2AH0A

Crystal structure of the carbinolamine intermediate in the reductive half-reaction of aromatic amine dehydrogenase (aadh) with tryptamine. monoclinic form
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
360
structure length
360
Chain Sequence
REVLTGGHSVSAPQENRIYVMDSVFMHLTESRVHVYDYTNGKFLGMVPTAFNGHVQVSNDGKKIYTMTTYHERITRGKRSDVVEVWDADKLTFEKEISLPPKRVQGLNYDGLFRQTTDGKFIVLQNASPATSIGIVDVAKGDYVEDVTAAAGCWSVIPQPNRPRSFMTICGDGGLLTINLGEDGKVASQSRSKQMFSVKDDPIFIAPALDKDKAHFVSYYGNVYSADFSGDEVKVDGPWSLLNDEDKAKNWVPGGYNLVGLHRASGRMYVFMHPDGKEGTHKFPAAEIWVMDTKTKQRVARIPGRDALSMTIDQQRNLMLTLDGGNVNVYDISQPEPKLLRTIEGAAEASLQVQFHPVGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aromatic amine dehydrogenase
publication title Atomic description of an enzyme reaction dominated by proton tunneling
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 95
structure length 360
sequence length 360
chains with identical sequence B
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2005-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2ah0A01
5GXHA 4QT8A 3SHFA 1TYQC 3PVUB 4D0KA 4AEZA 3EI1A 2UZYB 4CY5A 5H17A 2P9PC 3SCYA 2HYEA 4GGDA 2CO0C 5CXCA 2H9NA 1OLZA 5C2VB 4OWRA 3V9FA 2YBAA 1XIPA 4GGCA 3UKRC 2IWKA 2O9KA 3C75H 4Y7RA 3EMHA 4AOWA 4ERZA 5TDHB 2B4EA 4FAVD 2AGLA 2H9PA 4JD2C 4J8GA 5I5IA 4J81A 4N14A 5EMJB 4O3TB 3DXKC 1YFQA 5TEEA 3F3FA 4PNKB 4A09B 5C2WB 1N6FA 3L4OD 5AMSA 3SN6B 2W18A 4PBYA 4CZYA 4CI8A 5IJ7E 2I0SA 4GM3A 3RN0D 5EM2A 3IJ0A 3KRXB 3OKTA 4GZ8A 4LGNA 3SVWD 4FAND 3I89A 2HKRA 1PEVA 3RN1D 1PBYB 1GG2B 4ES0A 3IJ1A 2TRCB 1GXRA 5AFU3 3EI3B 4A0BA 4FB1D 3N0EA 2OVQB 3DM0A 4PXWA 3OKWA 4JT5C 5HYNB 4X60B 2P9UC 3SBPA 3EI2B 3EI4A 3V7DB 2OJYA 2GNQA 5HE1B 4XYIA 3MXXA 2IUVA 3AL9A 1JMZB 2B5MA 2HJBA 3KRWB 3C99A 4PBZA 3AL8A 5CXBA 3BG0A 3EWEA 4GMBA 4Y5RD 3PSCB 4GQ1A 2IUPA 4A2MA 4LG8A 4G56B 3OTTA 3PXTD 1SQJA 5CXCB 2HESX 1XKSA 3SBRA 5JWZA 2I0RA 2CN2A 1SHYB 5CYKA 3RRMC 4CI1A 2I3SA 1S4UX 1TBGA 2AGXA 2OK4A 2CN3A 3I8CA 5EAPA 3MZLA 1K32A 2G99A 3DSMA 5GMKn 5K19A 4J77A 2Z2PA 1R5MA 3PVWB 4J0XA 5FA5B 3RLMD 3PSLA 5GXIA 3UVOA 3JB9L 4MK0B 4ERQA 3IKOA 3BG1A 3RSEC 5EM2B 5KDOB 3C9CA 3FRXA 4CY1A 5TEFA 4FA5D 2IAAA 1B9XA 2YNNA 4JSNC 3ZWLB 4KFMB 5B4WA 5THAA 1L0QA 3JZNA 3I2NA 2CNXA 2PM9A 2QC5A 4FA9D 4A11A 3AFCA 3I7OA 4A0BB 4J82A 1RI6A 3ODTA 5K1CC 2J57G 4EWRA 3A0FA 1PGUA 3EI4B 4L9OA 4I79A 3W15A 3UVNA 4D6VA 4E54A 2H9LA 5HE3B 3ORVD 5EMKB 2HKMA 2H68A 5CXBB 5EMMB 2YB8B 3JRPA 3OL2A 1Q47A 3JZHA 3EU7A 5I5MA 1FWXA 2HJ4A 5EALA 4E5ZA 4TZ4A 1XHMA 4CY2A 4ESGA 4GGAA 3JPXA 5EARA 1MDAH 5CYKB 5EAMA 4ERYA 2PM6B 3N0DA 2H47A 1OMWB 1B9YA 3IJCA 2OVPB 2H6NA 2H13A 2Z2OA 3MZKA 4GM9A 3I7KA 1GOTB 2AH1A 3F3PA 5IT9g 5H14A 1QNIA 5TF2A 2PM7B 2B5NA 2I3TA 3SBQA 4YVDA 4CI3A 4ZN4A 3GFCA 1NEXB 2H6KA 2BCJB 2XL2A 3UVMA 4J87A 5HE0B 3EI1B 4FA1D 2P9KC 4J84A 4IMMA 4R7AB 4CY3A 4PSXB 2P9IC 3CIKB 2J56H 5IC7A 3I7PA 4FHLA 3B7FA 2UZXB 3V5WB 3NVXA 3AH8B 3SJLD 2PM9B 4J86A 4H5JA 2AQ5A 3NVNA 2AGWA 5IJ8E 4A11B 2P9LC 2CO0A 3CFVA 2H14A 1VYHC 3MKQA 2P9NC 2I0TA 2IWFA 3PXSD 4BH6A 2OIZA 4U1EI 3OKYA 3F3GA 4PSWB 1N6DA 4L1QD 4JSPC 4U7AA 4A0AA 1GP2B 4O3UB 2MTAH 2Q7QA 2H3XA 2EBSA 3EI2A 4E54B 2H6QA 1N6EA 4PC0A 2BBKH 3SMRA 1A0RB 5GSAA 4CZXA 4J8BA 4O9DA 4FA4D 2H9MA 2GC7A 5HQGA 5FQDA 4CC9A 2IURA 5IGQA 3OW8A 4E5ZB 3UVLA 4Z8LA 2QXVA 3CFSB 2G9AA 3EG6A 2XU7A 4UI9R 2AGYA 4XEIC 4LG9A 3FGBA 4IA9A 3RMZD 5H1MA 2J55H 3SWSD 3I7LA 3MMYA 3SXTD 2GC4A 3C5MA 4L3HD 4ZOYA 1P22A 3U4YA 2YMUA 4K3JB 1U4CA 4O45A 1ERJA 4A08A 3ULEC 1K8KC 4J78A 2Z2NA 3AL8B 4A2LA 3IIYA 4X61B 3E0CA 4ZOVA 2YNOA 4GQBB 4J0WA 2HXCA 3UKUC 2OK6A 4J73A 3VGZA 3VH0A 4GQ2P 5HE2B 3HFQA 3J81g 4X3EA 5A2Qg 4FWWA 3IIWA 2AGZA 1JOFA 3RFHA 2XYIA 4HDJA 3JAMg 3PE7A 5IGOA 3JZGA 4QRJA 3DWLC 3OKYB 4J79A 2CE8A 4ZOXA 1JJUB 4O1QD 1NR0A 3K27A 2OVRB 5C9ZB 4A0AB 3J80g 1JMXB 2B5LA 2YNPA 3P4FA 4JT6C 5FKTA 3UR4A 4ZOZA 4JXMA 3BWSA 4A09A 2AH0A 3NVQA 4XYHA 3FM0A 5FKRA 4OZUA 2CE9A 5FXYA 2P9SC 5FLXg 4QL1A 3I7HA 1U2VC 5SXMA 3SFZA 3PXWD 3K26A 2PBIB 4GM8A 5AJAA 4X63B 4QQEA 3JROA 4NSXA 3RFGA 4K3ID 4JSXC 2IUQA 5EMLB 4BL0A 5FKQA 3EI3A 4JSVC 3L4MD 4H5IA 3MKSB 5I5JA 4CZVA 4CI2A 4BUJC 3GREA 3I8EA 1SQ9A 1MG3A 3SLED 3DXMC 4L3GD 4A08B 3UVKA 2XL3A 4A7JA 3I7NA 1MG2A 3VA6A 5FKSA 1PI6A 3OL2B
chains in the Genus database with same CATH superfamily
5GXHA 4QT8A 5M61A 3SHFA 1TYQC 3PVUB 4D0KA 2VC2A 2XDWA 4MMYA 3VI4A 4AEZA 3EI1A 3ZDZA 2UZYB 4CY5A 5H17A 2XE4A 2P9PC 4L1MA 4WJKA 3SCYA 2HYEA 4GGDA 2CO0C 5CXCA 2H9NA 1OLZA 5C2VB 4OWRA 3V9FA 2WQ8A 1XIPA 2YBAA 4GGCA 3UKRC 2IWKA 2O9KA 3C75H 4Y7RA 3EMHA 4AOWA 1U8CA 4ERZA 1K3IA 5TDHB 2B4EA 4FAVD 2AGLA 2H9PA 3MVDK 4JD2C 4J8GA 5I5IA 2VDRA 2BKLA 4J81A 1VZ2A 4N14A 5EMJB 4O3TB 3DXKC 1YFQA 5TEEA 3F3FA 4PNKB 4A09B 5C2WB 1N6FA 3L4OD 5AMSA 3SN6B 2W18A 4PBYA 4CZYA 1GOFA 4CI8A 5IJ7E 3QI0A 4UM9A 3FCUA 1O6FA 2I0SA 3IUNA 4GM3A 3RN0D 5EM2A 3IJ0A 3KRXB 3OKTA 4GZ8A 4LGNA 3SVWD 4FAND 3I89A 1JV2A 2HKRA 3O4HA 1PEVA 2EIDA 3RN1D 1PBYB 3IUQA 1GG2B 1QFSA 4ES0A 5M5TA 3IJ1A 2TRCB 1GXRA 5AFU3 3EI3B 4A0BA 4FB1D 3N0EA 2OVQB 2QR5A 2JKXA 3DM0A 4BCDA 4PXWA 3OKWA 4JT5C 5HYNB 4X60B 2P9UC 2VDNA 3SBPA 3EI2B 3EI4A 3V7DB 2OJYA 2GNQA 5HE1B 4XYIA 3MXXA 1H2ZA 4NBMA 2IUVA 3AL9A 3O4GA 3OF7A 1JMZB 2B5MA 2HJBA 3KRWB 3VI3A 3C99A 1TYEA 2VZ1A 2XZGA 3AL8A 4PBZA 5CXBA 1UTCA 3BG0A 3EWEA 4GMBA 2VZ3A 4Y5RD 3PSCB 4GQ1A 2IUPA 4A2MA 4LG8A 4G56B 3K72A 3OTTA 3PXTD 1YR2A 1SQJA 1A12A 5CXCB 2HESX 5M5UA 1XKSA 3SBRA 5JWZA 2I0RA 2CN2A 1SHYB 5CYKA 3RRMC 4CI1A 2I3SA 4DNVA 5E6UA 1S4UX 3ZE1A 1TBGA 2AGXA 2OK4A 2CN3A 3I8CA 5EAPA 3MZLA 1K32A 2G99A 3DSMA 5GMKn 3GD1I 5K19A 3ZE0A 4J77A 2Z2PA 3IUMA 1R5MA 3PVWB 4J0XA 2VDQA 5FA5B 3ZDXA 3T3MA 3RLMD 3PSLA 4MMXA 5GXIA 3EQ9A 3UVOA 1C9LA 3JB9L 4MK0B 4ERQA 3IKOA 4O02A 3BG1A 3RSEC 4WK2A 5EM2B 5KDOB 3C9CA 2EIBA 3FRXA 4CY1A 5TEFA 4FA5D 2IAAA 1B9XA 2YNNA 3MUNA 4JSNC 3ZWLB 4KFMB 5B4WA 5THAA 1L0QA 3JZNA 3I2NA 2CNXA 2PM9A 2QC5A 4FA9D 4D9SA 4A11A 3AFCA 3O4IA 3I7OA 4BCCA 4A0BB 4J82A 1RI6A 3ODTA 5K1CC 2J57G 4O2WA 4EWRA 4G1EA 3NIFA 4MMZA 1UOQA 2VDLA 3A0FA 1PGUA 3EI4B 4L9OA 3NIDA 4I79A 3IJEA 1I2MB 3W15A 3UVNA 4D6VA 4E54A 2H9LA 4Z7OA 5HE3B 3ORVD 4RE6A 5EMKB 2HKMA 2H68A 4Z7NA 5CXBB 3K71A 5EMMB 2YB8B 3JRPA 3OL2A 1Q47A 3JZHA 3EU7A 5I5MA 1FWXA 1QFMA 2HJ4A 5EALA 4E5ZA 4TZ4A 1XHMA 5E6RA 4CY2A 4ESGA 4GGAA 1H2YA 2QZPA 3JPXA 5EARA 1MDAH 5CYKB 5EAMA 4BP9A 2PM6B 4ERYA 3N0DA 2H47A 1OMWB 1B9YA 3IUJA 3KCIA 4AN0A 3IJCA 2OVPB 2H6NA 4RE5A 2H13A 2Z2OA 3MZKA 4Z7QA 3IULA 4GM9A 3I7KA 1GOTB 2AH1A 1M1XA 3F3PA 5IT9g 5H14A 1QNIA 5TF2A 2PM7B 2B5NA 2I3TA 5FFGA 3SBQA 4YVDA 4CI3A 4ZN4A 3V4VA 3GFCA 2HU8A 1NEXB 2H6KA 2BCJB 2XL2A 3UVMA 3O4JA 4J87A 1T2XA 5HE0B 3EI1B 4FA1D 1H2WA 2P9KC 4NAAA 4J84A 1VZ3A 4IMMA 4R7AB 5C92A 1BPOA 3NIGA 4CY3A 4UM8A 4PSXB 2P9IC 1VE6A 1GOGA 3CIKB 2J56H 5IC7A 4G1MA 3I7PA 4FHLA 3B7FA 2UZXB 4DNUA 3V5WB 3FCSA 3NVXA 3AH8B 3SJLD 2PM9B 4J86A 4BCBA 4H5JA 2AQ5A 3NVNA 2AGWA 5IJ8E 4A11B 4BP8A 4AN1A 2P9LC 2EICA 2CO0A 3CFVA 3QHYB 2H14A 3GC3B 1VYHC 3MKQA 2P9NC 2I0TA 2EIEA 3ZE2A 1L5GA 2IWFA 3PXSD 4BH6A 2OIZA 4U1EI 3OKYA 2HU7A 3F3GA 4PSWB 1N6DA 4L1QD 4JSPC 4U7AA 1JTDB 4IRZA 1GP2B 4A0AA 4O3UB 2VDKA 2MTAH 2Q7QA 2H3XA 2EBSA 3EI2A 4E54B 2H6QA 1N6EA 4PC0A 2BBKH 3SMRA 4WK4A 5M5VA 1A0RB 5GSAA 5HDBA 4CZXA 4J8BA 4O9DA 4FA4D 2H9MA 3ZDYA 2GC7A 5HQGA 5FQDA 2HU5A 4CC9A 5M5RA 1E5TA 2VDPA 4JHPC 3K6SA 2IURA 5IGQA 3OW8A 4E5ZB 3UVLA 4Z8LA 2QXVA 3CFSB 2G9AA 3EG6A 2XU7A 4UI9R 2AGYA 4XEIC 4LG9A 3FGBA 4IA9A 3RMZD 1O6GA 5H1MA 3DDUA 2J55H 3SWSD 3I7LA 3MMYA 3SXTD 2GC4A 3C5MA 4L3HD 4ZOYA 1E8MA 1P22A 3T3PA 3U4YA 2YMUA 4K3JB 1U4CA 4O45A 1ERJA 3IURA 5E6SA 4A08A 3ULEC 1K8KC 4J78A 2Z2NA 3AL8B 4A2LA 3IIYA 4X61B 3E0CA 4ZOVA 2YNOA 4QAMA 4GQBB 4J0WA 4WK0A 2HXCA 3UKUC 2OK6A 1UOPA 4J73A 3VGZA 3VH0A 4GQ2P 5HE2B 1E8NA 3HFQA 3EQ7A 3J81g 4X3EA 5A2Qg 1GOHA 4FWWA 3IIWA 2AGZA 1JOFA 3RFHA 2XYIA 1VE7A 4HDJA 3JAMg 3PE7A 5IGOA 3JZGA 4QRJA 3DWLC 3OKYB 4J79A 2CE8A 4ZOXA 1JJUB 4O1QD 5C86A 1NR0A 4AMZA 3K27A 2OVRB 5C9ZB 4A0AB 3J80g 1JMXB 2B5LA 2YNPA 3P4FA 4G55A 4JT6C 5FKTA 3UR4A 4ZOZA 4JXMA 3BWSA 4A09A 2AH0A 3NVQA 4XYHA 3FM0A 5FKRA 4OZUA 5FFOA 2CE9A 5FXYA 2P9SC 3MUOA 5FLXg 4QL1A 3I7HA 1U2VC 5M5SA 1UOOA 5SXMA 1C9IA 3SFZA 3PXWD 4AX4A 3K26A 4AMYA 2PBIB 4GM8A 3V4PA 5AJAA 4NENA 4X63B 2VDOA 4QQEA 3JROA 4NSXA 3RFGA 1H2XA 4K3ID 4JSXC 2IUQA 5EMLB 4BL0A 5FKQA 4JHNA 3EI3A 3EQ8A 4JSVC 3L4MD 4H5IA 3MKSB 4NC4A 5I5JA 4CZVA 4CI2A 4BUJC 3GREA 3I8EA 2VDMA 1SQ9A 1MG3A 3SLED 3DXMC 4L3GD 4A08B 3UVKA 2XL3A 4A7JA 3I7NA 1MG2A 3IVMA 4DNWA 3VA6A 5FKSA 1PI6A 3OL2B
chains in the Genus database with same CATH topology
5GXHA 4QT8A 3SHFA 1TYQC 3PVUB 4D0KA 4AEZA 3EI1A 2UZYB 4CY5A 5H17A 2P9PC 3SCYA 2HYEA 4GGDA 2CO0C 5CXCA 2H9NA 1OLZA 5C2VB 4OWRA 3V9FA 2YBAA 1XIPA 4GGCA 3UKRC 2IWKA 2O9KA 3C75H 4Y7RA 3EMHA 4AOWA 4ERZA 5TDHB 2B4EA 4FAVD 2AGLA 2H9PA 4JD2C 4J8GA 5I5IA 4J81A 4N14A 5EMJB 4O3TB 3DXKC 1YFQA 5TEEA 3F3FA 4PNKB 4A09B 5C2WB 1N6FA 3L4OD 5AMSA 3SN6B 2W18A 4PBYA 4CZYA 4CI8A 5IJ7E 2I0SA 4GM3A 3RN0D 5EM2A 3IJ0A 3KRXB 3OKTA 4GZ8A 4LGNA 3SVWD 4FAND 3I89A 2HKRA 1PEVA 3RN1D 1PBYB 1GG2B 4ES0A 3IJ1A 2TRCB 1GXRA 5AFU3 3EI3B 4A0BA 4FB1D 3N0EA 2OVQB 3DM0A 4PXWA 3OKWA 4JT5C 5HYNB 4X60B 2P9UC 3SBPA 3EI2B 3EI4A 3V7DB 2OJYA 2GNQA 5HE1B 4XYIA 3MXXA 2IUVA 3AL9A 1JMZB 2B5MA 2HJBA 3KRWB 3C99A 4PBZA 3AL8A 5CXBA 3BG0A 3EWEA 4GMBA 4Y5RD 3PSCB 4GQ1A 2IUPA 4A2MA 4LG8A 4G56B 3OTTA 3PXTD 1SQJA 5CXCB 2HESX 1XKSA 3SBRA 5JWZA 2I0RA 2CN2A 1SHYB 5CYKA 3RRMC 4CI1A 2I3SA 1S4UX 1TBGA 2AGXA 2OK4A 2CN3A 3I8CA 5EAPA 3MZLA 1K32A 2G99A 3DSMA 5GMKn 5K19A 4J77A 2Z2PA 1R5MA 3PVWB 4J0XA 5FA5B 3RLMD 3PSLA 5GXIA 3UVOA 3JB9L 4MK0B 4ERQA 3IKOA 3BG1A 3RSEC 5EM2B 5KDOB 3C9CA 3FRXA 4CY1A 5TEFA 4FA5D 2IAAA 1B9XA 2YNNA 4JSNC 3ZWLB 4KFMB 5B4WA 5THAA 1L0QA 3JZNA 3I2NA 2CNXA 2PM9A 2QC5A 4FA9D 4A11A 3AFCA 3I7OA 4A0BB 4J82A 1RI6A 3ODTA 5K1CC 2J57G 4EWRA 3A0FA 1PGUA 3EI4B 4L9OA 4I79A 3W15A 3UVNA 4D6VA 4E54A 2H9LA 5HE3B 3ORVD 5EMKB 2HKMA 2H68A 5CXBB 5EMMB 2YB8B 3JRPA 3OL2A 1Q47A 3JZHA 3EU7A 5I5MA 1FWXA 2HJ4A 5EALA 4E5ZA 4TZ4A 1XHMA 4CY2A 4ESGA 4GGAA 3JPXA 5EARA 1MDAH 5CYKB 5EAMA 4ERYA 2PM6B 3N0DA 2H47A 1OMWB 1B9YA 3IJCA 2OVPB 2H6NA 2H13A 2Z2OA 3MZKA 4GM9A 3I7KA 1GOTB 2AH1A 3F3PA 5IT9g 5H14A 1QNIA 5TF2A 2PM7B 2B5NA 2I3TA 3SBQA 4YVDA 4CI3A 4ZN4A 3GFCA 1NEXB 2H6KA 2BCJB 2XL2A 3UVMA 4J87A 5HE0B 3EI1B 4FA1D 2P9KC 4J84A 4IMMA 4R7AB 4CY3A 4PSXB 2P9IC 3CIKB 2J56H 5IC7A 3I7PA 4FHLA 3B7FA 2UZXB 3V5WB 3NVXA 3AH8B 3SJLD 2PM9B 4J86A 4H5JA 2AQ5A 3NVNA 2AGWA 5IJ8E 4A11B 2P9LC 2CO0A 3CFVA 2H14A 1VYHC 3MKQA 2P9NC 2I0TA 2IWFA 3PXSD 4BH6A 2OIZA 4U1EI 3OKYA 3F3GA 4PSWB 1N6DA 4L1QD 4JSPC 4U7AA 4A0AA 1GP2B 4O3UB 2MTAH 2Q7QA 2H3XA 2EBSA 3EI2A 4E54B 2H6QA 1N6EA 4PC0A 2BBKH 3SMRA 1A0RB 5GSAA 4CZXA 4J8BA 4O9DA 4FA4D 2H9MA 2GC7A 5HQGA 5FQDA 4CC9A 2IURA 5IGQA 3OW8A 4E5ZB 3UVLA 4Z8LA 2QXVA 3CFSB 2G9AA 3EG6A 2XU7A 4UI9R 2AGYA 4XEIC 4LG9A 3FGBA 4IA9A 3RMZD 5H1MA 2J55H 3SWSD 3I7LA 3MMYA 3SXTD 2GC4A 3C5MA 4L3HD 4ZOYA 1P22A 3U4YA 2YMUA 4K3JB 1U4CA 4O45A 1ERJA 4A08A 3ULEC 1K8KC 4J78A 2Z2NA 3AL8B 4A2LA 3IIYA 4X61B 3E0CA 4ZOVA 2YNOA 4GQBB 4J0WA 2HXCA 3UKUC 2OK6A 4J73A 3VGZA 3VH0A 4GQ2P 5HE2B 3HFQA 3J81g 4X3EA 5A2Qg 4FWWA 3IIWA 2AGZA 1JOFA 3RFHA 2XYIA 4HDJA 3JAMg 3PE7A 5IGOA 3JZGA 4QRJA 3DWLC 3OKYB 4J79A 2CE8A 4ZOXA 1JJUB 4O1QD 1NR0A 3K27A 2OVRB 5C9ZB 4A0AB 3J80g 1JMXB 2B5LA 2YNPA 3P4FA 4JT6C 5FKTA 3UR4A 4ZOZA 4JXMA 3BWSA 4A09A 2AH0A 3NVQA 4XYHA 3FM0A 5FKRA 4OZUA 2CE9A 5FXYA 2P9SC 5FLXg 4QL1A 3I7HA 1U2VC 5SXMA 3SFZA 3PXWD 3K26A 2PBIB 4GM8A 5AJAA 4X63B 4QQEA 3JROA 4NSXA 3RFGA 4K3ID 4JSXC 2IUQA 5EMLB 4BL0A 5FKQA 3EI3A 4JSVC 3L4MD 4H5IA 3MKSB 5I5JA 4CZVA 4CI2A 4BUJC 3GREA 3I8EA 1SQ9A 1MG3A 3SLED 3DXMC 4L3GD 4A08B 3UVKA 2XL3A 4A7JA 3I7NA 1MG2A 3VA6A 5FKSA 1PI6A 3OL2B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GXH A;  4QT8 A;  3SHF A;  1TYQ C;  3PVU B;  4D0K A;  4AEZ A;  3EI1 A;  2UZY B;  4CY5 A;  5H17 A;  2P9P C;  3SCY A;  2HYE A;  4GGD A;  2CO0 C;  5CXC A;  2H9N A;  1OLZ A;  5C2V B;  4OWR A;  3V9F A;  2YBA A;  1XIP A;  4GGC A;  3UKR C;  2IWK A;  2O9K A;  3C75 H;  4Y7R A;  3EMH A;  4AOW A;  4ERZ A;  5TDH B;  2B4E A;  4FAV D;  2AGL A;  2H9P A;  4JD2 C;  4J8G A;  5I5I A;  4J81 A;  4N14 A;  5EMJ B;  4O3T B;  3DXK C;  1YFQ A;  5TEE A;  3F3F A;  4PNK B;  4A09 B;  5C2W B;  1N6F A;  3L4O D;  5AMS A;  3SN6 B;  2W18 A;  4PBY A;  4CZY A;  4CI8 A;  5IJ7 E;  2I0S A;  4GM3 A;  3RN0 D;  5EM2 A;  3IJ0 A;  3KRX B;  3OKT A;  4GZ8 A;  4LGN A;  3SVW D;  4FAN D;  3I89 A;  2HKR A;  1PEV A;  3RN1 D;  1PBY B;  1GG2 B;  4ES0 A;  3IJ1 A;  2TRC B;  1GXR A;  5AFU 3;  3EI3 B;  4A0B A;  4FB1 D;  3N0E A;  2OVQ B;  3DM0 A;  4PXW A;  3OKW A;  4JT5 C;  5HYN B;  4X60 B;  2P9U C;  3SBP A;  3EI2 B;  3EI4 A;  3V7D B;  2OJY A;  2GNQ A;  5HE1 B;  4XYI A;  3MXX A;  2IUV A;  3AL9 A;  1JMZ B;  2B5M A;  2HJB A;  3KRW B;  3C99 A;  4PBZ A;  3AL8 A;  5CXB A;  3BG0 A;  3EWE A;  4GMB A;  4Y5R D;  3PSC B;  4GQ1 A;  2IUP A;  4A2M A;  4LG8 A;  4G56 B;  3OTT A;  3PXT D;  1SQJ A;  5CXC B;  2HES X;  1XKS A;  3SBR A;  5JWZ A;  2I0R A;  2CN2 A;  1SHY B;  5CYK A;  3RRM C;  4CI1 A;  2I3S A;  1S4U X;  1TBG A;  2AGX A;  2OK4 A;  2CN3 A;  3I8C A;  5EAP A;  3MZL A;  1K32 A;  2G99 A;  3DSM A;  5GMK n;  5K19 A;  4J77 A;  2Z2P A;  1R5M A;  3PVW B;  4J0X A;  5FA5 B;  3RLM D;  3PSL A;  5GXI A;  3UVO A;  3JB9 L;  4MK0 B;  4ERQ A;  3IKO A;  3BG1 A;  3RSE C;  5EM2 B;  5KDO B;  3C9C A;  3FRX A;  4CY1 A;  5TEF A;  4FA5 D;  2IAA A;  1B9X A;  2YNN A;  4JSN C;  3ZWL B;  4KFM B;  5B4W A;  5THA A;  1L0Q A;  3JZN A;  3I2N A;  2CNX A;  2PM9 A;  2QC5 A;  4FA9 D;  4A11 A;  3AFC A;  3I7O A;  4A0B B;  4J82 A;  1RI6 A;  3ODT A;  5K1C C;  2J57 G;  4EWR A;  3A0F A;  1PGU A;  3EI4 B;  4L9O A;  4I79 A;  3W15 A;  3UVN A;  4D6V A;  4E54 A;  2H9L A;  5HE3 B;  3ORV D;  5EMK B;  2HKM A;  2H68 A;  5CXB B;  5EMM B;  2YB8 B;  3JRP A;  3OL2 A;  1Q47 A;  3JZH A;  3EU7 A;  5I5M A;  1FWX A;  2HJ4 A;  5EAL A;  4E5Z A;  4TZ4 A;  1XHM A;  4CY2 A;  4ESG A;  4GGA A;  3JPX A;  5EAR A;  1MDA H;  5CYK B;  5EAM A;  4ERY A;  2PM6 B;  3N0D A;  2H47 A;  1OMW B;  1B9Y A;  3IJC A;  2OVP B;  2H6N A;  2H13 A;  2Z2O A;  3MZK A;  4GM9 A;  3I7K A;  1GOT B;  2AH1 A;  3F3P A;  5IT9 g;  5H14 A;  1QNI A;  5TF2 A;  2PM7 B;  2B5N A;  2I3T A;  3SBQ A;  4YVD A;  4CI3 A;  4ZN4 A;  3GFC A;  1NEX B;  2H6K A;  2BCJ B;  2XL2 A;  3UVM A;  4J87 A;  5HE0 B;  3EI1 B;  4FA1 D;  2P9K C;  4J84 A;  4IMM A;  4R7A B;  4CY3 A;  4PSX B;  2P9I C;  3CIK B;  2J56 H;  5IC7 A;  3I7P A;  4FHL A;  3B7F A;  2UZX B;  3V5W B;  3NVX A;  3AH8 B;  3SJL D;  2PM9 B;  4J86 A;  4H5J A;  2AQ5 A;  3NVN A;  2AGW A;  5IJ8 E;  4A11 B;  2P9L C;  2CO0 A;  3CFV A;  2H14 A;  1VYH C;  3MKQ A;  2P9N C;  2I0T A;  2IWF A;  3PXS D;  4BH6 A;  2OIZ A;  4U1E I;  3OKY A;  3F3G A;  4PSW B;  1N6D A;  4L1Q D;  4JSP C;  4U7A A;  4A0A A;  1GP2 B;  4O3U B;  2MTA H;  2Q7Q A;  2H3X A;  2EBS A;  3EI2 A;  4E54 B;  2H6Q A;  1N6E A;  4PC0 A;  2BBK H;  3SMR A;  1A0R B;  5GSA A;  4CZX A;  4J8B A;  4O9D A;  4FA4 D;  2H9M A;  2GC7 A;  5HQG A;  5FQD A;  4CC9 A;  2IUR A;  5IGQ A;  3OW8 A;  4E5Z B;  3UVL A;  4Z8L A;  2QXV A;  3CFS B;  2G9A A;  3EG6 A;  2XU7 A;  4UI9 R;  2AGY A;  4XEI C;  4LG9 A;  3FGB A;  4IA9 A;  3RMZ D;  5H1M A;  2J55 H;  3SWS D;  3I7L A;  3MMY A;  3SXT D;  2GC4 A;  3C5M A;  4L3H D;  4ZOY A;  1P22 A;  3U4Y A;  2YMU A;  4K3J B;  1U4C A;  4O45 A;  1ERJ A;  4A08 A;  3ULE C;  1K8K C;  4J78 A;  2Z2N A;  3AL8 B;  4A2L A;  3IIY A;  4X61 B;  3E0C A;  4ZOV A;  2YNO A;  4GQB B;  4J0W A;  2HXC A;  3UKU C;  2OK6 A;  4J73 A;  3VGZ A;  3VH0 A;  4GQ2 P;  5HE2 B;  3HFQ A;  3J81 g;  4X3E A;  5A2Q g;  4FWW A;  3IIW A;  2AGZ A;  1JOF A;  3RFH A;  2XYI A;  4HDJ A;  3JAM g;  3PE7 A;  5IGO A;  3JZG A;  4QRJ A;  3DWL C;  3OKY B;  4J79 A;  2CE8 A;  4ZOX A;  1JJU B;  4O1Q D;  1NR0 A;  3K27 A;  2OVR B;  5C9Z B;  4A0A B;  3J80 g;  1JMX B;  2B5L A;  2YNP A;  3P4F A;  4JT6 C;  5FKT A;  3UR4 A;  4ZOZ A;  4JXM A;  3BWS A;  4A09 A;  2AH0 A;  3NVQ A;  4XYH A;  3FM0 A;  5FKR A;  4OZU A;  2CE9 A;  5FXY A;  2P9S C;  5FLX g;  4QL1 A;  3I7H A;  1U2V C;  5SXM A;  3SFZ A;  3PXW D;  3K26 A;  2PBI B;  4GM8 A;  5AJA A;  4X63 B;  4QQE A;  3JRO A;  4NSX A;  3RFG A;  4K3I D;  4JSX C;  2IUQ A;  5EML B;  4BL0 A;  5FKQ A;  3EI3 A;  4JSV C;  3L4M D;  4H5I A;  3MKS B;  5I5J A;  4CZV A;  4CI2 A;  4BUJ C;  3GRE A;  3I8E A;  1SQ9 A;  1MG3 A;  3SLE D;  3DXM C;  4L3G D;  4A08 B;  3UVK A;  2XL3 A;  4A7J A;  3I7N A;  1MG2 A;  3VA6 A;  5FKS A;  1PI6 A;  3OL2 B; 
#chains in the Genus database with same CATH topology
 5GXH A;  4QT8 A;  5M61 A;  3SHF A;  1TYQ C;  3PVU B;  4D0K A;  2VC2 A;  2XDW A;  4MMY A;  3VI4 A;  4AEZ A;  3EI1 A;  3ZDZ A;  2UZY B;  4CY5 A;  5H17 A;  2XE4 A;  2P9P C;  4L1M A;  4WJK A;  3SCY A;  2HYE A;  4GGD A;  2CO0 C;  5CXC A;  2H9N A;  1OLZ A;  5C2V B;  4OWR A;  3V9F A;  2WQ8 A;  1XIP A;  2YBA A;  4GGC A;  3UKR C;  2IWK A;  2O9K A;  3C75 H;  4Y7R A;  3EMH A;  4AOW A;  1U8C A;  4ERZ A;  1K3I A;  5TDH B;  2B4E A;  4FAV D;  2AGL A;  2H9P A;  3MVD K;  4JD2 C;  4J8G A;  5I5I A;  2VDR A;  2BKL A;  4J81 A;  1VZ2 A;  4N14 A;  5EMJ B;  4O3T B;  3DXK C;  1YFQ A;  5TEE A;  3F3F A;  4PNK B;  4A09 B;  5C2W B;  1N6F A;  3L4O D;  5AMS A;  3SN6 B;  2W18 A;  4PBY A;  4CZY A;  1GOF A;  4CI8 A;  5IJ7 E;  3QI0 A;  4UM9 A;  3FCU A;  1O6F A;  2I0S A;  3IUN A;  4GM3 A;  3RN0 D;  5EM2 A;  3IJ0 A;  3KRX B;  3OKT A;  4GZ8 A;  4LGN A;  3SVW D;  4FAN D;  3I89 A;  1JV2 A;  2HKR A;  3O4H A;  1PEV A;  2EID A;  3RN1 D;  1PBY B;  3IUQ A;  1GG2 B;  1QFS A;  4ES0 A;  5M5T A;  3IJ1 A;  2TRC B;  1GXR A;  5AFU 3;  3EI3 B;  4A0B A;  4FB1 D;  3N0E A;  2OVQ B;  2QR5 A;  2JKX A;  3DM0 A;  4BCD A;  4PXW A;  3OKW A;  4JT5 C;  5HYN B;  4X60 B;  2P9U C;  2VDN A;  3SBP A;  3EI2 B;  3EI4 A;  3V7D B;  2OJY A;  2GNQ A;  5HE1 B;  4XYI A;  3MXX A;  1H2Z A;  4NBM A;  2IUV A;  3AL9 A;  3O4G A;  3OF7 A;  1JMZ B;  2B5M A;  2HJB A;  3KRW B;  3VI3 A;  3C99 A;  1TYE A;  2VZ1 A;  2XZG A;  3AL8 A;  4PBZ A;  5CXB A;  1UTC A;  3BG0 A;  3EWE A;  4GMB A;  2VZ3 A;  4Y5R D;  3PSC B;  4GQ1 A;  2IUP A;  4A2M A;  4LG8 A;  4G56 B;  3K72 A;  3OTT A;  3PXT D;  1YR2 A;  1SQJ A;  1A12 A;  5CXC B;  2HES X;  5M5U A;  1XKS A;  3SBR A;  5JWZ A;  2I0R A;  2CN2 A;  1SHY B;  5CYK A;  3RRM C;  4CI1 A;  2I3S A;  4DNV A;  5E6U A;  1S4U X;  3ZE1 A;  1TBG A;  2AGX A;  2OK4 A;  2CN3 A;  3I8C A;  5EAP A;  3MZL A;  1K32 A;  2G99 A;  3DSM A;  5GMK n;  3GD1 I;  5K19 A;  3ZE0 A;  4J77 A;  2Z2P A;  3IUM A;  1R5M A;  3PVW B;  4J0X A;  2VDQ A;  5FA5 B;  3ZDX A;  3T3M A;  3RLM D;  3PSL A;  4MMX A;  5GXI A;  3EQ9 A;  3UVO A;  1C9L A;  3JB9 L;  4MK0 B;  4ERQ A;  3IKO A;  4O02 A;  3BG1 A;  3RSE C;  4WK2 A;  5EM2 B;  5KDO B;  3C9C A;  2EIB A;  3FRX A;  4CY1 A;  5TEF A;  4FA5 D;  2IAA A;  1B9X A;  2YNN A;  3MUN A;  4JSN C;  3ZWL B;  4KFM B;  5B4W A;  5THA A;  1L0Q A;  3JZN A;  3I2N A;  2CNX A;  2PM9 A;  2QC5 A;  4FA9 D;  4D9S A;  4A11 A;  3AFC A;  3O4I A;  3I7O A;  4BCC A;  4A0B B;  4J82 A;  1RI6 A;  3ODT A;  5K1C C;  2J57 G;  4O2W A;  4EWR A;  4G1E A;  3NIF A;  4MMZ A;  1UOQ A;  2VDL A;  3A0F A;  1PGU A;  3EI4 B;  4L9O A;  3NID A;  4I79 A;  3IJE A;  1I2M B;  3W15 A;  3UVN A;  4D6V A;  4E54 A;  2H9L A;  4Z7O A;  5HE3 B;  3ORV D;  4RE6 A;  5EMK B;  2HKM A;  2H68 A;  4Z7N A;  5CXB B;  3K71 A;  5EMM B;  2YB8 B;  3JRP A;  3OL2 A;  1Q47 A;  3JZH A;  3EU7 A;  5I5M A;  1FWX A;  1QFM A;  2HJ4 A;  5EAL A;  4E5Z A;  4TZ4 A;  1XHM A;  5E6R A;  4CY2 A;  4ESG A;  4GGA A;  1H2Y A;  2QZP A;  3JPX A;  5EAR A;  1MDA H;  5CYK B;  5EAM A;  4BP9 A;  2PM6 B;  4ERY A;  3N0D A;  2H47 A;  1OMW B;  1B9Y A;  3IUJ A;  3KCI A;  4AN0 A;  3IJC A;  2OVP B;  2H6N A;  4RE5 A;  2H13 A;  2Z2O A;  3MZK A;  4Z7Q A;  3IUL A;  4GM9 A;  3I7K A;  1GOT B;  2AH1 A;  1M1X A;  3F3P A;  5IT9 g;  5H14 A;  1QNI A;  5TF2 A;  2PM7 B;  2B5N A;  2I3T A;  5FFG A;  3SBQ A;  4YVD A;  4CI3 A;  4ZN4 A;  3V4V A;  3GFC A;  2HU8 A;  1NEX B;  2H6K A;  2BCJ B;  2XL2 A;  3UVM A;  3O4J A;  4J87 A;  1T2X A;  5HE0 B;  3EI1 B;  4FA1 D;  1H2W A;  2P9K C;  4NAA A;  4J84 A;  1VZ3 A;  4IMM A;  4R7A B;  5C92 A;  1BPO A;  3NIG A;  4CY3 A;  4UM8 A;  4PSX B;  2P9I C;  1VE6 A;  1GOG A;  3CIK B;  2J56 H;  5IC7 A;  4G1M A;  3I7P A;  4FHL A;  3B7F A;  2UZX B;  4DNU A;  3V5W B;  3FCS A;  3NVX A;  3AH8 B;  3SJL D;  2PM9 B;  4J86 A;  4BCB A;  4H5J A;  2AQ5 A;  3NVN A;  2AGW A;  5IJ8 E;  4A11 B;  4BP8 A;  4AN1 A;  2P9L C;  2EIC A;  2CO0 A;  3CFV A;  3QHY B;  2H14 A;  3GC3 B;  1VYH C;  3MKQ A;  2P9N C;  2I0T A;  2EIE A;  3ZE2 A;  1L5G A;  2IWF A;  3PXS D;  4BH6 A;  2OIZ A;  4U1E I;  3OKY A;  2HU7 A;  3F3G A;  4PSW B;  1N6D A;  4L1Q D;  4JSP C;  4U7A A;  1JTD B;  4IRZ A;  1GP2 B;  4A0A A;  4O3U B;  2VDK A;  2MTA H;  2Q7Q A;  2H3X A;  2EBS A;  3EI2 A;  4E54 B;  2H6Q A;  1N6E A;  4PC0 A;  2BBK H;  3SMR A;  4WK4 A;  5M5V A;  1A0R B;  5GSA A;  5HDB A;  4CZX A;  4J8B A;  4O9D A;  4FA4 D;  2H9M A;  3ZDY A;  2GC7 A;  5HQG A;  5FQD A;  2HU5 A;  4CC9 A;  5M5R A;  1E5T A;  2VDP A;  4JHP C;  3K6S A;  2IUR A;  5IGQ A;  3OW8 A;  4E5Z B;  3UVL A;  4Z8L A;  2QXV A;  3CFS B;  2G9A A;  3EG6 A;  2XU7 A;  4UI9 R;  2AGY A;  4XEI C;  4LG9 A;  3FGB A;  4IA9 A;  3RMZ D;  1O6G A;  5H1M A;  3DDU A;  2J55 H;  3SWS D;  3I7L A;  3MMY A;  3SXT D;  2GC4 A;  3C5M A;  4L3H D;  4ZOY A;  1E8M A;  1P22 A;  3T3P A;  3U4Y A;  2YMU A;  4K3J B;  1U4C A;  4O45 A;  1ERJ A;  3IUR A;  5E6S A;  4A08 A;  3ULE C;  1K8K C;  4J78 A;  2Z2N A;  3AL8 B;  4A2L A;  3IIY A;  4X61 B;  3E0C A;  4ZOV A;  2YNO A;  4QAM A;  4GQB B;  4J0W A;  4WK0 A;  2HXC A;  3UKU C;  2OK6 A;  1UOP A;  4J73 A;  3VGZ A;  3VH0 A;  4GQ2 P;  5HE2 B;  1E8N A;  3HFQ A;  3EQ7 A;  3J81 g;  4X3E A;  5A2Q g;  1GOH A;  4FWW A;  3IIW A;  2AGZ A;  1JOF A;  3RFH A;  2XYI A;  1VE7 A;  4HDJ A;  3JAM g;  3PE7 A;  5IGO A;  3JZG A;  4QRJ A;  3DWL C;  3OKY B;  4J79 A;  2CE8 A;  4ZOX A;  1JJU B;  4O1Q D;  5C86 A;  1NR0 A;  4AMZ A;  3K27 A;  2OVR B;  5C9Z B;  4A0A B;  3J80 g;  1JMX B;  2B5L A;  2YNP A;  3P4F A;  4G55 A;  4JT6 C;  5FKT A;  3UR4 A;  4ZOZ A;  4JXM A;  3BWS A;  4A09 A;  2AH0 A;  3NVQ A;  4XYH A;  3FM0 A;  5FKR A;  4OZU A;  5FFO A;  2CE9 A;  5FXY A;  2P9S C;  3MUO A;  5FLX g;  4QL1 A;  3I7H A;  1U2V C;  5M5S A;  1UOO A;  5SXM A;  1C9I A;  3SFZ A;  3PXW D;  4AX4 A;  3K26 A;  4AMY A;  2PBI B;  4GM8 A;  3V4P A;  5AJA A;  4NEN A;  4X63 B;  2VDO A;  4QQE A;  3JRO A;  4NSX A;  3RFG A;  1H2X A;  4K3I D;  4JSX C;  2IUQ A;  5EML B;  4BL0 A;  5FKQ A;  4JHN A;  3EI3 A;  3EQ8 A;  4JSV C;  3L4M D;  4H5I A;  3MKS B;  4NC4 A;  5I5J A;  4CZV A;  4CI2 A;  4BUJ C;  3GRE A;  3I8E A;  2VDM A;  1SQ9 A;  1MG3 A;  3SLE D;  3DXM C;  4L3G D;  4A08 B;  3UVK A;  2XL3 A;  4A7J A;  3I7N A;  1MG2 A;  3IVM A;  4DNW A;  3VA6 A;  5FKS A;  1PI6 A;  3OL2 B; 
#chains in the Genus database with same CATH homology
 5GXH A;  4QT8 A;  3SHF A;  1TYQ C;  3PVU B;  4D0K A;  4AEZ A;  3EI1 A;  2UZY B;  4CY5 A;  5H17 A;  2P9P C;  3SCY A;  2HYE A;  4GGD A;  2CO0 C;  5CXC A;  2H9N A;  1OLZ A;  5C2V B;  4OWR A;  3V9F A;  2YBA A;  1XIP A;  4GGC A;  3UKR C;  2IWK A;  2O9K A;  3C75 H;  4Y7R A;  3EMH A;  4AOW A;  4ERZ A;  5TDH B;  2B4E A;  4FAV D;  2AGL A;  2H9P A;  4JD2 C;  4J8G A;  5I5I A;  4J81 A;  4N14 A;  5EMJ B;  4O3T B;  3DXK C;  1YFQ A;  5TEE A;  3F3F A;  4PNK B;  4A09 B;  5C2W B;  1N6F A;  3L4O D;  5AMS A;  3SN6 B;  2W18 A;  4PBY A;  4CZY A;  4CI8 A;  5IJ7 E;  2I0S A;  4GM3 A;  3RN0 D;  5EM2 A;  3IJ0 A;  3KRX B;  3OKT A;  4GZ8 A;  4LGN A;  3SVW D;  4FAN D;  3I89 A;  2HKR A;  1PEV A;  3RN1 D;  1PBY B;  1GG2 B;  4ES0 A;  3IJ1 A;  2TRC B;  1GXR A;  5AFU 3;  3EI3 B;  4A0B A;  4FB1 D;  3N0E A;  2OVQ B;  3DM0 A;  4PXW A;  3OKW A;  4JT5 C;  5HYN B;  4X60 B;  2P9U C;  3SBP A;  3EI2 B;  3EI4 A;  3V7D B;  2OJY A;  2GNQ A;  5HE1 B;  4XYI A;  3MXX A;  2IUV A;  3AL9 A;  1JMZ B;  2B5M A;  2HJB A;  3KRW B;  3C99 A;  4PBZ A;  3AL8 A;  5CXB A;  3BG0 A;  3EWE A;  4GMB A;  4Y5R D;  3PSC B;  4GQ1 A;  2IUP A;  4A2M A;  4LG8 A;  4G56 B;  3OTT A;  3PXT D;  1SQJ A;  5CXC B;  2HES X;  1XKS A;  3SBR A;  5JWZ A;  2I0R A;  2CN2 A;  1SHY B;  5CYK A;  3RRM C;  4CI1 A;  2I3S A;  1S4U X;  1TBG A;  2AGX A;  2OK4 A;  2CN3 A;  3I8C A;  5EAP A;  3MZL A;  1K32 A;  2G99 A;  3DSM A;  5GMK n;  5K19 A;  4J77 A;  2Z2P A;  1R5M A;  3PVW B;  4J0X A;  5FA5 B;  3RLM D;  3PSL A;  5GXI A;  3UVO A;  3JB9 L;  4MK0 B;  4ERQ A;  3IKO A;  3BG1 A;  3RSE C;  5EM2 B;  5KDO B;  3C9C A;  3FRX A;  4CY1 A;  5TEF A;  4FA5 D;  2IAA A;  1B9X A;  2YNN A;  4JSN C;  3ZWL B;  4KFM B;  5B4W A;  5THA A;  1L0Q A;  3JZN A;  3I2N A;  2CNX A;  2PM9 A;  2QC5 A;  4FA9 D;  4A11 A;  3AFC A;  3I7O A;  4A0B B;  4J82 A;  1RI6 A;  3ODT A;  5K1C C;  2J57 G;  4EWR A;  3A0F A;  1PGU A;  3EI4 B;  4L9O A;  4I79 A;  3W15 A;  3UVN A;  4D6V A;  4E54 A;  2H9L A;  5HE3 B;  3ORV D;  5EMK B;  2HKM A;  2H68 A;  5CXB B;  5EMM B;  2YB8 B;  3JRP A;  3OL2 A;  1Q47 A;  3JZH A;  3EU7 A;  5I5M A;  1FWX A;  2HJ4 A;  5EAL A;  4E5Z A;  4TZ4 A;  1XHM A;  4CY2 A;  4ESG A;  4GGA A;  3JPX A;  5EAR A;  1MDA H;  5CYK B;  5EAM A;  4ERY A;  2PM6 B;  3N0D A;  2H47 A;  1OMW B;  1B9Y A;  3IJC A;  2OVP B;  2H6N A;  2H13 A;  2Z2O A;  3MZK A;  4GM9 A;  3I7K A;  1GOT B;  2AH1 A;  3F3P A;  5IT9 g;  5H14 A;  1QNI A;  5TF2 A;  2PM7 B;  2B5N A;  2I3T A;  3SBQ A;  4YVD A;  4CI3 A;  4ZN4 A;  3GFC A;  1NEX B;  2H6K A;  2BCJ B;  2XL2 A;  3UVM A;  4J87 A;  5HE0 B;  3EI1 B;  4FA1 D;  2P9K C;  4J84 A;  4IMM A;  4R7A B;  4CY3 A;  4PSX B;  2P9I C;  3CIK B;  2J56 H;  5IC7 A;  3I7P A;  4FHL A;  3B7F A;  2UZX B;  3V5W B;  3NVX A;  3AH8 B;  3SJL D;  2PM9 B;  4J86 A;  4H5J A;  2AQ5 A;  3NVN A;  2AGW A;  5IJ8 E;  4A11 B;  2P9L C;  2CO0 A;  3CFV A;  2H14 A;  1VYH C;  3MKQ A;  2P9N C;  2I0T A;  2IWF A;  3PXS D;  4BH6 A;  2OIZ A;  4U1E I;  3OKY A;  3F3G A;  4PSW B;  1N6D A;  4L1Q D;  4JSP C;  4U7A A;  4A0A A;  1GP2 B;  4O3U B;  2MTA H;  2Q7Q A;  2H3X A;  2EBS A;  3EI2 A;  4E54 B;  2H6Q A;  1N6E A;  4PC0 A;  2BBK H;  3SMR A;  1A0R B;  5GSA A;  4CZX A;  4J8B A;  4O9D A;  4FA4 D;  2H9M A;  2GC7 A;  5HQG A;  5FQD A;  4CC9 A;  2IUR A;  5IGQ A;  3OW8 A;  4E5Z B;  3UVL A;  4Z8L A;  2QXV A;  3CFS B;  2G9A A;  3EG6 A;  2XU7 A;  4UI9 R;  2AGY A;  4XEI C;  4LG9 A;  3FGB A;  4IA9 A;  3RMZ D;  5H1M A;  2J55 H;  3SWS D;  3I7L A;  3MMY A;  3SXT D;  2GC4 A;  3C5M A;  4L3H D;  4ZOY A;  1P22 A;  3U4Y A;  2YMU A;  4K3J B;  1U4C A;  4O45 A;  1ERJ A;  4A08 A;  3ULE C;  1K8K C;  4J78 A;  2Z2N A;  3AL8 B;  4A2L A;  3IIY A;  4X61 B;  3E0C A;  4ZOV A;  2YNO A;  4GQB B;  4J0W A;  2HXC A;  3UKU C;  2OK6 A;  4J73 A;  3VGZ A;  3VH0 A;  4GQ2 P;  5HE2 B;  3HFQ A;  3J81 g;  4X3E A;  5A2Q g;  4FWW A;  3IIW A;  2AGZ A;  1JOF A;  3RFH A;  2XYI A;  4HDJ A;  3JAM g;  3PE7 A;  5IGO A;  3JZG A;  4QRJ A;  3DWL C;  3OKY B;  4J79 A;  2CE8 A;  4ZOX A;  1JJU B;  4O1Q D;  1NR0 A;  3K27 A;  2OVR B;  5C9Z B;  4A0A B;  3J80 g;  1JMX B;  2B5L A;  2YNP A;  3P4F A;  4JT6 C;  5FKT A;  3UR4 A;  4ZOZ A;  4JXM A;  3BWS A;  4A09 A;  2AH0 A;  3NVQ A;  4XYH A;  3FM0 A;  5FKR A;  4OZU A;  2CE9 A;  5FXY A;  2P9S C;  5FLX g;  4QL1 A;  3I7H A;  1U2V C;  5SXM A;  3SFZ A;  3PXW D;  3K26 A;  2PBI B;  4GM8 A;  5AJA A;  4X63 B;  4QQE A;  3JRO A;  4NSX A;  3RFG A;  4K3I D;  4JSX C;  2IUQ A;  5EML B;  4BL0 A;  5FKQ A;  3EI3 A;  4JSV C;  3L4M D;  4H5I A;  3MKS B;  5I5J A;  4CZV A;  4CI2 A;  4BUJ C;  3GRE A;  3I8E A;  1SQ9 A;  1MG3 A;  3SLE D;  3DXM C;  4L3G D;  4A08 B;  3UVK A;  2XL3 A;  4A7J A;  3I7N A;  1MG2 A;  3VA6 A;  5FKS A;  1PI6 A;  3OL2 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...