2AH0A

Crystal structure of the carbinolamine intermediate in the reductive half-reaction of aromatic amine dehydrogenase (aadh) with tryptamine. monoclinic form
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
360
structure length
360
Chain Sequence
b'REVLTGGHSVSAPQENRIYVMDSVFMHLTESRVHVYDYTNGKFLGMVPTAFNGHVQVSNDGKKIYTMTTYHERITRGKRSDVVEVWDADKLTFEKEISLPPKRVQGLNYDGLFRQTTDGKFIVLQNASPATSIGIVDVAKGDYVEDVTAAAGCWSVIPQPNRPRSFMTICGDGGLLTINLGEDGKVASQSRSKQMFSVKDDPIFIAPALDKDKAHFVSYYGNVYSADFSGDEVKVDGPWSLLNDEDKAKNWVPGGYNLVGLHRASGRMYVFMHPDGKEGTHKFPAAEIWVMDTKTKQRVARIPGRDALSMTIDQQRNLMLTLDGGNVNVYDISQPEPKLLRTIEGAAEASLQVQFHPVGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aromatic amine dehydrogenase
molecule tags Oxidoreductase
publication title Atomic description of an enzyme reaction dominated by proton tunneling
pubmed doi rcsb
total genus 95
structure length 360
sequence length 360
chains with identical sequence B
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2005-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2ah0A01
1GOTB 5FKQA 3DXKC 4A09B 3CFVA 5EMKB 1NEXB 3PSCB 5IT9g 1P22A 3IKOA 1PBYB 3RLMD 4PC0A 5CYKB 4BUJC 4LG8A 4GMBA 3E0CA 4QRJA 5CXBB 3C99A 4ERQA 3OKWA 2YNNA 5EMLB 5KDOB 2XU7A 3CFSB 5C2WB 3EI1A 2Z2OA 2P9LC 1B9YA 1PGUA 4YVDA 3AFCA 2H14A 3EI3B 4CY1A 3EI1B 3K26A 4CY3A 4EWRA 2G99A 4L1QD 4XEIC 3PXWD 2IAAA 2P9NC 4ZOZA 3OKYB 3SBPA 4E5ZA 3EU7A 4PXWA 4CY5A 5K19A 2P9UC 4GZ8A 5I5JA 4CY2A 2Z2NA 5AMSA 3AH8B 2Z2PA 4JD2C 1GXRA 4JXMA 5TEFA 4FA5D 4TZ4A 2PM9A 3I7HA 4FAVD 2AH1A 2I0TA 3SLED 3DXMC 2OJYA 4A7JA 4K3ID 1S4UX 3EG6A 5CXBA 4A11A 3UKRC 2AGXA 3J80g 2H6KA 4N14A 2I0RA 1L0QA 1K8KC 2BCJB 2G9AA 2AGWA 4JSXC 5I5MA 2P9SC 1N6DA 3DM0A 3JAMg 2HESX 1A0RB 3OKTA 3BG0A 4GGCA 5IGQA 3FGBA 3SJLD 2OVRB 4A09A 5HE3B 2EBSA 3IJ0A 4O9DA 2TRCB 3CIKB 4FA4D 3PXTD 4H5JA 5HE1B 1GG2B 2H9MA 4X63B 3ORVD 1Q47A 3IJCA 4BH6A 3KRXB 3RFHA 4JSNC 3KRWB 3MXXA 4A0AA 3MKSB 5HQGA 2B5MA 3PXSD 4ESGA 2IUVA 3PVUB 3V9FA 3BG1A 2H9PA 3UVOA 3OKYA 3AL8B 3AL9A 2GC7A 3F3GA 4G56B 4ZOYA 2W18A 1B9XA 4O45A 2OK6A 5HE2B 5HE0B 3C75H 3EI4B 4O3TB 4GM3A 3EI2A 4XYHA 4XYIA 2H6QA 3SHFA 3GREA 5IJ7E 1ERJA 3ODTA 5CXCB 4CC9A 3EI2B 1OLZA 4CI2A 2J55H 1N6EA 3OL2A 2P9PC 3N0EA 3SBRA 4MK0B 2HKRA 4J0XA 4J77A 4CI3A 5JWZA 4PNKB 2QXVA 5SXMA 3UVNA 5H17A 4J8BA 5TEEA 2H9NA 3I8EA 1XHMA 5EALA 2GNQA 5HYNB 4J84A 4J82A 4GM9A 2YB8B 4NSXA 3IIWA 3C5MA 3DWLC 2CN3A 4GGAA 2P9IC 5TDHB 3VH0A 5GXHA 4GQ2P 4U7AA 4J8GA 1U2VC 3IIYA 3I8CA 5EAMA 5GSAA 4R7AB 4J73A 2YBAA 2AGLA 1N6FA 4J86A 3RRMC 4D0KA 4CI8A 1YFQA 5FKTA 3MZLA 4L3HD 5FLXg 2I0SA 2PBIB 2H68A 1R5MA 3JROA 3MZKA 5EM2B 4J0WA 4PBYA 4LGNA 4QT8A 1U4CA 1K32A 4E54B 4ERYA 5CYKA 4AOWA 2PM6B 5EMJB 1XKSA 2B5NA 2CO0A 5H14A 5C9ZB 5TF2A 3F3FA 3I7LA 4Z8LA 2CN2A 5FKRA 4A0BA 1MG2A 3MKQA 1JJUB 2HJBA 2AGZA 4ZOXA 2GC4A 3FRXA 2B5LA 2YNPA 2CE9A 3SFZA 4U1EI 4BL0A 4X60B 4CZYA 4UI9R 3SMRA 4CZVA 3JZGA 3OTTA 1MDAH 4ERZA 2H6NA 1NR0A 3PVWB 5I5IA 2B4EA 2H13A 4FA9D 3NVXA 4AEZA 2MTAH 3J81g 3IJ1A 1OMWB 4PBZA 4QQEA 4CZXA 3I7PA 1JMXB 3B7FA 1PEVA 2AH0A 1RI6A 3UKUC 3RSEC 2HYEA 2P9KC 3FM0A 3NVQA 5CXCA 4A08B 4L9OA 4I79A 3W15A 5EM2A 2QC5A 5IJ8E 3HFQA 3EI4A 4OZUA 3RN1D 4Y7RA 4GGDA 4Y5RD 2XL2A 4O1QD 3GFCA 2HJ4A 3DSMA 2UZXB 4J87A 2HKMA 3A0FA 3JZHA 3UVMA 2XYIA 3UR4A 3EMHA 2CO0C 1SQ9A 4PSWB 3UVLA 3V7DB 1MG3A 3SVWD 5FXYA 1XIPA 2CNXA 4KFMB 2OVQB 2IWFA 3SXTD 1SHYB 5FKSA 4IA9A 5B4WA 1TYQC 5FA5B 2I3SA 4FAND 3JZNA 3SBQA 3EWEA 4J79A 5AJAA 5GXIA 3F3PA 2OVPB 3OW8A 3I7NA 4E5ZB 2J57G 3EI3A 3ULEC 3P4FA 4X3EA 3L4MD 4X61B 4JSVC 4O3UB 4HDJA 2Q7QA 5IC7A 2UZYB 4LG9A 4A2LA 2I3TA 4A0AB 5AFU3 4PSXB 4A0BB 2AGYA 4GQBB 3AL8A 3SWSD 3OL2B 2O9KA 4A11B 1SQJA 2OIZA 3C9CA 4GQ1A 5C2VB 1QNIA 2OK4A 4E54A 5EMMB 4OWRA 1TBGA 4K3JB 3RMZD 3V5WB 3I89A 5EAPA 3NVNA 4D6VA 1PI6A 4FHLA 4IMMA 4A2MA 2J56H 2BBKH 2PM7B 3K27A 3VGZA 5FQDA 3ZWLB 1JMZB 3VA6A 2YNOA 4FWWA 3JPXA 4FB1D 3RN0D 3JB9L 1VYHC 2YMUA 2HXCA 5A2Qg 2H3XA 4ZN4A 5IGOA 3U4YA 3JRPA 4JT6C 4ES0A 2IUPA 3I2NA 3SCYA 1JOFA 4J78A 2PM9B 4FA1D 2IWKA 2AQ5A 5THAA 2IURA 3N0DA 3L4OD 4L3GD 2XL3A 5H1MA 4GM8A 4H5IA 2CE8A 5EARA 3RFGA 1FWXA 4JSPC 3MMYA 5GMKn 4A08A 4J81A 4QL1A 3BWSA 2IUQA 3PE7A 4JT5C 2H47A 2H9LA 5K1CC 4ZOVA 4CI1A 3I7KA 3PSLA 3I7OA 3UVKA 3SN6B 1GP2B
chains in the Genus database with same CATH superfamily
1GOTB 5FKQA 3DXKC 4A09B 3V4PA 3CFVA 5EMKB 1NEXB 3PSCB 3VI4A 5IT9g 1P22A 3IKOA 1PBYB 3RLMD 3MVDK 4PC0A 5CYKB 4BUJC 1O6GA 4LG8A 4GMBA 3E0CA 4QRJA 5CXBB 3C99A 4ERQA 3ZE0A 5M5RA 3OKWA 2YNNA 1JTDB 2XE4A 5EMLB 1UOPA 5KDOB 2XU7A 1UOOA 3CFSB 5C2WB 3EI1A 2Z2OA 2P9LC 1B9YA 4MMXA 1PGUA 2QR5A 4YVDA 3AFCA 2H14A 3EI3B 4CY1A 3EI1B 3K26A 3ZDXA 4CY3A 4EWRA 2G99A 4L1QD 3EQ9A 4XEIC 3PXWD 2IAAA 2P9NC 4ZOZA 3OKYB 3SBPA 4E5ZA 3EU7A 4PXWA 4CY5A 1VZ2A 5K19A 3NIDA 2P9UC 4GZ8A 3IUNA 5I5JA 4CY2A 2Z2NA 5AMSA 3AH8B 2Z2PA 4JD2C 3K71A 1GXRA 4IRZA 2BKLA 4JXMA 5TEFA 1GOHA 4FA5D 4TZ4A 2PM9A 3OF7A 3I7HA 4D9SA 4FAVD 4NENA 2AH1A 2I0TA 3SLED 3DXMC 2OJYA 4A7JA 4K3ID 1S4UX 3EG6A 5CXBA 4A11A 3UKRC 2AGXA 1UOQA 3J80g 2H6KA 4N14A 2I0RA 1L0QA 1K8KC 2BCJB 2G9AA 4WK2A 2AGWA 4JSXC 5I5MA 2P9SC 1N6DA 3DM0A 3JAMg 2HESX 5M5SA 1A0RB 3OKTA 2EIDA 3BG0A 4GGCA 4BCDA 3K72A 5IGQA 3FGBA 4WJKA 3SJLD 1VZ3A 2OVRB 4A09A 2QZPA 5HE3B 2EBSA 1UTCA 3IJ0A 4O9DA 4JHPC 2TRCB 3CIKB 3NIGA 4FA4D 3EQ8A 4G1MA 3PXTD 4H5JA 3EQ7A 1GOFA 5HE1B 1GG2B 2H9MA 4AN1A 1VE6A 1O6FA 4X63B 3ORVD 1Q47A 2EICA 3IJCA 4BH6A 3KRXB 1L5GA 3RFHA 1K3IA 4JSNC 3KRWB 3MXXA 4A0AA 3FCUA 1A12A 3MKSB 5HQGA 1I2MB 2B5MA 3PXSD 4ESGA 2IUVA 3PVUB 3V9FA 3BG1A 3O4GA 5M5TA 2H9PA 3UVOA 3OKYA 3AL8B 3AL9A 2GC7A 3F3GA 4G56B 4ZOYA 2W18A 1BPOA 1B9XA 1H2YA 3IJEA 4O45A 3V4VA 2OK6A 5HE2B 5HE0B 3C75H 3EI4B 4O3TB 4GM3A 3EI2A 4MMYA 4XYHA 4XYIA 2H6QA 3SHFA 3GREA 3O4HA 4RE5A 4WK4A 5IJ7E 1ERJA 3ODTA 5CXCB 4CC9A 3EI2B 1OLZA 4CI2A 2J55H 1N6EA 3OL2A 2P9PC 3N0EA 3SBRA 2HU7A 4DNVA 3IURA 4MK0B 2HKRA 4J0XA 4J77A 4CI3A 5JWZA 1E5TA 4PNKB 2QXVA 5SXMA 3UVNA 5H17A 4J8BA 5TEEA 3IULA 2H9NA 3I8EA 1XHMA 4G55A 5EALA 2GNQA 5HYNB 1GOGA 1C9LA 4J84A 4J82A 2EIEA 1C9IA 4GM9A 2YB8B 4NSXA 1H2XA 3IIWA 1JV2A 3C5MA 3DWLC 2CN3A 4G1EA 4GGAA 2P9IC 5E6UA 3QI0A 5TDHB 3VH0A 5GXHA 4GQ2P 4U7AA 4J8GA 1U2VC 2VDQA 3IIYA 3I8CA 5EAMA 5GSAA 4R7AB 4J73A 5M61A 2YBAA 2AGLA 1N6FA 4J86A 4RE6A 3RRMC 4BP8A 4D0KA 4CI8A 1YFQA 5FKTA 3MZLA 4L3HD 5FLXg 2I0SA 2PBIB 2H68A 1R5MA 3JROA 3MZKA 2VDNA 5EM2B 4J0WA 4BCCA 4PBYA 4LGNA 4QT8A 1U4CA 1E8NA 1K32A 4E54B 4ERYA 5FFOA 5CYKA 4Z7OA 4AOWA 2PM6B 3ZE1A 4MMZA 5EMJB 1XKSA 2B5NA 4O02A 2CO0A 5H14A 5C9ZB 5FFGA 5TF2A 3KCIA 3F3FA 3I7LA 4Z8LA 3O4IA 2CN2A 4NC4A 5FKRA 4A0BA 4UM8A 1MG2A 3MKQA 1JJUB 2HJBA 2AGZA 4ZOXA 3ZE2A 2GC4A 1M1XA 3FRXA 2B5LA 2YNPA 2CE9A 4DNWA 3SFZA 4U1EI 4BL0A 4X60B 4CZYA 5M5VA 4UI9R 3DDUA 3GD1I 3SMRA 3T3PA 4CZVA 3JZGA 3OTTA 1MDAH 4ERZA 2H6NA 1NR0A 3PVWB 5I5IA 2B4EA 2H13A 4FA9D 5C92A 3NVXA 4AEZA 2MTAH 5C86A 3J81g 3IJ1A 1OMWB 4NAAA 3O4JA 4PBZA 4QQEA 2XDWA 4CZXA 3I7PA 1JMXB 3B7FA 1PEVA 2VDOA 2AH0A 4Z7QA 1RI6A 4AX4A 3UKUC 3RSEC 2HYEA 2P9KC 3FM0A 2VZ1A 3NVQA 5CXCA 4A08B 4L9OA 4I79A 4AN0A 3QHYB 3W15A 5EM2A 2QC5A 5IJ8E 3HFQA 2HU5A 3EI4A 4OZUA 2HU8A 3RN1D 4Y7RA 4GGDA 4Y5RD 2XL2A 1H2ZA 4O1QD 3GFCA 3T3MA 2HJ4A 4L1MA 3DSMA 2VDMA 2UZXB 3VI3A 4J87A 2HKMA 3A0FA 3JZHA 3UVMA 2XYIA 3UR4A 4JHNA 3EMHA 2CO0C 1SQ9A 4PSWB 3UVLA 3V7DB 1MG3A 3SVWD 5FXYA 1XIPA 3NIFA 2CNXA 1VE7A 4KFMB 2OVQB 2IWFA 3SXTD 1SHYB 5FKSA 4O2WA 2EIBA 4IA9A 5B4WA 3IUMA 3MUNA 1TYQC 5FA5B 2I3SA 4FAND 3JZNA 3SBQA 2VDLA 3EWEA 4J79A 5AJAA 5GXIA 3F3PA 2OVPB 3OW8A 4AMZA 3I7NA 4E5ZB 2VDRA 2WQ8A 2J57G 3IVMA 4Z7NA 3EI3A 4UM9A 3ULEC 3P4FA 4X3EA 3L4MD 4X61B 5M5UA 4JSVC 4O3UB 3IUJA 1QFMA 3GC3B 2Q7QA 4HDJA 5IC7A 2UZYB 4LG9A 4A2LA 2I3TA 4A0AB 3FCSA 5AFU3 1TYEA 4PSXB 4A0BB 2AGYA 4GQBB 3AL8A 4NBMA 3SWSD 3OL2B 1T2XA 2O9KA 4A11B 1SQJA 2OIZA 3IUQA 3C9CA 4GQ1A 5C2VB 1QNIA 2OK4A 4E54A 1QFSA 5EMMB 1YR2A 4OWRA 1TBGA 4K3JB 3RMZD 3V5WB 3I89A 5EAPA 2VDKA 3NVNA 1PI6A 4D6VA 4FHLA 4IMMA 2VZ3A 3ZDZA 1H2WA 4A2MA 2J56H 2BBKH 2PM7B 3K27A 3VGZA 2VC2A 5FQDA 3ZWLB 1JMZB 3VA6A 2YNOA 4FWWA 3JPXA 4FB1D 3RN0D 3JB9L 5E6RA 1VYHC 5HDBA 2YMUA 2HXCA 3K6SA 5A2Qg 2H3XA 4ZN4A 5IGOA 3U4YA 3JRPA 4JT6C 4ES0A 2IUPA 3I2NA 3SCYA 1JOFA 4J78A 2PM9B 4BP9A 4FA1D 4QAMA 2IWKA 2AQ5A 5THAA 2IURA 3N0DA 3L4OD 4L3GD 4WK0A 3MUOA 2XL3A 5H1MA 2JKXA 4GM8A 2CE8A 4H5IA 5EARA 3RFGA 4AMYA 1FWXA 4JSPC 2VDPA 3MMYA 5GMKn 4A08A 4J81A 4QL1A 3BWSA 1U8CA 2IUQA 3PE7A 4JT5C 2H47A 5E6SA 2H9LA 5K1CC 4ZOVA 4CI1A 3I7KA 3PSLA 3ZDYA 4DNUA 3I7OA 3UVKA 2XZGA 3SN6B 4BCBA 1E8MA 1GP2B
chains in the Genus database with same CATH topology
1GOTB 5FKQA 3DXKC 4A09B 3CFVA 5EMKB 1NEXB 3PSCB 5IT9g 1P22A 3IKOA 1PBYB 3RLMD 4PC0A 5CYKB 4BUJC 4LG8A 4GMBA 3E0CA 4QRJA 5CXBB 3C99A 4ERQA 3OKWA 2YNNA 5EMLB 5KDOB 2XU7A 3CFSB 5C2WB 3EI1A 2Z2OA 2P9LC 1B9YA 1PGUA 4YVDA 3AFCA 2H14A 3EI3B 4CY1A 3EI1B 3K26A 4CY3A 4EWRA 2G99A 4L1QD 4XEIC 3PXWD 2IAAA 2P9NC 4ZOZA 3OKYB 3SBPA 4E5ZA 3EU7A 4PXWA 4CY5A 5K19A 2P9UC 4GZ8A 5I5JA 4CY2A 2Z2NA 5AMSA 3AH8B 2Z2PA 4JD2C 1GXRA 4JXMA 5TEFA 4FA5D 4TZ4A 2PM9A 3I7HA 4FAVD 2AH1A 2I0TA 3SLED 3DXMC 2OJYA 4A7JA 4K3ID 1S4UX 3EG6A 5CXBA 4A11A 3UKRC 2AGXA 3J80g 2H6KA 4N14A 2I0RA 1L0QA 1K8KC 2BCJB 2G9AA 2AGWA 4JSXC 5I5MA 2P9SC 1N6DA 3DM0A 3JAMg 2HESX 1A0RB 3OKTA 3BG0A 4GGCA 5IGQA 3FGBA 3SJLD 2OVRB 4A09A 5HE3B 2EBSA 3IJ0A 4O9DA 2TRCB 3CIKB 4FA4D 3PXTD 4H5JA 5HE1B 1GG2B 2H9MA 4X63B 3ORVD 1Q47A 3IJCA 4BH6A 3KRXB 3RFHA 4JSNC 3KRWB 3MXXA 4A0AA 3MKSB 5HQGA 2B5MA 3PXSD 4ESGA 2IUVA 3PVUB 3V9FA 3BG1A 2H9PA 3UVOA 3OKYA 3AL8B 3AL9A 2GC7A 3F3GA 4G56B 4ZOYA 2W18A 1B9XA 4O45A 2OK6A 5HE2B 5HE0B 3C75H 3EI4B 4O3TB 4GM3A 3EI2A 4XYHA 4XYIA 2H6QA 3SHFA 3GREA 5IJ7E 1ERJA 3ODTA 5CXCB 4CC9A 3EI2B 1OLZA 4CI2A 2J55H 1N6EA 3OL2A 2P9PC 3N0EA 3SBRA 4MK0B 2HKRA 4J0XA 4J77A 4CI3A 5JWZA 4PNKB 2QXVA 5SXMA 3UVNA 5H17A 4J8BA 5TEEA 2H9NA 3I8EA 1XHMA 5EALA 2GNQA 5HYNB 4J84A 4J82A 4GM9A 2YB8B 4NSXA 3IIWA 3C5MA 3DWLC 2CN3A 4GGAA 2P9IC 5TDHB 3VH0A 5GXHA 4GQ2P 4U7AA 4J8GA 1U2VC 3IIYA 3I8CA 5EAMA 5GSAA 4R7AB 4J73A 2YBAA 2AGLA 1N6FA 4J86A 3RRMC 4D0KA 4CI8A 1YFQA 5FKTA 3MZLA 4L3HD 5FLXg 2I0SA 2PBIB 2H68A 1R5MA 3JROA 3MZKA 5EM2B 4J0WA 4PBYA 4LGNA 4QT8A 1U4CA 1K32A 4E54B 4ERYA 5CYKA 4AOWA 2PM6B 5EMJB 1XKSA 2B5NA 2CO0A 5H14A 5C9ZB 5TF2A 3F3FA 3I7LA 4Z8LA 2CN2A 5FKRA 4A0BA 1MG2A 3MKQA 1JJUB 2HJBA 2AGZA 4ZOXA 2GC4A 3FRXA 2B5LA 2YNPA 2CE9A 3SFZA 4U1EI 4BL0A 4X60B 4CZYA 4UI9R 3SMRA 4CZVA 3JZGA 3OTTA 1MDAH 4ERZA 2H6NA 1NR0A 3PVWB 5I5IA 2B4EA 2H13A 4FA9D 3NVXA 4AEZA 2MTAH 3J81g 3IJ1A 1OMWB 4PBZA 4QQEA 4CZXA 3I7PA 1JMXB 3B7FA 1PEVA 2AH0A 1RI6A 3UKUC 3RSEC 2HYEA 2P9KC 3FM0A 3NVQA 5CXCA 4A08B 4L9OA 4I79A 3W15A 5EM2A 2QC5A 5IJ8E 3HFQA 3EI4A 4OZUA 3RN1D 4Y7RA 4GGDA 4Y5RD 2XL2A 4O1QD 3GFCA 2HJ4A 3DSMA 2UZXB 4J87A 2HKMA 3A0FA 3JZHA 3UVMA 2XYIA 3UR4A 3EMHA 2CO0C 1SQ9A 4PSWB 3UVLA 3V7DB 1MG3A 3SVWD 5FXYA 1XIPA 2CNXA 4KFMB 2OVQB 2IWFA 3SXTD 1SHYB 5FKSA 4IA9A 5B4WA 1TYQC 5FA5B 2I3SA 4FAND 3JZNA 3SBQA 3EWEA 4J79A 5AJAA 5GXIA 3F3PA 2OVPB 3OW8A 3I7NA 4E5ZB 2J57G 3EI3A 3ULEC 3P4FA 4X3EA 3L4MD 4X61B 4JSVC 4O3UB 4HDJA 2Q7QA 5IC7A 2UZYB 4LG9A 4A2LA 2I3TA 4A0AB 5AFU3 4PSXB 4A0BB 2AGYA 4GQBB 3AL8A 3SWSD 3OL2B 2O9KA 4A11B 1SQJA 2OIZA 3C9CA 4GQ1A 5C2VB 1QNIA 2OK4A 4E54A 5EMMB 4OWRA 1TBGA 4K3JB 3RMZD 3V5WB 3I89A 5EAPA 3NVNA 4D6VA 1PI6A 4FHLA 4IMMA 4A2MA 2J56H 2BBKH 2PM7B 3K27A 3VGZA 5FQDA 3ZWLB 1JMZB 3VA6A 2YNOA 4FWWA 3JPXA 4FB1D 3RN0D 3JB9L 1VYHC 2YMUA 2HXCA 5A2Qg 2H3XA 4ZN4A 5IGOA 3U4YA 3JRPA 4JT6C 4ES0A 2IUPA 3I2NA 3SCYA 1JOFA 4J78A 2PM9B 4FA1D 2IWKA 2AQ5A 5THAA 2IURA 3N0DA 3L4OD 4L3GD 2XL3A 5H1MA 4GM8A 4H5IA 2CE8A 5EARA 3RFGA 1FWXA 4JSPC 3MMYA 5GMKn 4A08A 4J81A 4QL1A 3BWSA 2IUQA 3PE7A 4JT5C 2H47A 2H9LA 5K1CC 4ZOVA 4CI1A 3I7KA 3PSLA 3I7OA 3UVKA 3SN6B 1GP2B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GOT B;  5FKQ A;  3DXK C;  4A09 B;  3CFV A;  5EMK B;  1NEX B;  3PSC B;  5IT9 g;  1P22 A;  3IKO A;  1PBY B;  3RLM D;  4PC0 A;  5CYK B;  4BUJ C;  4LG8 A;  4GMB A;  3E0C A;  4QRJ A;  5CXB B;  3C99 A;  4ERQ A;  3OKW A;  2YNN A;  5EML B;  5KDO B;  2XU7 A;  3CFS B;  5C2W B;  3EI1 A;  2Z2O A;  2P9L C;  1B9Y A;  1PGU A;  4YVD A;  3AFC A;  2H14 A;  3EI3 B;  4CY1 A;  3EI1 B;  3K26 A;  4CY3 A;  4EWR A;  2G99 A;  4L1Q D;  4XEI C;  3PXW D;  2IAA A;  2P9N C;  4ZOZ A;  3OKY B;  3SBP A;  4E5Z A;  3EU7 A;  4PXW A;  4CY5 A;  5K19 A;  2P9U C;  4GZ8 A;  5I5J A;  4CY2 A;  2Z2N A;  5AMS A;  3AH8 B;  2Z2P A;  4JD2 C;  1GXR A;  4JXM A;  5TEF A;  4FA5 D;  4TZ4 A;  2PM9 A;  3I7H A;  4FAV D;  2AH1 A;  2I0T A;  3SLE D;  3DXM C;  2OJY A;  4A7J A;  4K3I D;  1S4U X;  3EG6 A;  5CXB A;  4A11 A;  3UKR C;  2AGX A;  3J80 g;  2H6K A;  4N14 A;  2I0R A;  1L0Q A;  1K8K C;  2BCJ B;  2G9A A;  2AGW A;  4JSX C;  5I5M A;  2P9S C;  1N6D A;  3DM0 A;  3JAM g;  2HES X;  1A0R B;  3OKT A;  3BG0 A;  4GGC A;  5IGQ A;  3FGB A;  3SJL D;  2OVR B;  4A09 A;  5HE3 B;  2EBS A;  3IJ0 A;  4O9D A;  2TRC B;  3CIK B;  4FA4 D;  3PXT D;  4H5J A;  5HE1 B;  1GG2 B;  2H9M A;  4X63 B;  3ORV D;  1Q47 A;  3IJC A;  4BH6 A;  3KRX B;  3RFH A;  4JSN C;  3KRW B;  3MXX A;  4A0A A;  3MKS B;  5HQG A;  2B5M A;  3PXS D;  4ESG A;  2IUV A;  3PVU B;  3V9F A;  3BG1 A;  2H9P A;  3UVO A;  3OKY A;  3AL8 B;  3AL9 A;  2GC7 A;  3F3G A;  4G56 B;  4ZOY A;  2W18 A;  1B9X A;  4O45 A;  2OK6 A;  5HE2 B;  5HE0 B;  3C75 H;  3EI4 B;  4O3T B;  4GM3 A;  3EI2 A;  4XYH A;  4XYI A;  2H6Q A;  3SHF A;  3GRE A;  5IJ7 E;  1ERJ A;  3ODT A;  5CXC B;  4CC9 A;  3EI2 B;  1OLZ A;  4CI2 A;  2J55 H;  1N6E A;  3OL2 A;  2P9P C;  3N0E A;  3SBR A;  4MK0 B;  2HKR A;  4J0X A;  4J77 A;  4CI3 A;  5JWZ A;  4PNK B;  2QXV A;  5SXM A;  3UVN A;  5H17 A;  4J8B A;  5TEE A;  2H9N A;  3I8E A;  1XHM A;  5EAL A;  2GNQ A;  5HYN B;  4J84 A;  4J82 A;  4GM9 A;  2YB8 B;  4NSX A;  3IIW A;  3C5M A;  3DWL C;  2CN3 A;  4GGA A;  2P9I C;  5TDH B;  3VH0 A;  5GXH A;  4GQ2 P;  4U7A A;  4J8G A;  1U2V C;  3IIY A;  3I8C A;  5EAM A;  5GSA A;  4R7A B;  4J73 A;  2YBA A;  2AGL A;  1N6F A;  4J86 A;  3RRM C;  4D0K A;  4CI8 A;  1YFQ A;  5FKT A;  3MZL A;  4L3H D;  5FLX g;  2I0S A;  2PBI B;  2H68 A;  1R5M A;  3JRO A;  3MZK A;  5EM2 B;  4J0W A;  4PBY A;  4LGN A;  4QT8 A;  1U4C A;  1K32 A;  4E54 B;  4ERY A;  5CYK A;  4AOW A;  2PM6 B;  5EMJ B;  1XKS A;  2B5N A;  2CO0 A;  5H14 A;  5C9Z B;  5TF2 A;  3F3F A;  3I7L A;  4Z8L A;  2CN2 A;  5FKR A;  4A0B A;  1MG2 A;  3MKQ A;  1JJU B;  2HJB A;  2AGZ A;  4ZOX A;  2GC4 A;  3FRX A;  2B5L A;  2YNP A;  2CE9 A;  3SFZ A;  4U1E I;  4BL0 A;  4X60 B;  4CZY A;  4UI9 R;  3SMR A;  4CZV A;  3JZG A;  3OTT A;  1MDA H;  4ERZ A;  2H6N A;  1NR0 A;  3PVW B;  5I5I A;  2B4E A;  2H13 A;  4FA9 D;  3NVX A;  4AEZ A;  2MTA H;  3J81 g;  3IJ1 A;  1OMW B;  4PBZ A;  4QQE A;  4CZX A;  3I7P A;  1JMX B;  3B7F A;  1PEV A;  2AH0 A;  1RI6 A;  3UKU C;  3RSE C;  2HYE A;  2P9K C;  3FM0 A;  3NVQ A;  5CXC A;  4A08 B;  4L9O A;  4I79 A;  3W15 A;  5EM2 A;  2QC5 A;  5IJ8 E;  3HFQ A;  3EI4 A;  4OZU A;  3RN1 D;  4Y7R A;  4GGD A;  4Y5R D;  2XL2 A;  4O1Q D;  3GFC A;  2HJ4 A;  3DSM A;  2UZX B;  4J87 A;  2HKM A;  3A0F A;  3JZH A;  3UVM A;  2XYI A;  3UR4 A;  3EMH A;  2CO0 C;  1SQ9 A;  4PSW B;  3UVL A;  3V7D B;  1MG3 A;  3SVW D;  5FXY A;  1XIP A;  2CNX A;  4KFM B;  2OVQ B;  2IWF A;  3SXT D;  1SHY B;  5FKS A;  4IA9 A;  5B4W A;  1TYQ C;  5FA5 B;  2I3S A;  4FAN D;  3JZN A;  3SBQ A;  3EWE A;  4J79 A;  5AJA A;  5GXI A;  3F3P A;  2OVP B;  3OW8 A;  3I7N A;  4E5Z B;  2J57 G;  3EI3 A;  3ULE C;  3P4F A;  4X3E A;  3L4M D;  4X61 B;  4JSV C;  4O3U B;  4HDJ A;  2Q7Q A;  5IC7 A;  2UZY B;  4LG9 A;  4A2L A;  2I3T A;  4A0A B;  5AFU 3;  4PSX B;  4A0B B;  2AGY A;  4GQB B;  3AL8 A;  3SWS D;  3OL2 B;  2O9K A;  4A11 B;  1SQJ A;  2OIZ A;  3C9C A;  4GQ1 A;  5C2V B;  1QNI A;  2OK4 A;  4E54 A;  5EMM B;  4OWR A;  1TBG A;  4K3J B;  3RMZ D;  3V5W B;  3I89 A;  5EAP A;  3NVN A;  4D6V A;  1PI6 A;  4FHL A;  4IMM A;  4A2M A;  2J56 H;  2BBK H;  2PM7 B;  3K27 A;  3VGZ A;  5FQD A;  3ZWL B;  1JMZ B;  3VA6 A;  2YNO A;  4FWW A;  3JPX A;  4FB1 D;  3RN0 D;  3JB9 L;  1VYH C;  2YMU A;  2HXC A;  5A2Q g;  2H3X A;  4ZN4 A;  5IGO A;  3U4Y A;  3JRP A;  4JT6 C;  4ES0 A;  2IUP A;  3I2N A;  3SCY A;  1JOF A;  4J78 A;  2PM9 B;  4FA1 D;  2IWK A;  2AQ5 A;  5THA A;  2IUR A;  3N0D A;  3L4O D;  4L3G D;  2XL3 A;  5H1M A;  4GM8 A;  4H5I A;  2CE8 A;  5EAR A;  3RFG A;  1FWX A;  4JSP C;  3MMY A;  5GMK n;  4A08 A;  4J81 A;  4QL1 A;  3BWS A;  2IUQ A;  3PE7 A;  4JT5 C;  2H47 A;  2H9L A;  5K1C C;  4ZOV A;  4CI1 A;  3I7K A;  3PSL A;  3I7O A;  3UVK A;  3SN6 B;  1GP2 B; 
#chains in the Genus database with same CATH topology
 1GOT B;  5FKQ A;  3DXK C;  4A09 B;  3V4P A;  3CFV A;  5EMK B;  1NEX B;  3PSC B;  3VI4 A;  5IT9 g;  1P22 A;  3IKO A;  1PBY B;  3RLM D;  3MVD K;  4PC0 A;  5CYK B;  4BUJ C;  1O6G A;  4LG8 A;  4GMB A;  3E0C A;  4QRJ A;  5CXB B;  3C99 A;  4ERQ A;  3ZE0 A;  5M5R A;  3OKW A;  2YNN A;  1JTD B;  2XE4 A;  5EML B;  1UOP A;  5KDO B;  2XU7 A;  1UOO A;  3CFS B;  5C2W B;  3EI1 A;  2Z2O A;  2P9L C;  1B9Y A;  4MMX A;  1PGU A;  2QR5 A;  4YVD A;  3AFC A;  2H14 A;  3EI3 B;  4CY1 A;  3EI1 B;  3K26 A;  3ZDX A;  4CY3 A;  4EWR A;  2G99 A;  4L1Q D;  3EQ9 A;  4XEI C;  3PXW D;  2IAA A;  2P9N C;  4ZOZ A;  3OKY B;  3SBP A;  4E5Z A;  3EU7 A;  4PXW A;  4CY5 A;  1VZ2 A;  5K19 A;  3NID A;  2P9U C;  4GZ8 A;  3IUN A;  5I5J A;  4CY2 A;  2Z2N A;  5AMS A;  3AH8 B;  2Z2P A;  4JD2 C;  3K71 A;  1GXR A;  4IRZ A;  2BKL A;  4JXM A;  5TEF A;  1GOH A;  4FA5 D;  4TZ4 A;  2PM9 A;  3OF7 A;  3I7H A;  4D9S A;  4FAV D;  4NEN A;  2AH1 A;  2I0T A;  3SLE D;  3DXM C;  2OJY A;  4A7J A;  4K3I D;  1S4U X;  3EG6 A;  5CXB A;  4A11 A;  3UKR C;  2AGX A;  1UOQ A;  3J80 g;  2H6K A;  4N14 A;  2I0R A;  1L0Q A;  1K8K C;  2BCJ B;  2G9A A;  4WK2 A;  2AGW A;  4JSX C;  5I5M A;  2P9S C;  1N6D A;  3DM0 A;  3JAM g;  2HES X;  5M5S A;  1A0R B;  3OKT A;  2EID A;  3BG0 A;  4GGC A;  4BCD A;  3K72 A;  5IGQ A;  3FGB A;  4WJK A;  3SJL D;  1VZ3 A;  2OVR B;  4A09 A;  2QZP A;  5HE3 B;  2EBS A;  1UTC A;  3IJ0 A;  4O9D A;  4JHP C;  2TRC B;  3CIK B;  3NIG A;  4FA4 D;  3EQ8 A;  4G1M A;  3PXT D;  4H5J A;  3EQ7 A;  1GOF A;  5HE1 B;  1GG2 B;  2H9M A;  4AN1 A;  1VE6 A;  1O6F A;  4X63 B;  3ORV D;  1Q47 A;  2EIC A;  3IJC A;  4BH6 A;  3KRX B;  1L5G A;  3RFH A;  1K3I A;  4JSN C;  3KRW B;  3MXX A;  4A0A A;  3FCU A;  1A12 A;  3MKS B;  5HQG A;  1I2M B;  2B5M A;  3PXS D;  4ESG A;  2IUV A;  3PVU B;  3V9F A;  3BG1 A;  3O4G A;  5M5T A;  2H9P A;  3UVO A;  3OKY A;  3AL8 B;  3AL9 A;  2GC7 A;  3F3G A;  4G56 B;  4ZOY A;  2W18 A;  1BPO A;  1B9X A;  1H2Y A;  3IJE A;  4O45 A;  3V4V A;  2OK6 A;  5HE2 B;  5HE0 B;  3C75 H;  3EI4 B;  4O3T B;  4GM3 A;  3EI2 A;  4MMY A;  4XYH A;  4XYI A;  2H6Q A;  3SHF A;  3GRE A;  3O4H A;  4RE5 A;  4WK4 A;  5IJ7 E;  1ERJ A;  3ODT A;  5CXC B;  4CC9 A;  3EI2 B;  1OLZ A;  4CI2 A;  2J55 H;  1N6E A;  3OL2 A;  2P9P C;  3N0E A;  3SBR A;  2HU7 A;  4DNV A;  3IUR A;  4MK0 B;  2HKR A;  4J0X A;  4J77 A;  4CI3 A;  5JWZ A;  1E5T A;  4PNK B;  2QXV A;  5SXM A;  3UVN A;  5H17 A;  4J8B A;  5TEE A;  3IUL A;  2H9N A;  3I8E A;  1XHM A;  4G55 A;  5EAL A;  2GNQ A;  5HYN B;  1GOG A;  1C9L A;  4J84 A;  4J82 A;  2EIE A;  1C9I A;  4GM9 A;  2YB8 B;  4NSX A;  1H2X A;  3IIW A;  1JV2 A;  3C5M A;  3DWL C;  2CN3 A;  4G1E A;  4GGA A;  2P9I C;  5E6U A;  3QI0 A;  5TDH B;  3VH0 A;  5GXH A;  4GQ2 P;  4U7A A;  4J8G A;  1U2V C;  2VDQ A;  3IIY A;  3I8C A;  5EAM A;  5GSA A;  4R7A B;  4J73 A;  5M61 A;  2YBA A;  2AGL A;  1N6F A;  4J86 A;  4RE6 A;  3RRM C;  4BP8 A;  4D0K A;  4CI8 A;  1YFQ A;  5FKT A;  3MZL A;  4L3H D;  5FLX g;  2I0S A;  2PBI B;  2H68 A;  1R5M A;  3JRO A;  3MZK A;  2VDN A;  5EM2 B;  4J0W A;  4BCC A;  4PBY A;  4LGN A;  4QT8 A;  1U4C A;  1E8N A;  1K32 A;  4E54 B;  4ERY A;  5FFO A;  5CYK A;  4Z7O A;  4AOW A;  2PM6 B;  3ZE1 A;  4MMZ A;  5EMJ B;  1XKS A;  2B5N A;  4O02 A;  2CO0 A;  5H14 A;  5C9Z B;  5FFG A;  5TF2 A;  3KCI A;  3F3F A;  3I7L A;  4Z8L A;  3O4I A;  2CN2 A;  4NC4 A;  5FKR A;  4A0B A;  4UM8 A;  1MG2 A;  3MKQ A;  1JJU B;  2HJB A;  2AGZ A;  4ZOX A;  3ZE2 A;  2GC4 A;  1M1X A;  3FRX A;  2B5L A;  2YNP A;  2CE9 A;  4DNW A;  3SFZ A;  4U1E I;  4BL0 A;  4X60 B;  4CZY A;  5M5V A;  4UI9 R;  3DDU A;  3GD1 I;  3SMR A;  3T3P A;  4CZV A;  3JZG A;  3OTT A;  1MDA H;  4ERZ A;  2H6N A;  1NR0 A;  3PVW B;  5I5I A;  2B4E A;  2H13 A;  4FA9 D;  5C92 A;  3NVX A;  4AEZ A;  2MTA H;  5C86 A;  3J81 g;  3IJ1 A;  1OMW B;  4NAA A;  3O4J A;  4PBZ A;  4QQE A;  2XDW A;  4CZX A;  3I7P A;  1JMX B;  3B7F A;  1PEV A;  2VDO A;  2AH0 A;  4Z7Q A;  1RI6 A;  4AX4 A;  3UKU C;  3RSE C;  2HYE A;  2P9K C;  3FM0 A;  2VZ1 A;  3NVQ A;  5CXC A;  4A08 B;  4L9O A;  4I79 A;  4AN0 A;  3QHY B;  3W15 A;  5EM2 A;  2QC5 A;  5IJ8 E;  3HFQ A;  2HU5 A;  3EI4 A;  4OZU A;  2HU8 A;  3RN1 D;  4Y7R A;  4GGD A;  4Y5R D;  2XL2 A;  1H2Z A;  4O1Q D;  3GFC A;  3T3M A;  2HJ4 A;  4L1M A;  3DSM A;  2VDM A;  2UZX B;  3VI3 A;  4J87 A;  2HKM A;  3A0F A;  3JZH A;  3UVM A;  2XYI A;  3UR4 A;  4JHN A;  3EMH A;  2CO0 C;  1SQ9 A;  4PSW B;  3UVL A;  3V7D B;  1MG3 A;  3SVW D;  5FXY A;  1XIP A;  3NIF A;  2CNX A;  1VE7 A;  4KFM B;  2OVQ B;  2IWF A;  3SXT D;  1SHY B;  5FKS A;  4O2W A;  2EIB A;  4IA9 A;  5B4W A;  3IUM A;  3MUN A;  1TYQ C;  5FA5 B;  2I3S A;  4FAN D;  3JZN A;  3SBQ A;  2VDL A;  3EWE A;  4J79 A;  5AJA A;  5GXI A;  3F3P A;  2OVP B;  3OW8 A;  4AMZ A;  3I7N A;  4E5Z B;  2VDR A;  2WQ8 A;  2J57 G;  3IVM A;  4Z7N A;  3EI3 A;  4UM9 A;  3ULE C;  3P4F A;  4X3E A;  3L4M D;  4X61 B;  5M5U A;  4JSV C;  4O3U B;  3IUJ A;  1QFM A;  3GC3 B;  2Q7Q A;  4HDJ A;  5IC7 A;  2UZY B;  4LG9 A;  4A2L A;  2I3T A;  4A0A B;  3FCS A;  5AFU 3;  1TYE A;  4PSX B;  4A0B B;  2AGY A;  4GQB B;  3AL8 A;  4NBM A;  3SWS D;  3OL2 B;  1T2X A;  2O9K A;  4A11 B;  1SQJ A;  2OIZ A;  3IUQ A;  3C9C A;  4GQ1 A;  5C2V B;  1QNI A;  2OK4 A;  4E54 A;  1QFS A;  5EMM B;  1YR2 A;  4OWR A;  1TBG A;  4K3J B;  3RMZ D;  3V5W B;  3I89 A;  5EAP A;  2VDK A;  3NVN A;  1PI6 A;  4D6V A;  4FHL A;  4IMM A;  2VZ3 A;  3ZDZ A;  1H2W A;  4A2M A;  2J56 H;  2BBK H;  2PM7 B;  3K27 A;  3VGZ A;  2VC2 A;  5FQD A;  3ZWL B;  1JMZ B;  3VA6 A;  2YNO A;  4FWW A;  3JPX A;  4FB1 D;  3RN0 D;  3JB9 L;  5E6R A;  1VYH C;  5HDB A;  2YMU A;  2HXC A;  3K6S A;  5A2Q g;  2H3X A;  4ZN4 A;  5IGO A;  3U4Y A;  3JRP A;  4JT6 C;  4ES0 A;  2IUP A;  3I2N A;  3SCY A;  1JOF A;  4J78 A;  2PM9 B;  4BP9 A;  4FA1 D;  4QAM A;  2IWK A;  2AQ5 A;  5THA A;  2IUR A;  3N0D A;  3L4O D;  4L3G D;  4WK0 A;  3MUO A;  2XL3 A;  5H1M A;  2JKX A;  4GM8 A;  2CE8 A;  4H5I A;  5EAR A;  3RFG A;  4AMY A;  1FWX A;  4JSP C;  2VDP A;  3MMY A;  5GMK n;  4A08 A;  4J81 A;  4QL1 A;  3BWS A;  1U8C A;  2IUQ A;  3PE7 A;  4JT5 C;  2H47 A;  5E6S A;  2H9L A;  5K1C C;  4ZOV A;  4CI1 A;  3I7K A;  3PSL A;  3ZDY A;  4DNU A;  3I7O A;  3UVK A;  2XZG A;  3SN6 B;  4BCB A;  1E8M A;  1GP2 B; 
#chains in the Genus database with same CATH homology
 1GOT B;  5FKQ A;  3DXK C;  4A09 B;  3CFV A;  5EMK B;  1NEX B;  3PSC B;  5IT9 g;  1P22 A;  3IKO A;  1PBY B;  3RLM D;  4PC0 A;  5CYK B;  4BUJ C;  4LG8 A;  4GMB A;  3E0C A;  4QRJ A;  5CXB B;  3C99 A;  4ERQ A;  3OKW A;  2YNN A;  5EML B;  5KDO B;  2XU7 A;  3CFS B;  5C2W B;  3EI1 A;  2Z2O A;  2P9L C;  1B9Y A;  1PGU A;  4YVD A;  3AFC A;  2H14 A;  3EI3 B;  4CY1 A;  3EI1 B;  3K26 A;  4CY3 A;  4EWR A;  2G99 A;  4L1Q D;  4XEI C;  3PXW D;  2IAA A;  2P9N C;  4ZOZ A;  3OKY B;  3SBP A;  4E5Z A;  3EU7 A;  4PXW A;  4CY5 A;  5K19 A;  2P9U C;  4GZ8 A;  5I5J A;  4CY2 A;  2Z2N A;  5AMS A;  3AH8 B;  2Z2P A;  4JD2 C;  1GXR A;  4JXM A;  5TEF A;  4FA5 D;  4TZ4 A;  2PM9 A;  3I7H A;  4FAV D;  2AH1 A;  2I0T A;  3SLE D;  3DXM C;  2OJY A;  4A7J A;  4K3I D;  1S4U X;  3EG6 A;  5CXB A;  4A11 A;  3UKR C;  2AGX A;  3J80 g;  2H6K A;  4N14 A;  2I0R A;  1L0Q A;  1K8K C;  2BCJ B;  2G9A A;  2AGW A;  4JSX C;  5I5M A;  2P9S C;  1N6D A;  3DM0 A;  3JAM g;  2HES X;  1A0R B;  3OKT A;  3BG0 A;  4GGC A;  5IGQ A;  3FGB A;  3SJL D;  2OVR B;  4A09 A;  5HE3 B;  2EBS A;  3IJ0 A;  4O9D A;  2TRC B;  3CIK B;  4FA4 D;  3PXT D;  4H5J A;  5HE1 B;  1GG2 B;  2H9M A;  4X63 B;  3ORV D;  1Q47 A;  3IJC A;  4BH6 A;  3KRX B;  3RFH A;  4JSN C;  3KRW B;  3MXX A;  4A0A A;  3MKS B;  5HQG A;  2B5M A;  3PXS D;  4ESG A;  2IUV A;  3PVU B;  3V9F A;  3BG1 A;  2H9P A;  3UVO A;  3OKY A;  3AL8 B;  3AL9 A;  2GC7 A;  3F3G A;  4G56 B;  4ZOY A;  2W18 A;  1B9X A;  4O45 A;  2OK6 A;  5HE2 B;  5HE0 B;  3C75 H;  3EI4 B;  4O3T B;  4GM3 A;  3EI2 A;  4XYH A;  4XYI A;  2H6Q A;  3SHF A;  3GRE A;  5IJ7 E;  1ERJ A;  3ODT A;  5CXC B;  4CC9 A;  3EI2 B;  1OLZ A;  4CI2 A;  2J55 H;  1N6E A;  3OL2 A;  2P9P C;  3N0E A;  3SBR A;  4MK0 B;  2HKR A;  4J0X A;  4J77 A;  4CI3 A;  5JWZ A;  4PNK B;  2QXV A;  5SXM A;  3UVN A;  5H17 A;  4J8B A;  5TEE A;  2H9N A;  3I8E A;  1XHM A;  5EAL A;  2GNQ A;  5HYN B;  4J84 A;  4J82 A;  4GM9 A;  2YB8 B;  4NSX A;  3IIW A;  3C5M A;  3DWL C;  2CN3 A;  4GGA A;  2P9I C;  5TDH B;  3VH0 A;  5GXH A;  4GQ2 P;  4U7A A;  4J8G A;  1U2V C;  3IIY A;  3I8C A;  5EAM A;  5GSA A;  4R7A B;  4J73 A;  2YBA A;  2AGL A;  1N6F A;  4J86 A;  3RRM C;  4D0K A;  4CI8 A;  1YFQ A;  5FKT A;  3MZL A;  4L3H D;  5FLX g;  2I0S A;  2PBI B;  2H68 A;  1R5M A;  3JRO A;  3MZK A;  5EM2 B;  4J0W A;  4PBY A;  4LGN A;  4QT8 A;  1U4C A;  1K32 A;  4E54 B;  4ERY A;  5CYK A;  4AOW A;  2PM6 B;  5EMJ B;  1XKS A;  2B5N A;  2CO0 A;  5H14 A;  5C9Z B;  5TF2 A;  3F3F A;  3I7L A;  4Z8L A;  2CN2 A;  5FKR A;  4A0B A;  1MG2 A;  3MKQ A;  1JJU B;  2HJB A;  2AGZ A;  4ZOX A;  2GC4 A;  3FRX A;  2B5L A;  2YNP A;  2CE9 A;  3SFZ A;  4U1E I;  4BL0 A;  4X60 B;  4CZY A;  4UI9 R;  3SMR A;  4CZV A;  3JZG A;  3OTT A;  1MDA H;  4ERZ A;  2H6N A;  1NR0 A;  3PVW B;  5I5I A;  2B4E A;  2H13 A;  4FA9 D;  3NVX A;  4AEZ A;  2MTA H;  3J81 g;  3IJ1 A;  1OMW B;  4PBZ A;  4QQE A;  4CZX A;  3I7P A;  1JMX B;  3B7F A;  1PEV A;  2AH0 A;  1RI6 A;  3UKU C;  3RSE C;  2HYE A;  2P9K C;  3FM0 A;  3NVQ A;  5CXC A;  4A08 B;  4L9O A;  4I79 A;  3W15 A;  5EM2 A;  2QC5 A;  5IJ8 E;  3HFQ A;  3EI4 A;  4OZU A;  3RN1 D;  4Y7R A;  4GGD A;  4Y5R D;  2XL2 A;  4O1Q D;  3GFC A;  2HJ4 A;  3DSM A;  2UZX B;  4J87 A;  2HKM A;  3A0F A;  3JZH A;  3UVM A;  2XYI A;  3UR4 A;  3EMH A;  2CO0 C;  1SQ9 A;  4PSW B;  3UVL A;  3V7D B;  1MG3 A;  3SVW D;  5FXY A;  1XIP A;  2CNX A;  4KFM B;  2OVQ B;  2IWF A;  3SXT D;  1SHY B;  5FKS A;  4IA9 A;  5B4W A;  1TYQ C;  5FA5 B;  2I3S A;  4FAN D;  3JZN A;  3SBQ A;  3EWE A;  4J79 A;  5AJA A;  5GXI A;  3F3P A;  2OVP B;  3OW8 A;  3I7N A;  4E5Z B;  2J57 G;  3EI3 A;  3ULE C;  3P4F A;  4X3E A;  3L4M D;  4X61 B;  4JSV C;  4O3U B;  4HDJ A;  2Q7Q A;  5IC7 A;  2UZY B;  4LG9 A;  4A2L A;  2I3T A;  4A0A B;  5AFU 3;  4PSX B;  4A0B B;  2AGY A;  4GQB B;  3AL8 A;  3SWS D;  3OL2 B;  2O9K A;  4A11 B;  1SQJ A;  2OIZ A;  3C9C A;  4GQ1 A;  5C2V B;  1QNI A;  2OK4 A;  4E54 A;  5EMM B;  4OWR A;  1TBG A;  4K3J B;  3RMZ D;  3V5W B;  3I89 A;  5EAP A;  3NVN A;  4D6V A;  1PI6 A;  4FHL A;  4IMM A;  4A2M A;  2J56 H;  2BBK H;  2PM7 B;  3K27 A;  3VGZ A;  5FQD A;  3ZWL B;  1JMZ B;  3VA6 A;  2YNO A;  4FWW A;  3JPX A;  4FB1 D;  3RN0 D;  3JB9 L;  1VYH C;  2YMU A;  2HXC A;  5A2Q g;  2H3X A;  4ZN4 A;  5IGO A;  3U4Y A;  3JRP A;  4JT6 C;  4ES0 A;  2IUP A;  3I2N A;  3SCY A;  1JOF A;  4J78 A;  2PM9 B;  4FA1 D;  2IWK A;  2AQ5 A;  5THA A;  2IUR A;  3N0D A;  3L4O D;  4L3G D;  2XL3 A;  5H1M A;  4GM8 A;  4H5I A;  2CE8 A;  5EAR A;  3RFG A;  1FWX A;  4JSP C;  3MMY A;  5GMK n;  4A08 A;  4J81 A;  4QL1 A;  3BWS A;  2IUQ A;  3PE7 A;  4JT5 C;  2H47 A;  2H9L A;  5K1C C;  4ZOV A;  4CI1 A;  3I7K A;  3PSL A;  3I7O A;  3UVK A;  3SN6 B;  1GP2 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...