2AH0A

Crystal structure of the carbinolamine intermediate in the reductive half-reaction of aromatic amine dehydrogenase (aadh) with tryptamine. monoclinic form
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
360
structure length
360
Chain Sequence
REVLTGGHSVSAPQENRIYVMDSVFMHLTESRVHVYDYTNGKFLGMVPTAFNGHVQVSNDGKKIYTMTTYHERITRGKRSDVVEVWDADKLTFEKEISLPPKRVQGLNYDGLFRQTTDGKFIVLQNASPATSIGIVDVAKGDYVEDVTAAAGCWSVIPQPNRPRSFMTICGDGGLLTINLGEDGKVASQSRSKQMFSVKDDPIFIAPALDKDKAHFVSYYGNVYSADFSGDEVKVDGPWSLLNDEDKAKNWVPGGYNLVGLHRASGRMYVFMHPDGKEGTHKFPAAEIWVMDTKTKQRVARIPGRDALSMTIDQQRNLMLTLDGGNVNVYDISQPEPKLLRTIEGAAEASLQVQFHPVGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aromatic amine dehydrogenase
publication title Atomic description of an enzyme reaction dominated by proton tunneling
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 95
structure length 360
sequence length 360
chains with identical sequence B
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2005-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2ah0A01
4QL1A 2AGWA 1B9YA 3RMZD 3ULEC 4L3HD 4EWRA 5IC7A 2PM9A 5IJ8E 2AGZA 5C9ZB 2GC4A 2UZYB 4R7AB 3AL8A 4X63B 3MKSB 3RFHA 4A0BA 2HJBA 5GXIA 1S4UX 4FB1D 4GGDA 2CE9A 4N14A 5CYKB 5EAPA 3RFGA 2OK6A 2B5MA 2P9LC 2H6NA 1OMWB 2H9LA 2AH0A 3SFZA 2HKRA 2I3SA 1XHMA 3EI3B 3IKOA 4YVDA 4AEZA 3FRXA 2AGLA 3OL2A 3SHFA 3N0EA 3OKWA 5CXCB 5GSAA 1FWXA 3BG1A 4ZOZA 3RRMC 5EMJB 4FAND 4GQ2P 3SBPA 2OJYA 3EI2B 1NR0A 4FAVD 4ZOYA 4CI3A 2AGYA 3ZWLB 4D6VA 2QC5A 3PXWD 4ES0A 1QNIA 3KRWB 3PVWB 3BWSA 4PSWB 2H9MA 4PNKB 3UKRC 1GXRA 5EARA 4H5JA 5B4WA 4JT6C 1PI6A 1RI6A 5GXHA 3E0CA 4PBZA 3RLMD 5EMMB 2CO0C 4IMMA 5EMLB 3IJ1A 4HDJA 2H68A 5HE3B 3I7LA 3C9CA 3VH0A 2IUQA 3DXMC 2CN3A 2G9AA 5TDHB 2PM6B 4A0AB 2OIZA 1JOFA 3SN6B 1OLZA 5C2WB 4A11B 4GQ1A 4CY3A 2CNXA 5IJ7E 3AFCA 5TF2A 3L4OD 4BL0A 4J86A 4O3UB 3C5MA 3IIYA 5K1CC 4A08A 4J84A 4J73A 4JSVC 2Z2NA 4QQEA 4X60B 3JROA 3ORVD 4A09B 4ZOVA 3B7FA 5EM2B 4JSNC 3I7NA 1L0QA 3J80g 2H6KA 2H47A 3GFCA 2P9IC 4CI2A 3MKQA 4OZUA 3K27A 2HXCA 4FA5D 1YFQA 5H14A 2Q7QA 3RN1D 4ERYA 5IGQA 2HJ4A 2J57G 3NVXA 3OKYB 3EI3A 3HFQA 1XKSA 2QXVA 5I5IA 2AGXA 5TEFA 4O1QD 3SBRA 3C75H 4QT8A 5HE2B 4FA4D 3MZLA 2B4EA 3FM0A 5H17A 4PBYA 3I2NA 1GP2B 1N6DA 4E5ZB 4E54A 2I0SA 4J79A 5AFU3 2HYEA 1U4CA 2GNQA 4IA9A 5HQGA 3UVNA 3C99A 3F3FA 2OK4A 3SCYA 5A2Qg 3P4FA 2IWFA 4ZOXA 4Z8LA 2P9SC 3I89A 3U4YA 3UVLA 2XL2A 4XEIC 4ZN4A 5CXBA 5AMSA 4GGAA 4UI9R 2P9PC 3IJ0A 3SLED 5GMKn 1GG2B 4QRJA 4D0KA 1N6EA 4X61B 4PXWA 2H6QA 1PBYB 4JXMA 3PE7A 4J8BA 3UVOA 4X3EA 3V9FA 4CY5A 4A11A 3EI4B 4J0XA 5FQDA 4A2LA 4CZXA 3DM0A 4CY2A 3EI1A 3OW8A 2Z2PA 2PM9B 3OKTA 3NVNA 1GOTB 3J81g 4LG8A 3V7DB 5KDOB 3I8EA 4LG9A 4FA1D 2H9PA 4J78A 3AL8B 1SQ9A 4NSXA 3VA6A 3PXTD 3UVKA 3JZGA 3JZHA 4A0BB 5H1MA 3SWSD 5AJAA 4GQBB 4CC9A 4A2MA 1B9XA 3AL9A 4J8GA 4ERZA 5TEEA 2AH1A 3JZNA 3DSMA 4J81A 2IWKA 3DXKC 4J87A 4Y5RD 3UKUC 5I5MA 4E5ZA 4L3GD 3OL2B 4Y7RA 4CI8A 2IURA 3F3PA 3OTTA 4JD2C 3KRXB 4ESGA 4L9OA 5HE0B 2IUPA 3AH8B 5THAA 5CYKA 1MDAH 4J0WA 4PSXB 2CN2A 2I3TA 1U2VC 1K8KC 3I8CA 4CY1A 1PGUA 3EU7A 5C2VB 4CZYA 4J77A 2IAAA 5FA5B 3IIWA 2HKMA 4U1EI 3L4MD 2PM7B 3FGBA 3CIKB 5FKTA 5CXCA 3EI2A 5EMKB 3A0FA 1SQJA 3EI4A 3PSCB 4O3TB 4K3JB 4JSPC 2OVRB 2YB8B 3PSLA 4GMBA 2HESX 4KFMB 2I0RA 2TRCB 1MG2A 2YBAA 2O9KA 4H5IA 4FHLA 3PVUB 2OVPB 4GZ8A 1PEVA 3I7OA 5FLXg 3N0DA 4U7AA 3SXTD 3I7PA 3IJCA 5HE1B 2UZXB 4A08B 4K3ID 4G56B 1R5MA 2P9UC 2PBIB 4CZVA 2W18A 4BUJC 2BCJB 4GGCA 1P22A 3K26A 2J55H 2P9NC 2Z2OA 1A0RB 2OVQB 4JT5C 1JJUB 3SMRA 4A0AA 2I0TA 2P9KC 4XYIA 2B5NA 1ERJA 3SVWD 3DWLC 1N6FA 3BG0A 4CI1A 4I79A 1SHYB 5JWZA 5EALA 2YNNA 5HYNB 3JPXA 1Q47A 4A09A 2H9NA 3V5WB 5EM2A 1MG3A 2IUVA 4O45A 2XL3A 4GM3A 4E54B 2YNOA 3MMYA 3MXXA 4A7JA 2H3XA 4ERQA 4XYHA 1VYHC 5K19A 2YMUA 4JSXC 4OWRA 1JMXB 4MK0B 4FA9D 1XIPA 2YNPA 4L1QD 3OKYA 4PC0A 5FKQA 3JAMg 3CFSB 2XYIA 4J82A 3JRPA 4O9DA 3EMHA 5EAMA 3GREA 5CXBB 3W15A 2G99A 3I7KA 2B5LA 1K32A 4AOWA 3JB9L 2J56H 5FXYA 3I7HA 3EG6A 5SXMA 5IT9g 3EWEA 3RN0D 4LGNA 1JMZB 3RSEC 3NVQA 2AQ5A 2MTAH 2GC7A 2XU7A 3PXSD 5IGOA 3SBQA 5FKSA 1TYQC 2CO0A 3CFVA 2H13A 2H14A 3EI1B 2CE8A 4TZ4A 3MZKA 2EBSA 3UVMA 4GM9A 4FWWA 1NEXB 3SJLD 1TBGA 3F3GA 4BH6A 2BBKH 3UR4A 3ODTA 5I5JA 3VGZA 5FKRA 4GM8A
chains in the Genus database with same CATH superfamily
3IUQA 4QL1A 2AGWA 1B9YA 3RMZD 3ULEC 1C9IA 4L3HD 3EQ9A 4EWRA 1VZ2A 5IC7A 2VDOA 2HU8A 5C92A 2EIDA 2VDMA 2PM9A 5IJ8E 1YR2A 1E8MA 5E6RA 1UOQA 2AGZA 3MVDK 1H2YA 5C9ZB 2GC4A 2UZYB 2VDQA 4R7AB 3AL8A 4X63B 5E6UA 3MKSB 3VI3A 4DNVA 3RFHA 3DDUA 4A0BA 2HJBA 5GXIA 1S4UX 4FB1D 4GGDA 2CE9A 4N14A 1JTDB 5CYKB 5EAPA 3RFGA 2OK6A 4UM9A 3K71A 2B5MA 2P9LC 3GD1I 2H6NA 1OMWB 2H9LA 4G1EA 3EQ8A 2AH0A 3SFZA 2HKRA 2I3SA 1XHMA 4BP9A 3EI3B 4JHPC 4Z7OA 3IKOA 4YVDA 1U8CA 4AEZA 4DNWA 3FRXA 2AGLA 3OL2A 3SHFA 2VDKA 3N0EA 3V4VA 3OKWA 2XE4A 5CXCB 5GSAA 1FWXA 3BG1A 4ZOZA 3RRMC 5EMJB 4FAND 4GQ2P 3SBPA 2OJYA 3EI2B 2VDRA 4AN1A 1NR0A 1GOGA 4FAVD 4ZOYA 4CI3A 2AGYA 3ZWLB 4D6VA 2QC5A 3PXWD 3IVMA 4ES0A 1QNIA 1A12A 3KRWB 3PVWB 3BWSA 4PSWB 1H2ZA 2H9MA 1K3IA 4PNKB 3UKRC 2VDLA 1GXRA 3MUNA 4H5JA 5EARA 5B4WA 4JT6C 1PI6A 1RI6A 5GXHA 3E0CA 4PBZA 3RLMD 5EMMB 2CO0C 4IMMA 5EMLB 3GC3B 3IJ1A 4HDJA 2H68A 5HE3B 3I7LA 4G55A 3C9CA 3VH0A 2IUQA 3DXMC 2CN3A 2G9AA 5TDHB 1QFMA 2PM6B 4A0AB 4NENA 2OIZA 1JOFA 3SN6B 4RE6A 1OLZA 5C2WB 3FCSA 4A11B 5C86A 4GQ1A 4CY3A 2CNXA 5IJ7E 3AFCA 5TF2A 3L4OD 3K6SA 4BL0A 4J86A 4WJKA 4O3UB 3C5MA 3IIYA 5K1CC 4A08A 2HU7A 4J84A 4J73A 4JSVC 2Z2NA 4QQEA 4X60B 3JROA 3ORVD 4A09B 3IUJA 4ZOVA 3B7FA 5EM2B 4JSNC 3I7NA 5M5UA 1L0QA 4WK2A 3J80g 2H6KA 2XDWA 2H47A 3GFCA 2P9IC 4CI2A 3MKQA 4WK4A 4OZUA 4RE5A 4BP8A 3K27A 2HXCA 2VZ1A 4FA5D 1YFQA 3QI0A 5H14A 4L1MA 2Q7QA 3RN1D 4ERYA 5IGQA 2HJ4A 3KCIA 2J57G 3NVXA 3OKYB 1BPOA 3EI3A 3HFQA 1XKSA 2QXVA 5I5IA 1L5GA 2QR5A 2AGXA 5TEFA 4O1QD 3O4IA 3SBRA 3C75H 4QT8A 5HE2B 4FA4D 3MZLA 3ZE0A 2B4EA 3FM0A 5H17A 4PBYA 2XZGA 1GP2B 3I2NA 4NC4A 1N6DA 4E5ZB 4O02A 4E54A 2I0SA 1E8NA 4J79A 5AFU3 2HYEA 1U4CA 2GNQA 4IA9A 5FFGA 5HQGA 3UVNA 4D9SA 1TYEA 3O4GA 3C99A 3F3FA 2OK4A 3SCYA 5A2Qg 3P4FA 2IWFA 4ZOXA 5M5RA 4Z8LA 2P9SC 1GOHA 3I89A 5FFOA 4AMZA 3U4YA 3UVLA 2XL2A 4XEIC 3T3MA 4ZN4A 3IUMA 5CXBA 5AMSA 4GGAA 4UI9R 2P9PC 3IJ0A 3SLED 5GMKn 1GOFA 1GG2B 4QRJA 4D0KA 1JV2A 1N6EA 4X61B 1T2XA 4PXWA 3O4JA 2H6QA 5M5TA 1PBYB 4JXMA 3MUOA 3PE7A 4J8BA 3UVOA 3ZE1A 4MMXA 4X3EA 3V9FA 4CY5A 4A11A 3EI4B 4G1MA 4J0XA 5FQDA 3ZE2A 4A2LA 4CZXA 3DM0A 4CY2A 3EI1A 2JKXA 2Z2PA 3OW8A 2PM9B 3OKTA 3NVNA 1GOTB 3J81g 4LG8A 3V7DB 5KDOB 3I8EA 4LG9A 4FA1D 2H9PA 4J78A 3AL8B 1SQ9A 4NSXA 2WQ8A 3VA6A 4DNUA 4BCDA 3PXTD 3UVKA 3IULA 3JZGA 3JZHA 4A0BB 5H1MA 3SWSD 5AJAA 4GQBB 3IUNA 4CC9A 4A2MA 1B9XA 3AL9A 4J8GA 4ERZA 5TEEA 2AH1A 3JZNA 3DSMA 4J81A 4Z7QA 2IWKA 3DXKC 4J87A 4Y5RD 3UKUC 3NIGA 3O4HA 1E5TA 5I5MA 4L3GD 4E5ZA 3OL2B 4Y7RA 4CI8A 2HU5A 2IURA 3F3PA 3OTTA 4JD2C 3KRXB 4ESGA 4L9OA 5HE0B 4BCBA 2IUPA 3AH8B 5THAA 5CYKA 1MDAH 4J0WA 4IRZA 4PSXB 2CN2A 2I3TA 1U2VC 4Z7NA 3NIDA 1K8KC 1VE6A 3EQ7A 3I8CA 4CY1A 1VE7A 1PGUA 2EIEA 3EU7A 3IJEA 5C2VB 4CZYA 2VC2A 4J77A 2IAAA 5FA5B 3IIWA 2HKMA 4U1EI 4WK0A 3L4MD 2PM7B 3FGBA 3CIKB 5FKTA 4UM8A 1I2MB 5CXCA 3EI2A 5HDBA 5EMKB 3A0FA 1SQJA 3EI4A 3PSCB 5E6SA 4O3TB 4K3JB 4JSPC 2OVRB 2YB8B 3PSLA 4GMBA 2HESX 4KFMB 4QAMA 2I0RA 2TRCB 1MG2A 1O6FA 2YBAA 3FCUA 2O9KA 4H5IA 4FHLA 4O2WA 3PVUB 4BCCA 2OVPB 1O6GA 4GZ8A 1H2WA 1PEVA 3I7OA 5FLXg 3N0DA 4U7AA 3SXTD 5M5VA 2EICA 3I7PA 4AN0A 3IJCA 1UTCA 5HE1B 5M61A 4AX4A 2UZXB 4A08B 1VZ3A 1M1XA 4MMYA 3ZDZA 4K3ID 4AMYA 4G56B 1R5MA 2P9UC 2PBIB 4CZVA 2W18A 4BUJC 4NAAA 2BCJB 4GGCA 1P22A 3K26A 2J55H 2P9NC 2Z2OA 1A0RB 3T3PA 2OVQB 4JT5C 1JJUB 2VDPA 3SMRA 4A0AA 2I0TA 2P9KC 4XYIA 2B5NA 4JHNA 1ERJA 3SVWD 3DWLC 1H2XA 1N6FA 2BKLA 3BG0A 4CI1A 4I79A 2EIBA 1SHYB 3ZDXA 5JWZA 5EALA 2YNNA 5HYNB 3JPXA 1Q47A 5M5SA 4A09A 2H9NA 1QFSA 3V5WB 5EM2A 4MMZA 1MG3A 2IUVA 4O45A 2XL3A 4GM3A 4E54B 2YNOA 3MMYA 3MXXA 4A7JA 1C9LA 2H3XA 4ERQA 4XYHA 1UOPA 1VYHC 5K19A 2YMUA 4JSXC 4OWRA 1JMXB 2VDNA 4MK0B 3NIFA 3QHYB 4FA9D 1XIPA 2YNPA 4L1QD 3OKYA 4PC0A 5FKQA 3JAMg 3CFSB 2XYIA 4J82A 3JRPA 4O9DA 3EMHA 5EAMA 3GREA 5CXBB 3W15A 2G99A 3I7KA 2B5LA 1K32A 4AOWA 1UOOA 3JB9L 2J56H 5FXYA 3OF7A 3I7HA 3ZDYA 3EG6A 5SXMA 5IT9g 3EWEA 3RN0D 4LGNA 1JMZB 3RSEC 3NVQA 2AQ5A 2MTAH 2GC7A 2XU7A 3IURA 3PXSD 5IGOA 3SBQA 3V4PA 5FKSA 1TYQC 2CO0A 3CFVA 3VI4A 2H13A 2H14A 4NBMA 3EI1B 2CE8A 4TZ4A 2VZ3A 3MZKA 2EBSA 2QZPA 3UVMA 4GM9A 4FWWA 1NEXB 3SJLD 1TBGA 3F3GA 4BH6A 2BBKH 3UR4A 3ODTA 5I5JA 3VGZA 5FKRA 3K72A 4GM8A
chains in the Genus database with same CATH topology
4QL1A 2AGWA 1B9YA 3RMZD 3ULEC 4L3HD 4EWRA 5IC7A 2PM9A 5IJ8E 2AGZA 5C9ZB 2GC4A 2UZYB 4R7AB 3AL8A 4X63B 3MKSB 3RFHA 4A0BA 2HJBA 5GXIA 1S4UX 4FB1D 4GGDA 2CE9A 4N14A 5CYKB 5EAPA 3RFGA 2OK6A 2B5MA 2P9LC 2H6NA 1OMWB 2H9LA 2AH0A 3SFZA 2HKRA 2I3SA 1XHMA 3EI3B 3IKOA 4YVDA 4AEZA 3FRXA 2AGLA 3OL2A 3SHFA 3N0EA 3OKWA 5CXCB 5GSAA 1FWXA 3BG1A 4ZOZA 3RRMC 5EMJB 4FAND 4GQ2P 3SBPA 2OJYA 3EI2B 1NR0A 4FAVD 4ZOYA 4CI3A 2AGYA 3ZWLB 4D6VA 2QC5A 3PXWD 4ES0A 1QNIA 3KRWB 3PVWB 3BWSA 4PSWB 2H9MA 4PNKB 3UKRC 1GXRA 5EARA 4H5JA 5B4WA 4JT6C 1PI6A 1RI6A 5GXHA 3E0CA 4PBZA 3RLMD 5EMMB 2CO0C 4IMMA 5EMLB 3IJ1A 4HDJA 2H68A 5HE3B 3I7LA 3C9CA 3VH0A 2IUQA 3DXMC 2CN3A 2G9AA 5TDHB 2PM6B 4A0AB 2OIZA 1JOFA 3SN6B 1OLZA 5C2WB 4A11B 4GQ1A 4CY3A 2CNXA 5IJ7E 3AFCA 5TF2A 3L4OD 4BL0A 4J86A 4O3UB 3C5MA 3IIYA 5K1CC 4A08A 4J84A 4J73A 4JSVC 2Z2NA 4QQEA 4X60B 3JROA 3ORVD 4A09B 4ZOVA 3B7FA 5EM2B 4JSNC 3I7NA 1L0QA 3J80g 2H6KA 2H47A 3GFCA 2P9IC 4CI2A 3MKQA 4OZUA 3K27A 2HXCA 4FA5D 1YFQA 5H14A 2Q7QA 3RN1D 4ERYA 5IGQA 2HJ4A 2J57G 3NVXA 3OKYB 3EI3A 3HFQA 1XKSA 2QXVA 5I5IA 2AGXA 5TEFA 4O1QD 3SBRA 3C75H 4QT8A 5HE2B 4FA4D 3MZLA 2B4EA 3FM0A 5H17A 4PBYA 3I2NA 1GP2B 1N6DA 4E5ZB 4E54A 2I0SA 4J79A 5AFU3 2HYEA 1U4CA 2GNQA 4IA9A 5HQGA 3UVNA 3C99A 3F3FA 2OK4A 3SCYA 5A2Qg 3P4FA 2IWFA 4ZOXA 4Z8LA 2P9SC 3I89A 3U4YA 3UVLA 2XL2A 4XEIC 4ZN4A 5CXBA 5AMSA 4GGAA 4UI9R 2P9PC 3IJ0A 3SLED 5GMKn 1GG2B 4QRJA 4D0KA 1N6EA 4X61B 4PXWA 2H6QA 1PBYB 4JXMA 3PE7A 4J8BA 3UVOA 4X3EA 3V9FA 4CY5A 4A11A 3EI4B 4J0XA 5FQDA 4A2LA 4CZXA 3DM0A 4CY2A 3EI1A 3OW8A 2Z2PA 2PM9B 3OKTA 3NVNA 1GOTB 3J81g 4LG8A 3V7DB 5KDOB 3I8EA 4LG9A 4FA1D 2H9PA 4J78A 3AL8B 1SQ9A 4NSXA 3VA6A 3PXTD 3UVKA 3JZGA 3JZHA 4A0BB 5H1MA 3SWSD 5AJAA 4GQBB 4CC9A 4A2MA 1B9XA 3AL9A 4J8GA 4ERZA 5TEEA 2AH1A 3JZNA 3DSMA 4J81A 2IWKA 3DXKC 4J87A 4Y5RD 3UKUC 5I5MA 4E5ZA 4L3GD 3OL2B 4Y7RA 4CI8A 2IURA 3F3PA 3OTTA 4JD2C 3KRXB 4ESGA 4L9OA 5HE0B 2IUPA 3AH8B 5THAA 5CYKA 1MDAH 4J0WA 4PSXB 2CN2A 2I3TA 1U2VC 1K8KC 3I8CA 4CY1A 1PGUA 3EU7A 5C2VB 4CZYA 4J77A 2IAAA 5FA5B 3IIWA 2HKMA 4U1EI 3L4MD 2PM7B 3FGBA 3CIKB 5FKTA 5CXCA 3EI2A 5EMKB 3A0FA 1SQJA 3EI4A 3PSCB 4O3TB 4K3JB 4JSPC 2OVRB 2YB8B 3PSLA 4GMBA 2HESX 4KFMB 2I0RA 2TRCB 1MG2A 2YBAA 2O9KA 4H5IA 4FHLA 3PVUB 2OVPB 4GZ8A 1PEVA 3I7OA 5FLXg 3N0DA 4U7AA 3SXTD 3I7PA 3IJCA 5HE1B 2UZXB 4A08B 4K3ID 4G56B 1R5MA 2P9UC 2PBIB 4CZVA 2W18A 4BUJC 2BCJB 4GGCA 1P22A 3K26A 2J55H 2P9NC 2Z2OA 1A0RB 2OVQB 4JT5C 1JJUB 3SMRA 4A0AA 2I0TA 2P9KC 4XYIA 2B5NA 1ERJA 3SVWD 3DWLC 1N6FA 3BG0A 4CI1A 4I79A 1SHYB 5JWZA 5EALA 2YNNA 5HYNB 3JPXA 1Q47A 4A09A 2H9NA 3V5WB 5EM2A 1MG3A 2IUVA 4O45A 2XL3A 4GM3A 4E54B 2YNOA 3MMYA 3MXXA 4A7JA 2H3XA 4ERQA 4XYHA 1VYHC 5K19A 2YMUA 4JSXC 4OWRA 1JMXB 4MK0B 4FA9D 1XIPA 2YNPA 4L1QD 3OKYA 4PC0A 5FKQA 3JAMg 3CFSB 2XYIA 4J82A 3JRPA 4O9DA 3EMHA 5EAMA 3GREA 5CXBB 3W15A 2G99A 3I7KA 2B5LA 1K32A 4AOWA 3JB9L 2J56H 5FXYA 3I7HA 3EG6A 5SXMA 5IT9g 3EWEA 3RN0D 4LGNA 1JMZB 3RSEC 3NVQA 2AQ5A 2MTAH 2GC7A 2XU7A 3PXSD 5IGOA 3SBQA 5FKSA 1TYQC 2CO0A 3CFVA 2H13A 2H14A 3EI1B 2CE8A 4TZ4A 3MZKA 2EBSA 3UVMA 4GM9A 4FWWA 1NEXB 3SJLD 1TBGA 3F3GA 4BH6A 2BBKH 3UR4A 3ODTA 5I5JA 3VGZA 5FKRA 4GM8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QL1 A;  2AGW A;  1B9Y A;  3RMZ D;  3ULE C;  4L3H D;  4EWR A;  5IC7 A;  2PM9 A;  5IJ8 E;  2AGZ A;  5C9Z B;  2GC4 A;  2UZY B;  4R7A B;  3AL8 A;  4X63 B;  3MKS B;  3RFH A;  4A0B A;  2HJB A;  5GXI A;  1S4U X;  4FB1 D;  4GGD A;  2CE9 A;  4N14 A;  5CYK B;  5EAP A;  3RFG A;  2OK6 A;  2B5M A;  2P9L C;  2H6N A;  1OMW B;  2H9L A;  2AH0 A;  3SFZ A;  2HKR A;  2I3S A;  1XHM A;  3EI3 B;  3IKO A;  4YVD A;  4AEZ A;  3FRX A;  2AGL A;  3OL2 A;  3SHF A;  3N0E A;  3OKW A;  5CXC B;  5GSA A;  1FWX A;  3BG1 A;  4ZOZ A;  3RRM C;  5EMJ B;  4FAN D;  4GQ2 P;  3SBP A;  2OJY A;  3EI2 B;  1NR0 A;  4FAV D;  4ZOY A;  4CI3 A;  2AGY A;  3ZWL B;  4D6V A;  2QC5 A;  3PXW D;  4ES0 A;  1QNI A;  3KRW B;  3PVW B;  3BWS A;  4PSW B;  2H9M A;  4PNK B;  3UKR C;  1GXR A;  5EAR A;  4H5J A;  5B4W A;  4JT6 C;  1PI6 A;  1RI6 A;  5GXH A;  3E0C A;  4PBZ A;  3RLM D;  5EMM B;  2CO0 C;  4IMM A;  5EML B;  3IJ1 A;  4HDJ A;  2H68 A;  5HE3 B;  3I7L A;  3C9C A;  3VH0 A;  2IUQ A;  3DXM C;  2CN3 A;  2G9A A;  5TDH B;  2PM6 B;  4A0A B;  2OIZ A;  1JOF A;  3SN6 B;  1OLZ A;  5C2W B;  4A11 B;  4GQ1 A;  4CY3 A;  2CNX A;  5IJ7 E;  3AFC A;  5TF2 A;  3L4O D;  4BL0 A;  4J86 A;  4O3U B;  3C5M A;  3IIY A;  5K1C C;  4A08 A;  4J84 A;  4J73 A;  4JSV C;  2Z2N A;  4QQE A;  4X60 B;  3JRO A;  3ORV D;  4A09 B;  4ZOV A;  3B7F A;  5EM2 B;  4JSN C;  3I7N A;  1L0Q A;  3J80 g;  2H6K A;  2H47 A;  3GFC A;  2P9I C;  4CI2 A;  3MKQ A;  4OZU A;  3K27 A;  2HXC A;  4FA5 D;  1YFQ A;  5H14 A;  2Q7Q A;  3RN1 D;  4ERY A;  5IGQ A;  2HJ4 A;  2J57 G;  3NVX A;  3OKY B;  3EI3 A;  3HFQ A;  1XKS A;  2QXV A;  5I5I A;  2AGX A;  5TEF A;  4O1Q D;  3SBR A;  3C75 H;  4QT8 A;  5HE2 B;  4FA4 D;  3MZL A;  2B4E A;  3FM0 A;  5H17 A;  4PBY A;  3I2N A;  1GP2 B;  1N6D A;  4E5Z B;  4E54 A;  2I0S A;  4J79 A;  5AFU 3;  2HYE A;  1U4C A;  2GNQ A;  4IA9 A;  5HQG A;  3UVN A;  3C99 A;  3F3F A;  2OK4 A;  3SCY A;  5A2Q g;  3P4F A;  2IWF A;  4ZOX A;  4Z8L A;  2P9S C;  3I89 A;  3U4Y A;  3UVL A;  2XL2 A;  4XEI C;  4ZN4 A;  5CXB A;  5AMS A;  4GGA A;  4UI9 R;  2P9P C;  3IJ0 A;  3SLE D;  5GMK n;  1GG2 B;  4QRJ A;  4D0K A;  1N6E A;  4X61 B;  4PXW A;  2H6Q A;  1PBY B;  4JXM A;  3PE7 A;  4J8B A;  3UVO A;  4X3E A;  3V9F A;  4CY5 A;  4A11 A;  3EI4 B;  4J0X A;  5FQD A;  4A2L A;  4CZX A;  3DM0 A;  4CY2 A;  3EI1 A;  3OW8 A;  2Z2P A;  2PM9 B;  3OKT A;  3NVN A;  1GOT B;  3J81 g;  4LG8 A;  3V7D B;  5KDO B;  3I8E A;  4LG9 A;  4FA1 D;  2H9P A;  4J78 A;  3AL8 B;  1SQ9 A;  4NSX A;  3VA6 A;  3PXT D;  3UVK A;  3JZG A;  3JZH A;  4A0B B;  5H1M A;  3SWS D;  5AJA A;  4GQB B;  4CC9 A;  4A2M A;  1B9X A;  3AL9 A;  4J8G A;  4ERZ A;  5TEE A;  2AH1 A;  3JZN A;  3DSM A;  4J81 A;  2IWK A;  3DXK C;  4J87 A;  4Y5R D;  3UKU C;  5I5M A;  4E5Z A;  4L3G D;  3OL2 B;  4Y7R A;  4CI8 A;  2IUR A;  3F3P A;  3OTT A;  4JD2 C;  3KRX B;  4ESG A;  4L9O A;  5HE0 B;  2IUP A;  3AH8 B;  5THA A;  5CYK A;  1MDA H;  4J0W A;  4PSX B;  2CN2 A;  2I3T A;  1U2V C;  1K8K C;  3I8C A;  4CY1 A;  1PGU A;  3EU7 A;  5C2V B;  4CZY A;  4J77 A;  2IAA A;  5FA5 B;  3IIW A;  2HKM A;  4U1E I;  3L4M D;  2PM7 B;  3FGB A;  3CIK B;  5FKT A;  5CXC A;  3EI2 A;  5EMK B;  3A0F A;  1SQJ A;  3EI4 A;  3PSC B;  4O3T B;  4K3J B;  4JSP C;  2OVR B;  2YB8 B;  3PSL A;  4GMB A;  2HES X;  4KFM B;  2I0R A;  2TRC B;  1MG2 A;  2YBA A;  2O9K A;  4H5I A;  4FHL A;  3PVU B;  2OVP B;  4GZ8 A;  1PEV A;  3I7O A;  5FLX g;  3N0D A;  4U7A A;  3SXT D;  3I7P A;  3IJC A;  5HE1 B;  2UZX B;  4A08 B;  4K3I D;  4G56 B;  1R5M A;  2P9U C;  2PBI B;  4CZV A;  2W18 A;  4BUJ C;  2BCJ B;  4GGC A;  1P22 A;  3K26 A;  2J55 H;  2P9N C;  2Z2O A;  1A0R B;  2OVQ B;  4JT5 C;  1JJU B;  3SMR A;  4A0A A;  2I0T A;  2P9K C;  4XYI A;  2B5N A;  1ERJ A;  3SVW D;  3DWL C;  1N6F A;  3BG0 A;  4CI1 A;  4I79 A;  1SHY B;  5JWZ A;  5EAL A;  2YNN A;  5HYN B;  3JPX A;  1Q47 A;  4A09 A;  2H9N A;  3V5W B;  5EM2 A;  1MG3 A;  2IUV A;  4O45 A;  2XL3 A;  4GM3 A;  4E54 B;  2YNO A;  3MMY A;  3MXX A;  4A7J A;  2H3X A;  4ERQ A;  4XYH A;  1VYH C;  5K19 A;  2YMU A;  4JSX C;  4OWR A;  1JMX B;  4MK0 B;  4FA9 D;  1XIP A;  2YNP A;  4L1Q D;  3OKY A;  4PC0 A;  5FKQ A;  3JAM g;  3CFS B;  2XYI A;  4J82 A;  3JRP A;  4O9D A;  3EMH A;  5EAM A;  3GRE A;  5CXB B;  3W15 A;  2G99 A;  3I7K A;  2B5L A;  1K32 A;  4AOW A;  3JB9 L;  2J56 H;  5FXY A;  3I7H A;  3EG6 A;  5SXM A;  5IT9 g;  3EWE A;  3RN0 D;  4LGN A;  1JMZ B;  3RSE C;  3NVQ A;  2AQ5 A;  2MTA H;  2GC7 A;  2XU7 A;  3PXS D;  5IGO A;  3SBQ A;  5FKS A;  1TYQ C;  2CO0 A;  3CFV A;  2H13 A;  2H14 A;  3EI1 B;  2CE8 A;  4TZ4 A;  3MZK A;  2EBS A;  3UVM A;  4GM9 A;  4FWW A;  1NEX B;  3SJL D;  1TBG A;  3F3G A;  4BH6 A;  2BBK H;  3UR4 A;  3ODT A;  5I5J A;  3VGZ A;  5FKR A;  4GM8 A; 
#chains in the Genus database with same CATH topology
 3IUQ A;  4QL1 A;  2AGW A;  1B9Y A;  3RMZ D;  3ULE C;  1C9I A;  4L3H D;  3EQ9 A;  4EWR A;  1VZ2 A;  5IC7 A;  2VDO A;  2HU8 A;  5C92 A;  2EID A;  2VDM A;  2PM9 A;  5IJ8 E;  1YR2 A;  1E8M A;  5E6R A;  1UOQ A;  2AGZ A;  3MVD K;  1H2Y A;  5C9Z B;  2GC4 A;  2UZY B;  2VDQ A;  4R7A B;  3AL8 A;  4X63 B;  5E6U A;  3MKS B;  3VI3 A;  4DNV A;  3RFH A;  3DDU A;  4A0B A;  2HJB A;  5GXI A;  1S4U X;  4FB1 D;  4GGD A;  2CE9 A;  4N14 A;  1JTD B;  5CYK B;  5EAP A;  3RFG A;  2OK6 A;  4UM9 A;  3K71 A;  2B5M A;  2P9L C;  3GD1 I;  2H6N A;  1OMW B;  2H9L A;  4G1E A;  3EQ8 A;  2AH0 A;  3SFZ A;  2HKR A;  2I3S A;  1XHM A;  4BP9 A;  3EI3 B;  4JHP C;  4Z7O A;  3IKO A;  4YVD A;  1U8C A;  4AEZ A;  4DNW A;  3FRX A;  2AGL A;  3OL2 A;  3SHF A;  2VDK A;  3N0E A;  3V4V A;  3OKW A;  2XE4 A;  5CXC B;  5GSA A;  1FWX A;  3BG1 A;  4ZOZ A;  3RRM C;  5EMJ B;  4FAN D;  4GQ2 P;  3SBP A;  2OJY A;  3EI2 B;  2VDR A;  4AN1 A;  1NR0 A;  1GOG A;  4FAV D;  4ZOY A;  4CI3 A;  2AGY A;  3ZWL B;  4D6V A;  2QC5 A;  3PXW D;  3IVM A;  4ES0 A;  1QNI A;  1A12 A;  3KRW B;  3PVW B;  3BWS A;  4PSW B;  1H2Z A;  2H9M A;  1K3I A;  4PNK B;  3UKR C;  2VDL A;  1GXR A;  3MUN A;  4H5J A;  5EAR A;  5B4W A;  4JT6 C;  1PI6 A;  1RI6 A;  5GXH A;  3E0C A;  4PBZ A;  3RLM D;  5EMM B;  2CO0 C;  4IMM A;  5EML B;  3GC3 B;  3IJ1 A;  4HDJ A;  2H68 A;  5HE3 B;  3I7L A;  4G55 A;  3C9C A;  3VH0 A;  2IUQ A;  3DXM C;  2CN3 A;  2G9A A;  5TDH B;  1QFM A;  2PM6 B;  4A0A B;  4NEN A;  2OIZ A;  1JOF A;  3SN6 B;  4RE6 A;  1OLZ A;  5C2W B;  3FCS A;  4A11 B;  5C86 A;  4GQ1 A;  4CY3 A;  2CNX A;  5IJ7 E;  3AFC A;  5TF2 A;  3L4O D;  3K6S A;  4BL0 A;  4J86 A;  4WJK A;  4O3U B;  3C5M A;  3IIY A;  5K1C C;  4A08 A;  2HU7 A;  4J84 A;  4J73 A;  4JSV C;  2Z2N A;  4QQE A;  4X60 B;  3JRO A;  3ORV D;  4A09 B;  3IUJ A;  4ZOV A;  3B7F A;  5EM2 B;  4JSN C;  3I7N A;  5M5U A;  1L0Q A;  4WK2 A;  3J80 g;  2H6K A;  2XDW A;  2H47 A;  3GFC A;  2P9I C;  4CI2 A;  3MKQ A;  4WK4 A;  4OZU A;  4RE5 A;  4BP8 A;  3K27 A;  2HXC A;  2VZ1 A;  4FA5 D;  1YFQ A;  3QI0 A;  5H14 A;  4L1M A;  2Q7Q A;  3RN1 D;  4ERY A;  5IGQ A;  2HJ4 A;  3KCI A;  2J57 G;  3NVX A;  3OKY B;  1BPO A;  3EI3 A;  3HFQ A;  1XKS A;  2QXV A;  5I5I A;  1L5G A;  2QR5 A;  2AGX A;  5TEF A;  4O1Q D;  3O4I A;  3SBR A;  3C75 H;  4QT8 A;  5HE2 B;  4FA4 D;  3MZL A;  3ZE0 A;  2B4E A;  3FM0 A;  5H17 A;  4PBY A;  2XZG A;  1GP2 B;  3I2N A;  4NC4 A;  1N6D A;  4E5Z B;  4O02 A;  4E54 A;  2I0S A;  1E8N A;  4J79 A;  5AFU 3;  2HYE A;  1U4C A;  2GNQ A;  4IA9 A;  5FFG A;  5HQG A;  3UVN A;  4D9S A;  1TYE A;  3O4G A;  3C99 A;  3F3F A;  2OK4 A;  3SCY A;  5A2Q g;  3P4F A;  2IWF A;  4ZOX A;  5M5R A;  4Z8L A;  2P9S C;  1GOH A;  3I89 A;  5FFO A;  4AMZ A;  3U4Y A;  3UVL A;  2XL2 A;  4XEI C;  3T3M A;  4ZN4 A;  3IUM A;  5CXB A;  5AMS A;  4GGA A;  4UI9 R;  2P9P C;  3IJ0 A;  3SLE D;  5GMK n;  1GOF A;  1GG2 B;  4QRJ A;  4D0K A;  1JV2 A;  1N6E A;  4X61 B;  1T2X A;  4PXW A;  3O4J A;  2H6Q A;  5M5T A;  1PBY B;  4JXM A;  3MUO A;  3PE7 A;  4J8B A;  3UVO A;  3ZE1 A;  4MMX A;  4X3E A;  3V9F A;  4CY5 A;  4A11 A;  3EI4 B;  4G1M A;  4J0X A;  5FQD A;  3ZE2 A;  4A2L A;  4CZX A;  3DM0 A;  4CY2 A;  3EI1 A;  2JKX A;  2Z2P A;  3OW8 A;  2PM9 B;  3OKT A;  3NVN A;  1GOT B;  3J81 g;  4LG8 A;  3V7D B;  5KDO B;  3I8E A;  4LG9 A;  4FA1 D;  2H9P A;  4J78 A;  3AL8 B;  1SQ9 A;  4NSX A;  2WQ8 A;  3VA6 A;  4DNU A;  4BCD A;  3PXT D;  3UVK A;  3IUL A;  3JZG A;  3JZH A;  4A0B B;  5H1M A;  3SWS D;  5AJA A;  4GQB B;  3IUN A;  4CC9 A;  4A2M A;  1B9X A;  3AL9 A;  4J8G A;  4ERZ A;  5TEE A;  2AH1 A;  3JZN A;  3DSM A;  4J81 A;  4Z7Q A;  2IWK A;  3DXK C;  4J87 A;  4Y5R D;  3UKU C;  3NIG A;  3O4H A;  1E5T A;  5I5M A;  4L3G D;  4E5Z A;  3OL2 B;  4Y7R A;  4CI8 A;  2HU5 A;  2IUR A;  3F3P A;  3OTT A;  4JD2 C;  3KRX B;  4ESG A;  4L9O A;  5HE0 B;  4BCB A;  2IUP A;  3AH8 B;  5THA A;  5CYK A;  1MDA H;  4J0W A;  4IRZ A;  4PSX B;  2CN2 A;  2I3T A;  1U2V C;  4Z7N A;  3NID A;  1K8K C;  1VE6 A;  3EQ7 A;  3I8C A;  4CY1 A;  1VE7 A;  1PGU A;  2EIE A;  3EU7 A;  3IJE A;  5C2V B;  4CZY A;  2VC2 A;  4J77 A;  2IAA A;  5FA5 B;  3IIW A;  2HKM A;  4U1E I;  4WK0 A;  3L4M D;  2PM7 B;  3FGB A;  3CIK B;  5FKT A;  4UM8 A;  1I2M B;  5CXC A;  3EI2 A;  5HDB A;  5EMK B;  3A0F A;  1SQJ A;  3EI4 A;  3PSC B;  5E6S A;  4O3T B;  4K3J B;  4JSP C;  2OVR B;  2YB8 B;  3PSL A;  4GMB A;  2HES X;  4KFM B;  4QAM A;  2I0R A;  2TRC B;  1MG2 A;  1O6F A;  2YBA A;  3FCU A;  2O9K A;  4H5I A;  4FHL A;  4O2W A;  3PVU B;  4BCC A;  2OVP B;  1O6G A;  4GZ8 A;  1H2W A;  1PEV A;  3I7O A;  5FLX g;  3N0D A;  4U7A A;  3SXT D;  5M5V A;  2EIC A;  3I7P A;  4AN0 A;  3IJC A;  1UTC A;  5HE1 B;  5M61 A;  4AX4 A;  2UZX B;  4A08 B;  1VZ3 A;  1M1X A;  4MMY A;  3ZDZ A;  4K3I D;  4AMY A;  4G56 B;  1R5M A;  2P9U C;  2PBI B;  4CZV A;  2W18 A;  4BUJ C;  4NAA A;  2BCJ B;  4GGC A;  1P22 A;  3K26 A;  2J55 H;  2P9N C;  2Z2O A;  1A0R B;  3T3P A;  2OVQ B;  4JT5 C;  1JJU B;  2VDP A;  3SMR A;  4A0A A;  2I0T A;  2P9K C;  4XYI A;  2B5N A;  4JHN A;  1ERJ A;  3SVW D;  3DWL C;  1H2X A;  1N6F A;  2BKL A;  3BG0 A;  4CI1 A;  4I79 A;  2EIB A;  1SHY B;  3ZDX A;  5JWZ A;  5EAL A;  2YNN A;  5HYN B;  3JPX A;  1Q47 A;  5M5S A;  4A09 A;  2H9N A;  1QFS A;  3V5W B;  5EM2 A;  4MMZ A;  1MG3 A;  2IUV A;  4O45 A;  2XL3 A;  4GM3 A;  4E54 B;  2YNO A;  3MMY A;  3MXX A;  4A7J A;  1C9L A;  2H3X A;  4ERQ A;  4XYH A;  1UOP A;  1VYH C;  5K19 A;  2YMU A;  4JSX C;  4OWR A;  1JMX B;  2VDN A;  4MK0 B;  3NIF A;  3QHY B;  4FA9 D;  1XIP A;  2YNP A;  4L1Q D;  3OKY A;  4PC0 A;  5FKQ A;  3JAM g;  3CFS B;  2XYI A;  4J82 A;  3JRP A;  4O9D A;  3EMH A;  5EAM A;  3GRE A;  5CXB B;  3W15 A;  2G99 A;  3I7K A;  2B5L A;  1K32 A;  4AOW A;  1UOO A;  3JB9 L;  2J56 H;  5FXY A;  3OF7 A;  3I7H A;  3ZDY A;  3EG6 A;  5SXM A;  5IT9 g;  3EWE A;  3RN0 D;  4LGN A;  1JMZ B;  3RSE C;  3NVQ A;  2AQ5 A;  2MTA H;  2GC7 A;  2XU7 A;  3IUR A;  3PXS D;  5IGO A;  3SBQ A;  3V4P A;  5FKS A;  1TYQ C;  2CO0 A;  3CFV A;  3VI4 A;  2H13 A;  2H14 A;  4NBM A;  3EI1 B;  2CE8 A;  4TZ4 A;  2VZ3 A;  3MZK A;  2EBS A;  2QZP A;  3UVM A;  4GM9 A;  4FWW A;  1NEX B;  3SJL D;  1TBG A;  3F3G A;  4BH6 A;  2BBK H;  3UR4 A;  3ODT A;  5I5J A;  3VGZ A;  5FKR A;  3K72 A;  4GM8 A; 
#chains in the Genus database with same CATH homology
 4QL1 A;  2AGW A;  1B9Y A;  3RMZ D;  3ULE C;  4L3H D;  4EWR A;  5IC7 A;  2PM9 A;  5IJ8 E;  2AGZ A;  5C9Z B;  2GC4 A;  2UZY B;  4R7A B;  3AL8 A;  4X63 B;  3MKS B;  3RFH A;  4A0B A;  2HJB A;  5GXI A;  1S4U X;  4FB1 D;  4GGD A;  2CE9 A;  4N14 A;  5CYK B;  5EAP A;  3RFG A;  2OK6 A;  2B5M A;  2P9L C;  2H6N A;  1OMW B;  2H9L A;  2AH0 A;  3SFZ A;  2HKR A;  2I3S A;  1XHM A;  3EI3 B;  3IKO A;  4YVD A;  4AEZ A;  3FRX A;  2AGL A;  3OL2 A;  3SHF A;  3N0E A;  3OKW A;  5CXC B;  5GSA A;  1FWX A;  3BG1 A;  4ZOZ A;  3RRM C;  5EMJ B;  4FAN D;  4GQ2 P;  3SBP A;  2OJY A;  3EI2 B;  1NR0 A;  4FAV D;  4ZOY A;  4CI3 A;  2AGY A;  3ZWL B;  4D6V A;  2QC5 A;  3PXW D;  4ES0 A;  1QNI A;  3KRW B;  3PVW B;  3BWS A;  4PSW B;  2H9M A;  4PNK B;  3UKR C;  1GXR A;  5EAR A;  4H5J A;  5B4W A;  4JT6 C;  1PI6 A;  1RI6 A;  5GXH A;  3E0C A;  4PBZ A;  3RLM D;  5EMM B;  2CO0 C;  4IMM A;  5EML B;  3IJ1 A;  4HDJ A;  2H68 A;  5HE3 B;  3I7L A;  3C9C A;  3VH0 A;  2IUQ A;  3DXM C;  2CN3 A;  2G9A A;  5TDH B;  2PM6 B;  4A0A B;  2OIZ A;  1JOF A;  3SN6 B;  1OLZ A;  5C2W B;  4A11 B;  4GQ1 A;  4CY3 A;  2CNX A;  5IJ7 E;  3AFC A;  5TF2 A;  3L4O D;  4BL0 A;  4J86 A;  4O3U B;  3C5M A;  3IIY A;  5K1C C;  4A08 A;  4J84 A;  4J73 A;  4JSV C;  2Z2N A;  4QQE A;  4X60 B;  3JRO A;  3ORV D;  4A09 B;  4ZOV A;  3B7F A;  5EM2 B;  4JSN C;  3I7N A;  1L0Q A;  3J80 g;  2H6K A;  2H47 A;  3GFC A;  2P9I C;  4CI2 A;  3MKQ A;  4OZU A;  3K27 A;  2HXC A;  4FA5 D;  1YFQ A;  5H14 A;  2Q7Q A;  3RN1 D;  4ERY A;  5IGQ A;  2HJ4 A;  2J57 G;  3NVX A;  3OKY B;  3EI3 A;  3HFQ A;  1XKS A;  2QXV A;  5I5I A;  2AGX A;  5TEF A;  4O1Q D;  3SBR A;  3C75 H;  4QT8 A;  5HE2 B;  4FA4 D;  3MZL A;  2B4E A;  3FM0 A;  5H17 A;  4PBY A;  3I2N A;  1GP2 B;  1N6D A;  4E5Z B;  4E54 A;  2I0S A;  4J79 A;  5AFU 3;  2HYE A;  1U4C A;  2GNQ A;  4IA9 A;  5HQG A;  3UVN A;  3C99 A;  3F3F A;  2OK4 A;  3SCY A;  5A2Q g;  3P4F A;  2IWF A;  4ZOX A;  4Z8L A;  2P9S C;  3I89 A;  3U4Y A;  3UVL A;  2XL2 A;  4XEI C;  4ZN4 A;  5CXB A;  5AMS A;  4GGA A;  4UI9 R;  2P9P C;  3IJ0 A;  3SLE D;  5GMK n;  1GG2 B;  4QRJ A;  4D0K A;  1N6E A;  4X61 B;  4PXW A;  2H6Q A;  1PBY B;  4JXM A;  3PE7 A;  4J8B A;  3UVO A;  4X3E A;  3V9F A;  4CY5 A;  4A11 A;  3EI4 B;  4J0X A;  5FQD A;  4A2L A;  4CZX A;  3DM0 A;  4CY2 A;  3EI1 A;  3OW8 A;  2Z2P A;  2PM9 B;  3OKT A;  3NVN A;  1GOT B;  3J81 g;  4LG8 A;  3V7D B;  5KDO B;  3I8E A;  4LG9 A;  4FA1 D;  2H9P A;  4J78 A;  3AL8 B;  1SQ9 A;  4NSX A;  3VA6 A;  3PXT D;  3UVK A;  3JZG A;  3JZH A;  4A0B B;  5H1M A;  3SWS D;  5AJA A;  4GQB B;  4CC9 A;  4A2M A;  1B9X A;  3AL9 A;  4J8G A;  4ERZ A;  5TEE A;  2AH1 A;  3JZN A;  3DSM A;  4J81 A;  2IWK A;  3DXK C;  4J87 A;  4Y5R D;  3UKU C;  5I5M A;  4E5Z A;  4L3G D;  3OL2 B;  4Y7R A;  4CI8 A;  2IUR A;  3F3P A;  3OTT A;  4JD2 C;  3KRX B;  4ESG A;  4L9O A;  5HE0 B;  2IUP A;  3AH8 B;  5THA A;  5CYK A;  1MDA H;  4J0W A;  4PSX B;  2CN2 A;  2I3T A;  1U2V C;  1K8K C;  3I8C A;  4CY1 A;  1PGU A;  3EU7 A;  5C2V B;  4CZY A;  4J77 A;  2IAA A;  5FA5 B;  3IIW A;  2HKM A;  4U1E I;  3L4M D;  2PM7 B;  3FGB A;  3CIK B;  5FKT A;  5CXC A;  3EI2 A;  5EMK B;  3A0F A;  1SQJ A;  3EI4 A;  3PSC B;  4O3T B;  4K3J B;  4JSP C;  2OVR B;  2YB8 B;  3PSL A;  4GMB A;  2HES X;  4KFM B;  2I0R A;  2TRC B;  1MG2 A;  2YBA A;  2O9K A;  4H5I A;  4FHL A;  3PVU B;  2OVP B;  4GZ8 A;  1PEV A;  3I7O A;  5FLX g;  3N0D A;  4U7A A;  3SXT D;  3I7P A;  3IJC A;  5HE1 B;  2UZX B;  4A08 B;  4K3I D;  4G56 B;  1R5M A;  2P9U C;  2PBI B;  4CZV A;  2W18 A;  4BUJ C;  2BCJ B;  4GGC A;  1P22 A;  3K26 A;  2J55 H;  2P9N C;  2Z2O A;  1A0R B;  2OVQ B;  4JT5 C;  1JJU B;  3SMR A;  4A0A A;  2I0T A;  2P9K C;  4XYI A;  2B5N A;  1ERJ A;  3SVW D;  3DWL C;  1N6F A;  3BG0 A;  4CI1 A;  4I79 A;  1SHY B;  5JWZ A;  5EAL A;  2YNN A;  5HYN B;  3JPX A;  1Q47 A;  4A09 A;  2H9N A;  3V5W B;  5EM2 A;  1MG3 A;  2IUV A;  4O45 A;  2XL3 A;  4GM3 A;  4E54 B;  2YNO A;  3MMY A;  3MXX A;  4A7J A;  2H3X A;  4ERQ A;  4XYH A;  1VYH C;  5K19 A;  2YMU A;  4JSX C;  4OWR A;  1JMX B;  4MK0 B;  4FA9 D;  1XIP A;  2YNP A;  4L1Q D;  3OKY A;  4PC0 A;  5FKQ A;  3JAM g;  3CFS B;  2XYI A;  4J82 A;  3JRP A;  4O9D A;  3EMH A;  5EAM A;  3GRE A;  5CXB B;  3W15 A;  2G99 A;  3I7K A;  2B5L A;  1K32 A;  4AOW A;  3JB9 L;  2J56 H;  5FXY A;  3I7H A;  3EG6 A;  5SXM A;  5IT9 g;  3EWE A;  3RN0 D;  4LGN A;  1JMZ B;  3RSE C;  3NVQ A;  2AQ5 A;  2MTA H;  2GC7 A;  2XU7 A;  3PXS D;  5IGO A;  3SBQ A;  5FKS A;  1TYQ C;  2CO0 A;  3CFV A;  2H13 A;  2H14 A;  3EI1 B;  2CE8 A;  4TZ4 A;  3MZK A;  2EBS A;  3UVM A;  4GM9 A;  4FWW A;  1NEX B;  3SJL D;  1TBG A;  3F3G A;  4BH6 A;  2BBK H;  3UR4 A;  3ODT A;  5I5J A;  3VGZ A;  5FKR A;  4GM8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...