L A;  2IUQ A;  4GGD A;  3PSC B;  2PM9 A;  2I3S A;  1H2W A;  4O1Q D;  4Y5R D;  2Z2P A;  4A08 B;  4X61 B;  3VA6 A;  2BCJ B;  2BBK H;  3W15 A;  3C5M A;  2B5L A;  2I0R A;  4A09 A;  4NSX A;  4Z8L A;  1RI6 A;  3UVN A;  4GQB B;  4A2L A;  5I5J A;  4GGC A;  5E6R A;  3K27 A;  4JD2 C;  5CXB B;  3OKY B;  3U4Y A;  3QI0 A;  1H2Z A;  3I2N A;  3JRP A;  3DSM A;  4NC4 A;  1M1X A;  2CNX A;  2I0S A;  4CI8 A;  4AOW A;  3UVL A;  3L4M D;  4BCB A;  3GD1 I;  3F3F A;  3O4J A;  4UM9 A;  1B9Y A;  3MKS B;  4BCC A;  5TEE A;  4HDJ A;  2CE8 A;  3EI2 B;  3ZDY A;  3RFH A;  3V7D B;  3VI4 A;  1S4U X;  2HES X;  2YBA A;  2OK6 A;  4PSW B;  3ZWL B;  3OKY A;  2GC4 A;  3AL9 A;  3PSL A;  4KFM B;  3C99 A;  3EI3 A;  4FA5 D;  2HKR A;  4JSV C;  3SBQ A;  4J77 A;  2XDW A;  2VDN A;  3OTT A;  3K71 A;  2P9U C;  1PBY B;  4NAA A;  1GOT B;  4J73 A;  4J79 A;  4LG9 A;  4Z7Q A;  2I3T A;  5FKQ A;  2IUP A;  4O3U B;  2AGY A;  1YR2 A;  3JB9 L;  2HJB A;  2VZ1 A;  4JSX C;  3RRM C;  2H3X A;  2OIZ A;  4WK0 A;  5C9Z B;  5M5U A;  3NID A;  1PI6 A;  4QAM A;  3EWE A;  3SXT D;  2VDO A;  3GRE A;  2XL2 A;  3I7N A;  2H47 A;  4FA4 D;  2H6Q A;  5IJ7 E;  1XHM A;  1UOQ A;  1FWX A;  1E5T A;  4N14 A;  5IC7 A;  1ERJ A;  3IIW A;  1Q47 A;  4BUJ C;  3KRX B;  4K3J B;  5CYK B;  4IMM A;  2IUR A;  4PXW A;  2H6N A;  5HE2 B;  2VDQ A;  5AJA A;  3ULE C;  1YFQ A;  3QHY B;  4PSX B;  2PM7 B;  5K19 A;  3EI4 B;  4CZY A;  5M61 A;  5FQD A;  2B4E A;  1QNI A;  2AH0 A;  2CO0 A;  5THA A;  2EIB A;  3EI1 A;  2XU7 A;  2CN2 A;  1K32 A;  5CYK A;  3UKU C;  3PE7 A;  2H6K A;  2P9I C;  2VDR A;  3MUO A;  2IWF A;  4GQ1 A;  4NEN A;  3J81 g;  4EWR A;  3NVQ A;  4FB1 D;  3MXX A;  2BKL A;  5B4W A;  4ESG A;  2UZY B;  3PXT D;  4A0A B;  5EMJ B;  4AN1 A;  2PBI B;  5EAM A;  3SWS D;  2PM9 B;  1TBG A;  1JJU B;  5HYN B;  2Z2N A;  2AH1 A;  3SBP A;  3MVD K;  2HU5 A;  4JSP C;  3SBR A;  1TYQ C;  4FA1 D;  5AFU 3;  4A09 B;  4J78 A;  4CI3 A;  3T3M A;  4L3H D;  2EID A;  2VZ3 A;  1GP2 B;  3EQ7 A;  3GFC A;  5JWZ A;  3PVU B;  2H68 A;  4A0A A;  2B5N A;  3PXW D;  2VDK A;  3K72 A;  2P9L C;  4FAN D;  1GOH A;  1U4C A;  3BG0 A;  1VYH C;  3JAM g;  4GQ2 P;  5EM2 A;  5TF2 A;  3CIK B;  3SVW D;  1O6G A;  1E8M A;  3JZG A;  5EAL A;  4CZV A;  1NEX B;  1VE7 A;  1K3I A;  4J86 A;  4R7A B;  3EI3 B;  5EML B;  1JOF A;  5FLX g;  5HE3 B;  3EG6 A;  4XYH A;  5H17 A;  1OLZ A;  3PXS D;  4AX4 A;  2HKM A;  2QXV A;  5I5I A;  3JRO A;  4ERY A;  3IVM A;  5GXH A;  3AFC A;  2JKX A;  3I7H A;  5GXI A;  4XEI C;  2P9P C;  3K26 A;  3ODT A;  4LGN A;  3V4V A;  3VGZ A;  3UVK A;  2VC2 A;  5IGO A;  1K8K C;  3RN1 D;  3J80 g;  1T2X A;  1VZ3 A;  1U8C A;  3FRX A;  2UZX B;  3I7P A;  5EMK B;  4JT6 C;  4Y7R A;  2PM6 B;  4YVD A;  5H14 A;  3ZE1 A;  4D0K A;  4CZX A;  4ZOZ A;  3RLM D;  4CY2 A;  3I89 A;  3V4P A;  3I7O A;  3NIF A;  4J84 A;  4O02 A;  3IJ1 A;  3JZH A;  3NIG A;  4BP8 A;  3IUN A;  3JPX A;  2J56 H;  5IGQ A;  5KDO B;  4G56 B;  5FKR A;  2G99 A;  3IUQ A;  4GM8 A;  2YNO A;  1MG3 A;  5IT9 g;  3EI1 B;  1H2X A;  2HXC A;  1JV2 A;  3I7L A;  4I79 A;  5HE1 B;  1JMZ B;  5EAP A;  3V5W B;  4MMZ A;  3JZN A;  2QZP A;  4GM3 A;  1H2Y A;  2HYE A;  4X63 B;  3AL8 A;  3ZDX A;  4E5Z A;  4X3E A;  5C2W B;  2P9N C;  3N0D A;  4J8B A;  4CI2 A;  1SHY B;  4G1M A;  3FM0 A;  3FGB A;  5FA5 B;  5AMS A;  4JHN A;  2IAA A;  2J57 G;  4D9S A;  5IJ8 E;  2WQ8 A;  4E54 A;  2GC7 A;  4WK4 A;  2XYI A;  4L3G D;  3RMZ D;  3IJ0 A;  1MDA H;  2CE9 A;  5HQG A;  4GZ8 A;  4D6V A;  4J0W A;  3I8E A;  3SFZ A;  3ORV D;  4GM9 A;  5FKT A;  4A11 A;  2VDP A;  4PNK B;  4A0B A;  3K6S A;  1XKS A;  1NR0 A;  4CY1 A;  3FCU A;  3BWS A;  3OL2 A;  3T3P A;  4BH6 A;  2I0T A;  5EM2 B;  3DXK C;  1GOG A;  5C86 A;  3OF7 A;  3IJE A;  2Q7Q A;  1BPO A;  2B5M A;  3O4H A;  4CI1 A;  2IUV A;  1UOP A;  3DXM C;  2XE4 A;  5FXY A;  1P22 A;  5FFO A;  4Z7O A;  2YNP A;  4UI9 R;  3SHF A;  5M5S A;  1GG2 B;  3F3P A;  2EBS A;  4U7A A;  4ZOX A;  1N6D A;  4PC0 A;  3RSE C;  5M5V A;  4OWR A;  3KRW B;  2TRC B;  3IUJ A;  3F3G A;  1VE6 A;  1QFM A;  3IUR A;  2AGL A;  2H14 A;  2EIC A;  3P4F A;  4DNV A;  1B9X A;  1SQJ A;  2OK4 A; 
#chains in the Genus database with same CATH homology
 5M5T A;  1C9L A;  5M5R A;  1C9I A;  5M5V A;  3GD1 I;  5M5U A;  2XZG A;  3GC3 B;  5M5S A;  5M61 A;  1BPO A;  4G55 A;  1UTC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...