2AH0A

Crystal structure of the carbinolamine intermediate in the reductive half-reaction of aromatic amine dehydrogenase (aadh) with tryptamine. monoclinic form
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
360
structure length
360
Chain Sequence
REVLTGGHSVSAPQENRIYVMDSVFMHLTESRVHVYDYTNGKFLGMVPTAFNGHVQVSNDGKKIYTMTTYHERITRGKRSDVVEVWDADKLTFEKEISLPPKRVQGLNYDGLFRQTTDGKFIVLQNASPATSIGIVDVAKGDYVEDVTAAAGCWSVIPQPNRPRSFMTICGDGGLLTINLGEDGKVASQSRSKQMFSVKDDPIFIAPALDKDKAHFVSYYGNVYSADFSGDEVKVDGPWSLLNDEDKAKNWVPGGYNLVGLHRASGRMYVFMHPDGKEGTHKFPAAEIWVMDTKTKQRVARIPGRDALSMTIDQQRNLMLTLDGGNVNVYDISQPEPKLLRTIEGAAEASLQVQFHPVGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Aromatic amine dehydrogenase
publication title Atomic description of an enzyme reaction dominated by proton tunneling
pubmed doi rcsb
total genus 95
structure length 360
sequence length 360
chains with identical sequence B
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2005-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2ah0A01
5FLXg 2H68A 4ZOZA 2H6QA 4L1QD 3SVWD 3SN6B 4U1EI 3DXMC 2YB8B 1FWXA 3UKUC 4BL0A 4O3UB 2B4EA 5HE0B 1K8KC 2P9LC 2G9AA 2QC5A 4X60B 1GP2B 4A09B 4KFMB 1PBYB 4A11A 1MG3A 3B7FA 2EBSA 1YFQA 5EMKB 2CN3A 1PI6A 2HJ4A 3I89A 2I0RA 3MXXA 5GXHA 5C2WB 5EM2B 5CXCA 5AFU3 4D6VA 5EMMB 3E0CA 2AGXA 4IA9A 5HE3B 3MKSB 5IT9g 3PSCB 2IURA 3C75H 4CC9A 4H5JA 4E54A 1XHMA 4I79A 3UVLA 2AH0A 5CYKA 1P22A 4PBZA 4CY1A 3IIWA 3NVNA 4D0KA 3SBRA 3L4MD 2B5MA 1TYQC 3SBPA 3FGBA 3PE7A 2IAAA 5IJ8E 3UVNA 3PVUB 1K32A 2I0SA 3J81g 4PXWA 5CXBA 2HKMA 5TF2A 3EI1A 2IUPA 1SQ9A 4LG8A 3UVMA 4CZYA 3FM0A 4Z8LA 5EAMA 2IWKA 3SXTD 5EM2A 3DSMA 2XL3A 4O45A 4XEIC 5SXMA 4A2LA 5HE1B 4PC0A 3SJLD 4JT6C 4A0AB 2CE8A 2H9LA 4BH6A 4J0XA 2HXCA 4A2MA 3JZNA 3C9CA 2O9KA 4J86A 3C99A 3IJCA 4FAND 4QRJA 4JSVC 4O1QD 5HQGA 4GGDA 1SQJA 4X3EA 4J8GA 3JRPA 1GG2B 2BCJB 4H5IA 5HYNB 2OVQB 1N6FA 3NVXA 1JMZB 3UVKA 3AL8B 4GGAA 3CIKB 3JAMg 3C5MA 3N0DA 3RLMD 4N14A 3IKOA 3ULEC 4Y7RA 2QXVA 5FKRA 5H14A 2H6KA 2Z2NA 2G99A 4O9DA 4QT8A 4FAVD 2P9SC 4O3TB 2PBIB 3IIYA 3K27A 5EMLB 4IMMA 2H6NA 3GFCA 4FA9D 2AGYA 4GMBA 4FA4D 1ERJA 3EI4A 4OZUA 1XKSA 3AL9A 2Q7QA 2P9NC 4FWWA 5I5MA 5CXBB 4CY2A 4R7AB 4A0AA 5I5JA 5GSAA 2CE9A 4K3JB 3EI3B 4J78A 3EI1B 4ZOYA 2J57G 3PSLA 5FKQA 3JPXA 3NVQA 2GC7A 5IC7A 5FXYA 3SBQA 2H9MA 4J81A 4LGNA 4L3HD 2MTAH 1JOFA 2GNQA 3PXTD 4ERQA 3KRXB 1PEVA 2PM6B 5TEEA 3OKTA 3MZLA 3I8CA 4EWRA 4FA1D 5I5IA 1NEXB 4XYHA 3AL8A 1JJUB 2XYIA 3F3PA 5FQDA 4CY5A 3V7DB 3EWEA 3HFQA 4J84A 2I3TA 2P9KC 2Z2PA 5IJ7E 3I7NA 3EU7A 4J73A 2TRCB 3RFGA 1XIPA 3RSEC 4J0WA 4OWRA 3EI2B 2BBKH 4A08B 3L4OD 2AQ5A 1S4UX 3RRMC 3UVOA 2H13A 4JSPC 3OW8A 3UR4A 2P9PC 3V5WB 2XU7A 3F3FA 3EI3A 3KRWB 2AGLA 3EI4B 5A2Qg 3P4FA 4ZOVA 2P9IC 5AMSA 4XYIA 3VA6A 5EMJB 4CI2A 3VGZA 4ES0A 2H9PA 5AJAA 4GZ8A 2YMUA 3PVWB 4FB1D 1MDAH 5FKTA 3MZKA 1PGUA 2AGWA 2H47A 4L9OA 2YNOA 2AH1A 5KDOB 4K3ID 5K1CC 3I7KA 3RMZD 4GGCA 5THAA 4CZVA 2IUQA 1MG2A 5TEFA 1N6EA 1QNIA 3EI2A 4CY3A 3JZHA 4J87A 3OKYB 4A08A 2YNNA 1SHYB 3BG1A 3DWLC 5EAPA 1B9XA 5JWZA 1GOTB 2YNPA 3I7HA 5TDHB 2CNXA 3RN0D 3RN1D 4L3GD 4A7JA 4U7AA 4GM9A 4ZN4A 3F3GA 4ZOXA 2OK6A 4QL1A 3W15A 3I7OA 2UZYB 4GQBB 4PNKB 4BUJC 3OKWA 3I7LA 4GM8A 2B5LA 2H14A 2J55H 1OMWB 5EALA 4LG9A 2OJYA 3PXWD 3SFZA 1GXRA 4X61B 2PM9B 1B9YA 4CI8A 2CN2A 2W18A 4FA5D 3IJ1A 3ORVD 1N6DA 3SWSD 2UZXB 1NR0A 3CFSB 5FA5B 4E5ZB 3JZGA 2B5NA 4J77A 4JSXC 5HE2B 3AH8B 2YBAA 2OIZA 3A0FA 2XL2A 4CI3A 2PM7B 3AFCA 1A0RB 1RI6A 4JSNC 5GXIA 4ESGA 3OKYA 4AEZA 4G56B 1JMXB 4TZ4A 4HDJA 3I2NA 3SMRA 3I7PA 2H3XA 2IWFA 3I8EA 2OK4A 2H9NA 4QQEA 2HESX 3J80g 2AGZA 4NSXA 4ERYA 3OL2B 4PBYA 3OTTA 4CI1A 3SHFA 4CZXA 3JB9L 3MMYA 5C9ZB 4YVDA 4A0BB 4JXMA 4Y5RD 1Q47A 3FRXA 4MK0B 3SCYA 4FHLA 2PM9A 4JD2C 4GQ2P 3RFHA 4JT5C 1U4CA 3CFVA 5C2VB 5FKSA 4GM3A 3MKQA 5IGOA 3ZWLB 3U4YA 4E5ZA 2HJBA 3IJ0A 3SLED 4A09A 3N0EA 5GMKn 5B4WA 4J79A 2HYEA 3V9FA 5K19A 2CO0A 4UI9R 4GQ1A 3JROA 3DXKC 5EARA 3EG6A 1R5MA 3PXSD 2GC4A 3BWSA 4A11B 3VH0A 4J82A 1L0QA 2I3SA 2HKRA 5IGQA 3GREA 2OVPB 3K26A 4J8BA 3DM0A 5CXCB 2P9UC 4ERZA 1U2VC 2Z2OA 3OL2A 3UKRC 2J56H 4AOWA 1VYHC 3EMHA 3BG0A 4X63B 4PSWB 5H1MA 4PSXB 2OVRB 4A0BA 2CO0C 3ODTA 4E54B 5H17A 1OLZA 5CYKB 1TBGA 2IUVA 2I0TA
chains in the Genus database with same CATH superfamily
5FLXg 2H68A 4ZOZA 2H6QA 4L1QD 5HDBA 3SVWD 3SN6B 4U1EI 3DXMC 2YB8B 1FWXA 4G1EA 3UKUC 4BL0A 4O3UB 2B4EA 5HE0B 1K8KC 1UTCA 2P9LC 2G9AA 5M5TA 1I2MB 2QC5A 4X60B 1GP2B 4A09B 1VZ2A 4KFMB 3IUJA 1PBYB 4G1MA 4A11A 1MG3A 3B7FA 2EBSA 1YFQA 3EQ7A 5EMKB 1UOOA 3T3MA 1JV2A 2CN3A 1PI6A 2HJ4A 3I89A 2I0RA 3MXXA 2XE4A 5GXHA 5C2WB 5EM2B 5CXCA 3NIGA 3IUQA 5AFU3 2VZ3A 4D6VA 5EMMB 3E0CA 2AGXA 4IA9A 5HE3B 3MKSB 5IT9g 3PSCB 2IURA 3C75H 4CC9A 4H5JA 3ZE0A 4WK0A 4E54A 1XHMA 4I79A 3UVLA 2AH0A 2HU8A 5CYKA 1P22A 1C9IA 4PBZA 1GOGA 4CY1A 3IIWA 3NVNA 4D0KA 4WK4A 3SBRA 3L4MD 3QI0A 2B5MA 1TYQC 3SBPA 3FGBA 1UOQA 3PE7A 2IAAA 3IURA 5IJ8E 3UVNA 1VE6A 4NENA 3ZE1A 3PVUB 1K32A 2I0SA 5FFOA 3J81g 4PXWA 1H2WA 5CXBA 2HKMA 1VE7A 3K6SA 5TF2A 3EI1A 4O02A 2IUPA 1SQ9A 4LG8A 3UVMA 4CZYA 4MMYA 3FM0A 3K71A 4Z8LA 4WJKA 4AX4A 5EAMA 2IWKA 3SXTD 5EM2A 3DSMA 2XL3A 4O45A 4XEIC 5SXMA 4A2LA 5HE1B 4PC0A 3SJLD 4JT6C 4A0AB 2CE8A 2H9LA 3IUMA 4BH6A 4J0XA 2HXCA 4A2MA 1A12A 3JZNA 4Z7OA 2VDNA 3C9CA 2O9KA 4J86A 3C99A 4Z7NA 3IJCA 4FAND 4QRJA 4JSVC 4O1QD 5HQGA 1E5TA 4GGDA 1QFSA 1SQJA 4X3EA 3T3PA 4J8GA 3JRPA 1GG2B 2BCJB 2XDWA 4JHNA 4H5IA 5HYNB 2OVQB 1N6FA 3NVXA 1JMZB 3UVKA 3AL8B 4GGAA 3CIKB 3QHYB 3JAMg 3C5MA 4RE6A 4BCCA 3N0DA 3RLMD 2EIBA 4N14A 3IKOA 5M5RA 3ULEC 1K3IA 3FCUA 4BP8A 4Y7RA 2QXVA 5FKRA 5H14A 4NC4A 2H6KA 2Z2NA 2G99A 4O9DA 4QT8A 4FAVD 2P9SC 4O3TB 2PBIB 3IIYA 3K27A 5EMLB 4IMMA 2H6NA 3GFCA 5M5VA 3V4PA 2AGYA 4GMBA 3FCSA 4FA4D 4FA9D 1ERJA 2VDPA 3EI4A 4OZUA 1XKSA 4AMYA 1U8CA 3AL9A 2Q7QA 2P9NC 4FWWA 1L5GA 5I5MA 5CXBB 4CY2A 4R7AB 4A0AA 5I5JA 4D9SA 5GSAA 2CE9A 4K3JB 3EI3B 4J78A 3EI1B 4ZOYA 2J57G 3PSLA 5FKQA 1VZ3A 3JPXA 3NVQA 5E6SA 2GC7A 5IC7A 5FXYA 3SBQA 2H9MA 4J81A 4LGNA 4L3HD 4UM8A 2MTAH 1JOFA 2GNQA 4UM9A 3KCIA 3PXTD 4ERQA 3KRXB 4AMZA 1PEVA 2HU7A 2PM6B 3O4JA 5TEEA 3OKTA 3MZLA 3I8CA 4EWRA 4FA1D 5I5IA 1NEXB 2QR5A 2HU5A 4XYHA 3AL8A 1JJUB 2XYIA 3VI3A 3F3PA 4IRZA 5FQDA 4CY5A 3V7DB 3EWEA 3HFQA 4J84A 5M5SA 2I3TA 2P9KC 2Z2PA 5IJ7E 3I7NA 2XZGA 3EU7A 2QZPA 4J73A 1H2ZA 2TRCB 2VDQA 3RFGA 1XIPA 3RSEC 4J0WA 4OWRA 3EI2B 5E6RA 1O6GA 2BBKH 4A08B 3IVMA 1M1XA 3L4OD 2AQ5A 1S4UX 3RRMC 3UVOA 4Z7QA 2H13A 4JSPC 1H2XA 3OW8A 3UR4A 2P9PC 3V5WB 4L1MA 5M5UA 2XU7A 3F3FA 3EI3A 3KRWB 1GOHA 2AGLA 3EI4B 4BCDA 5A2Qg 2VC2A 3ZDZA 3P4FA 1E8NA 4ZOVA 4G55A 2P9IC 5AMSA 4XYIA 1C9LA 4NBMA 2WQ8A 3VA6A 5EMJB 4CI2A 3VGZA 4ES0A 2H9PA 5AJAA 4GZ8A 2YMUA 3PVWB 4FB1D 4WK2A 1MDAH 5FKTA 3MZKA 1PGUA 2AGWA 2H47A 4L9OA 1BPOA 2YNOA 5M61A 2AH1A 5KDOB 4MMZA 4K3ID 5K1CC 3I7KA 3RMZD 4RE5A 4GGCA 5THAA 4CZVA 2IUQA 1MG2A 1O6FA 5TEFA 1N6EA 1QNIA 3EI2A 2VDLA 4AN1A 4CY3A 3JZHA 4J87A 3OKYB 4A08A 2YNNA 1SHYB 3BG1A 3DWLC 3OF7A 5EAPA 1JTDB 1B9XA 5JWZA 1GOTB 2YNPA 3EQ8A 3I7HA 3ZDYA 5TDHB 2CNXA 3RN0D 3RN1D 4L3GD 4A7JA 4U7AA 4GM9A 4ZN4A 3F3GA 4ZOXA 2OK6A 4QL1A 3W15A 4QAMA 3I7OA 2UZYB 4GQBB 4PNKB 4BUJC 3OKWA 3I7LA 4GM8A 2B5LA 2H14A 2J55H 1OMWB 5EALA 3O4GA 5E6UA 4LG9A 2OJYA 3PXWD 3MUOA 1GXRA 4X61B 3SFZA 2PM9B 1B9YA 4CI8A 2CN2A 2W18A 4FA5D 3IJ1A 3ORVD 3V4VA 1N6DA 3SWSD 2UZXB 1NR0A 3CFSB 5FA5B 4E5ZB 3JZGA 2B5NA 4J77A 4JSXC 5HE2B 3AH8B 2YBAA 3K72A 2OIZA 3A0FA 2XL2A 4DNVA 4CI3A 2PM7B 4NAAA 3AFCA 2VDKA 1A0RB 1RI6A 4O2WA 4JSNC 5GXIA 4ESGA 3IULA 3NIFA 3OKYA 4AEZA 4G56B 1JMXB 4TZ4A 4HDJA 1QFMA 3I2NA 3SMRA 3I7PA 2H3XA 1TYEA 2IWFA 3I8EA 2BKLA 2OK4A 2H9NA 1T2XA 4QQEA 2HESX 3J80g 2AGZA 4NSXA 4ERYA 3OL2B 4PBYA 2VDRA 1GOFA 3OTTA 4CI1A 3SHFA 4CZXA 3JB9L 2JKXA 3GC3B 2VDOA 3MMYA 5C9ZB 4YVDA 2EIDA 4A0BB 4JXMA 4Y5RD 5C92A 1Q47A 4MMXA 3FRXA 4MK0B 3SCYA 2VZ1A 4FHLA 2PM9A 4JD2C 4GQ2P 3RFHA 4JT5C 1U4CA 3CFVA 4BP9A 5C86A 5FKSA 5C2VB 4GM3A 4DNUA 3MKQA 5IGOA 3ZWLB 3U4YA 4E5ZA 2HJBA 3IJ0A 3GD1I 3SLED 3ZE2A 4A09A 3N0EA 5GMKn 5B4WA 4J79A 2HYEA 3MVDK 1H2YA 3V9FA 5K19A 4AN0A 2CO0A 4UI9R 3EQ9A 3DDUA 3JROA 3DXKC 4GQ1A 4JHPC 1YR2A 5EARA 3EG6A 3MUNA 1R5MA 3PXSD 3ZDXA 3O4IA 2GC4A 3BWSA 4A11B 3VH0A 4J82A 5FFGA 1L0QA 2I3SA 2HKRA 5IGQA 3GREA 2OVPB 3K26A 4J8BA 1E8MA 2EICA 3DM0A 5CXCB 2P9UC 4ERZA 4BCBA 1U2VC 2Z2OA 2VDMA 3VI4A 3OL2A 3NIDA 3UKRC 4DNWA 2J56H 4AOWA 1VYHC 3EMHA 3BG0A 4X63B 4PSWB 5H1MA 4PSXB 2OVRB 4A0BA 2CO0C 3ODTA 3IUNA 4E54B 5H17A 3IJEA 1OLZA 5CYKB 1TBGA 2IUVA 2EIEA 2I0TA 1UOPA 3O4HA
chains in the Genus database with same CATH topology
5FLXg 2H68A 4ZOZA 2H6QA 4L1QD 3SVWD 3SN6B 4U1EI 3DXMC 2YB8B 1FWXA 3UKUC 4BL0A 4O3UB 2B4EA 5HE0B 1K8KC 2P9LC 2G9AA 2QC5A 4X60B 1GP2B 4A09B 4KFMB 1PBYB 4A11A 1MG3A 3B7FA 2EBSA 1YFQA 5EMKB 2CN3A 1PI6A 2HJ4A 3I89A 2I0RA 3MXXA 5GXHA 5C2WB 5EM2B 5CXCA 5AFU3 4D6VA 5EMMB 3E0CA 2AGXA 4IA9A 5HE3B 3MKSB 5IT9g 3PSCB 2IURA 3C75H 4CC9A 4H5JA 4E54A 1XHMA 4I79A 3UVLA 2AH0A 5CYKA 1P22A 4PBZA 4CY1A 3IIWA 3NVNA 4D0KA 3SBRA 3L4MD 2B5MA 1TYQC 3SBPA 3FGBA 3PE7A 2IAAA 5IJ8E 3UVNA 3PVUB 1K32A 2I0SA 3J81g 4PXWA 5CXBA 2HKMA 5TF2A 3EI1A 2IUPA 1SQ9A 4LG8A 3UVMA 4CZYA 3FM0A 4Z8LA 5EAMA 2IWKA 3SXTD 5EM2A 3DSMA 2XL3A 4O45A 4XEIC 5SXMA 4A2LA 5HE1B 4PC0A 3SJLD 4JT6C 4A0AB 2CE8A 2H9LA 4BH6A 4J0XA 2HXCA 4A2MA 3JZNA 3C9CA 2O9KA 4J86A 3C99A 3IJCA 4FAND 4QRJA 4JSVC 4O1QD 5HQGA 4GGDA 1SQJA 4X3EA 4J8GA 3JRPA 1GG2B 2BCJB 4H5IA 5HYNB 2OVQB 1N6FA 3NVXA 1JMZB 3UVKA 3AL8B 4GGAA 3CIKB 3JAMg 3C5MA 3N0DA 3RLMD 4N14A 3IKOA 3ULEC 4Y7RA 2QXVA 5FKRA 5H14A 2H6KA 2Z2NA 2G99A 4O9DA 4QT8A 4FAVD 2P9SC 4O3TB 2PBIB 3IIYA 3K27A 5EMLB 4IMMA 2H6NA 3GFCA 4FA9D 2AGYA 4GMBA 4FA4D 1ERJA 3EI4A 4OZUA 1XKSA 3AL9A 2Q7QA 2P9NC 4FWWA 5I5MA 5CXBB 4CY2A 4R7AB 4A0AA 5I5JA 5GSAA 2CE9A 4K3JB 3EI3B 4J78A 3EI1B 4ZOYA 2J57G 3PSLA 5FKQA 3JPXA 3NVQA 2GC7A 5IC7A 5FXYA 3SBQA 2H9MA 4J81A 4LGNA 4L3HD 2MTAH 1JOFA 2GNQA 3PXTD 4ERQA 3KRXB 1PEVA 2PM6B 5TEEA 3OKTA 3MZLA 3I8CA 4EWRA 4FA1D 5I5IA 1NEXB 4XYHA 3AL8A 1JJUB 2XYIA 3F3PA 5FQDA 4CY5A 3V7DB 3EWEA 3HFQA 4J84A 2I3TA 2P9KC 2Z2PA 5IJ7E 3I7NA 3EU7A 4J73A 2TRCB 3RFGA 1XIPA 3RSEC 4J0WA 4OWRA 3EI2B 2BBKH 4A08B 3L4OD 2AQ5A 1S4UX 3RRMC 3UVOA 2H13A 4JSPC 3OW8A 3UR4A 2P9PC 3V5WB 2XU7A 3F3FA 3EI3A 3KRWB 2AGLA 3EI4B 5A2Qg 3P4FA 4ZOVA 2P9IC 5AMSA 4XYIA 3VA6A 5EMJB 4CI2A 3VGZA 4ES0A 2H9PA 5AJAA 4GZ8A 2YMUA 3PVWB 4FB1D 1MDAH 5FKTA 3MZKA 1PGUA 2AGWA 2H47A 4L9OA 2YNOA 2AH1A 5KDOB 4K3ID 5K1CC 3I7KA 3RMZD 4GGCA 5THAA 4CZVA 2IUQA 1MG2A 5TEFA 1N6EA 1QNIA 3EI2A 4CY3A 3JZHA 4J87A 3OKYB 4A08A 2YNNA 1SHYB 3BG1A 3DWLC 5EAPA 1B9XA 5JWZA 1GOTB 2YNPA 3I7HA 5TDHB 2CNXA 3RN0D 3RN1D 4L3GD 4A7JA 4U7AA 4GM9A 4ZN4A 3F3GA 4ZOXA 2OK6A 4QL1A 3W15A 3I7OA 2UZYB 4GQBB 4PNKB 4BUJC 3OKWA 3I7LA 4GM8A 2B5LA 2H14A 2J55H 1OMWB 5EALA 4LG9A 2OJYA 3PXWD 3SFZA 1GXRA 4X61B 2PM9B 1B9YA 4CI8A 2CN2A 2W18A 4FA5D 3IJ1A 3ORVD 1N6DA 3SWSD 2UZXB 1NR0A 3CFSB 5FA5B 4E5ZB 3JZGA 2B5NA 4J77A 4JSXC 5HE2B 3AH8B 2YBAA 2OIZA 3A0FA 2XL2A 4CI3A 2PM7B 3AFCA 1A0RB 1RI6A 4JSNC 5GXIA 4ESGA 3OKYA 4AEZA 4G56B 1JMXB 4TZ4A 4HDJA 3I2NA 3SMRA 3I7PA 2H3XA 2IWFA 3I8EA 2OK4A 2H9NA 4QQEA 2HESX 3J80g 2AGZA 4NSXA 4ERYA 3OL2B 4PBYA 3OTTA 4CI1A 3SHFA 4CZXA 3JB9L 3MMYA 5C9ZB 4YVDA 4A0BB 4JXMA 4Y5RD 1Q47A 3FRXA 4MK0B 3SCYA 4FHLA 2PM9A 4JD2C 4GQ2P 3RFHA 4JT5C 1U4CA 3CFVA 5C2VB 5FKSA 4GM3A 3MKQA 5IGOA 3ZWLB 3U4YA 4E5ZA 2HJBA 3IJ0A 3SLED 4A09A 3N0EA 5GMKn 5B4WA 4J79A 2HYEA 3V9FA 5K19A 2CO0A 4UI9R 4GQ1A 3JROA 3DXKC 5EARA 3EG6A 1R5MA 3PXSD 2GC4A 3BWSA 4A11B 3VH0A 4J82A 1L0QA 2I3SA 2HKRA 5IGQA 3GREA 2OVPB 3K26A 4J8BA 3DM0A 5CXCB 2P9UC 4ERZA 1U2VC 2Z2OA 3OL2A 3UKRC 2J56H 4AOWA 1VYHC 3EMHA 3BG0A 4X63B 4PSWB 5H1MA 4PSXB 2OVRB 4A0BA 2CO0C 3ODTA 4E54B 5H17A 1OLZA 5CYKB 1TBGA 2IUVA 2I0TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FLX g;  2H68 A;  4ZOZ A;  2H6Q A;  4L1Q D;  3SVW D;  3SN6 B;  4U1E I;  3DXM C;  2YB8 B;  1FWX A;  3UKU C;  4BL0 A;  4O3U B;  2B4E A;  5HE0 B;  1K8K C;  2P9L C;  2G9A A;  2QC5 A;  4X60 B;  1GP2 B;  4A09 B;  4KFM B;  1PBY B;  4A11 A;  1MG3 A;  3B7F A;  2EBS A;  1YFQ A;  5EMK B;  2CN3 A;  1PI6 A;  2HJ4 A;  3I89 A;  2I0R A;  3MXX A;  5GXH A;  5C2W B;  5EM2 B;  5CXC A;  5AFU 3;  4D6V A;  5EMM B;  3E0C A;  2AGX A;  4IA9 A;  5HE3 B;  3MKS B;  5IT9 g;  3PSC B;  2IUR A;  3C75 H;  4CC9 A;  4H5J A;  4E54 A;  1XHM A;  4I79 A;  3UVL A;  2AH0 A;  5CYK A;  1P22 A;  4PBZ A;  4CY1 A;  3IIW A;  3NVN A;  4D0K A;  3SBR A;  3L4M D;  2B5M A;  1TYQ C;  3SBP A;  3FGB A;  3PE7 A;  2IAA A;  5IJ8 E;  3UVN A;  3PVU B;  1K32 A;  2I0S A;  3J81 g;  4PXW A;  5CXB A;  2HKM A;  5TF2 A;  3EI1 A;  2IUP A;  1SQ9 A;  4LG8 A;  3UVM A;  4CZY A;  3FM0 A;  4Z8L A;  5EAM A;  2IWK A;  3SXT D;  5EM2 A;  3DSM A;  2XL3 A;  4O45 A;  4XEI C;  5SXM A;  4A2L A;  5HE1 B;  4PC0 A;  3SJL D;  4JT6 C;  4A0A B;  2CE8 A;  2H9L A;  4BH6 A;  4J0X A;  2HXC A;  4A2M A;  3JZN A;  3C9C A;  2O9K A;  4J86 A;  3C99 A;  3IJC A;  4FAN D;  4QRJ A;  4JSV C;  4O1Q D;  5HQG A;  4GGD A;  1SQJ A;  4X3E A;  4J8G A;  3JRP A;  1GG2 B;  2BCJ B;  4H5I A;  5HYN B;  2OVQ B;  1N6F A;  3NVX A;  1JMZ B;  3UVK A;  3AL8 B;  4GGA A;  3CIK B;  3JAM g;  3C5M A;  3N0D A;  3RLM D;  4N14 A;  3IKO A;  3ULE C;  4Y7R A;  2QXV A;  5FKR A;  5H14 A;  2H6K A;  2Z2N A;  2G99 A;  4O9D A;  4QT8 A;  4FAV D;  2P9S C;  4O3T B;  2PBI B;  3IIY A;  3K27 A;  5EML B;  4IMM A;  2H6N A;  3GFC A;  4FA9 D;  2AGY A;  4GMB A;  4FA4 D;  1ERJ A;  3EI4 A;  4OZU A;  1XKS A;  3AL9 A;  2Q7Q A;  2P9N C;  4FWW A;  5I5M A;  5CXB B;  4CY2 A;  4R7A B;  4A0A A;  5I5J A;  5GSA A;  2CE9 A;  4K3J B;  3EI3 B;  4J78 A;  3EI1 B;  4ZOY A;  2J57 G;  3PSL A;  5FKQ A;  3JPX A;  3NVQ A;  2GC7 A;  5IC7 A;  5FXY A;  3SBQ A;  2H9M A;  4J81 A;  4LGN A;  4L3H D;  2MTA H;  1JOF A;  2GNQ A;  3PXT D;  4ERQ A;  3KRX B;  1PEV A;  2PM6 B;  5TEE A;  3OKT A;  3MZL A;  3I8C A;  4EWR A;  4FA1 D;  5I5I A;  1NEX B;  4XYH A;  3AL8 A;  1JJU B;  2XYI A;  3F3P A;  5FQD A;  4CY5 A;  3V7D B;  3EWE A;  3HFQ A;  4J84 A;  2I3T A;  2P9K C;  2Z2P A;  5IJ7 E;  3I7N A;  3EU7 A;  4J73 A;  2TRC B;  3RFG A;  1XIP A;  3RSE C;  4J0W A;  4OWR A;  3EI2 B;  2BBK H;  4A08 B;  3L4O D;  2AQ5 A;  1S4U X;  3RRM C;  3UVO A;  2H13 A;  4JSP C;  3OW8 A;  3UR4 A;  2P9P C;  3V5W B;  2XU7 A;  3F3F A;  3EI3 A;  3KRW B;  2AGL A;  3EI4 B;  5A2Q g;  3P4F A;  4ZOV A;  2P9I C;  5AMS A;  4XYI A;  3VA6 A;  5EMJ B;  4CI2 A;  3VGZ A;  4ES0 A;  2H9P A;  5AJA A;  4GZ8 A;  2YMU A;  3PVW B;  4FB1 D;  1MDA H;  5FKT A;  3MZK A;  1PGU A;  2AGW A;  2H47 A;  4L9O A;  2YNO A;  2AH1 A;  5KDO B;  4K3I D;  5K1C C;  3I7K A;  3RMZ D;  4GGC A;  5THA A;  4CZV A;  2IUQ A;  1MG2 A;  5TEF A;  1N6E A;  1QNI A;  3EI2 A;  4CY3 A;  3JZH A;  4J87 A;  3OKY B;  4A08 A;  2YNN A;  1SHY B;  3BG1 A;  3DWL C;  5EAP A;  1B9X A;  5JWZ A;  1GOT B;  2YNP A;  3I7H A;  5TDH B;  2CNX A;  3RN0 D;  3RN1 D;  4L3G D;  4A7J A;  4U7A A;  4GM9 A;  4ZN4 A;  3F3G A;  4ZOX A;  2OK6 A;  4QL1 A;  3W15 A;  3I7O A;  2UZY B;  4GQB B;  4PNK B;  4BUJ C;  3OKW A;  3I7L A;  4GM8 A;  2B5L A;  2H14 A;  2J55 H;  1OMW B;  5EAL A;  4LG9 A;  2OJY A;  3PXW D;  3SFZ A;  1GXR A;  4X61 B;  2PM9 B;  1B9Y A;  4CI8 A;  2CN2 A;  2W18 A;  4FA5 D;  3IJ1 A;  3ORV D;  1N6D A;  3SWS D;  2UZX B;  1NR0 A;  3CFS B;  5FA5 B;  4E5Z B;  3JZG A;  2B5N A;  4J77 A;  4JSX C;  5HE2 B;  3AH8 B;  2YBA A;  2OIZ A;  3A0F A;  2XL2 A;  4CI3 A;  2PM7 B;  3AFC A;  1A0R B;  1RI6 A;  4JSN C;  5GXI A;  4ESG A;  3OKY A;  4AEZ A;  4G56 B;  1JMX B;  4TZ4 A;  4HDJ A;  3I2N A;  3SMR A;  3I7P A;  2H3X A;  2IWF A;  3I8E A;  2OK4 A;  2H9N A;  4QQE A;  2HES X;  3J80 g;  2AGZ A;  4NSX A;  4ERY A;  3OL2 B;  4PBY A;  3OTT A;  4CI1 A;  3SHF A;  4CZX A;  3JB9 L;  3MMY A;  5C9Z B;  4YVD A;  4A0B B;  4JXM A;  4Y5R D;  1Q47 A;  3FRX A;  4MK0 B;  3SCY A;  4FHL A;  2PM9 A;  4JD2 C;  4GQ2 P;  3RFH A;  4JT5 C;  1U4C A;  3CFV A;  5C2V B;  5FKS A;  4GM3 A;  3MKQ A;  5IGO A;  3ZWL B;  3U4Y A;  4E5Z A;  2HJB A;  3IJ0 A;  3SLE D;  4A09 A;  3N0E A;  5GMK n;  5B4W A;  4J79 A;  2HYE A;  3V9F A;  5K19 A;  2CO0 A;  4UI9 R;  4GQ1 A;  3JRO A;  3DXK C;  5EAR A;  3EG6 A;  1R5M A;  3PXS D;  2GC4 A;  3BWS A;  4A11 B;  3VH0 A;  4J82 A;  1L0Q A;  2I3S A;  2HKR A;  5IGQ A;  3GRE A;  2OVP B;  3K26 A;  4J8B A;  3DM0 A;  5CXC B;  2P9U C;  4ERZ A;  1U2V C;  2Z2O A;  3OL2 A;  3UKR C;  2J56 H;  4AOW A;  1VYH C;  3EMH A;  3BG0 A;  4X63 B;  4PSW B;  5H1M A;  4PSX B;  2OVR B;  4A0B A;  2CO0 C;  3ODT A;  4E54 B;  5H17 A;  1OLZ A;  5CYK B;  1TBG A;  2IUV A;  2I0T A; 
#chains in the Genus database with same CATH topology
 5FLX g;  2H68 A;  4ZOZ A;  2H6Q A;  4L1Q D;  5HDB A;  3SVW D;  3SN6 B;  4U1E I;  3DXM C;  2YB8 B;  1FWX A;  4G1E A;  3UKU C;  4BL0 A;  4O3U B;  2B4E A;  5HE0 B;  1K8K C;  1UTC A;  2P9L C;  2G9A A;  5M5T A;  1I2M B;  2QC5 A;  4X60 B;  1GP2 B;  4A09 B;  1VZ2 A;  4KFM B;  3IUJ A;  1PBY B;  4G1M A;  4A11 A;  1MG3 A;  3B7F A;  2EBS A;  1YFQ A;  3EQ7 A;  5EMK B;  1UOO A;  3T3M A;  1JV2 A;  2CN3 A;  1PI6 A;  2HJ4 A;  3I89 A;  2I0R A;  3MXX A;  2XE4 A;  5GXH A;  5C2W B;  5EM2 B;  5CXC A;  3NIG A;  3IUQ A;  5AFU 3;  2VZ3 A;  4D6V A;  5EMM B;  3E0C A;  2AGX A;  4IA9 A;  5HE3 B;  3MKS B;  5IT9 g;  3PSC B;  2IUR A;  3C75 H;  4CC9 A;  4H5J A;  3ZE0 A;  4WK0 A;  4E54 A;  1XHM A;  4I79 A;  3UVL A;  2AH0 A;  2HU8 A;  5CYK A;  1P22 A;  1C9I A;  4PBZ A;  1GOG A;  4CY1 A;  3IIW A;  3NVN A;  4D0K A;  4WK4 A;  3SBR A;  3L4M D;  3QI0 A;  2B5M A;  1TYQ C;  3SBP A;  3FGB A;  1UOQ A;  3PE7 A;  2IAA A;  3IUR A;  5IJ8 E;  3UVN A;  1VE6 A;  4NEN A;  3ZE1 A;  3PVU B;  1K32 A;  2I0S A;  5FFO A;  3J81 g;  4PXW A;  1H2W A;  5CXB A;  2HKM A;  1VE7 A;  3K6S A;  5TF2 A;  3EI1 A;  4O02 A;  2IUP A;  1SQ9 A;  4LG8 A;  3UVM A;  4CZY A;  4MMY A;  3FM0 A;  3K71 A;  4Z8L A;  4WJK A;  4AX4 A;  5EAM A;  2IWK A;  3SXT D;  5EM2 A;  3DSM A;  2XL3 A;  4O45 A;  4XEI C;  5SXM A;  4A2L A;  5HE1 B;  4PC0 A;  3SJL D;  4JT6 C;  4A0A B;  2CE8 A;  2H9L A;  3IUM A;  4BH6 A;  4J0X A;  2HXC A;  4A2M A;  1A12 A;  3JZN A;  4Z7O A;  2VDN A;  3C9C A;  2O9K A;  4J86 A;  3C99 A;  4Z7N A;  3IJC A;  4FAN D;  4QRJ A;  4JSV C;  4O1Q D;  5HQG A;  1E5T A;  4GGD A;  1QFS A;  1SQJ A;  4X3E A;  3T3P A;  4J8G A;  3JRP A;  1GG2 B;  2BCJ B;  2XDW A;  4JHN A;  4H5I A;  5HYN B;  2OVQ B;  1N6F A;  3NVX A;  1JMZ B;  3UVK A;  3AL8 B;  4GGA A;  3CIK B;  3QHY B;  3JAM g;  3C5M A;  4RE6 A;  4BCC A;  3N0D A;  3RLM D;  2EIB A;  4N14 A;  3IKO A;  5M5R A;  3ULE C;  1K3I A;  3FCU A;  4BP8 A;  4Y7R A;  2QXV A;  5FKR A;  5H14 A;  4NC4 A;  2H6K A;  2Z2N A;  2G99 A;  4O9D A;  4QT8 A;  4FAV D;  2P9S C;  4O3T B;  2PBI B;  3IIY A;  3K27 A;  5EML B;  4IMM A;  2H6N A;  3GFC A;  5M5V A;  3V4P A;  2AGY A;  4GMB A;  3FCS A;  4FA4 D;  4FA9 D;  1ERJ A;  2VDP A;  3EI4 A;  4OZU A;  1XKS A;  4AMY A;  1U8C A;  3AL9 A;  2Q7Q A;  2P9N C;  4FWW A;  1L5G A;  5I5M A;  5CXB B;  4CY2 A;  4R7A B;  4A0A A;  5I5J A;  4D9S A;  5GSA A;  2CE9 A;  4K3J B;  3EI3 B;  4J78 A;  3EI1 B;  4ZOY A;  2J57 G;  3PSL A;  5FKQ A;  1VZ3 A;  3JPX A;  3NVQ A;  5E6S A;  2GC7 A;  5IC7 A;  5FXY A;  3SBQ A;  2H9M A;  4J81 A;  4LGN A;  4L3H D;  4UM8 A;  2MTA H;  1JOF A;  2GNQ A;  4UM9 A;  3KCI A;  3PXT D;  4ERQ A;  3KRX B;  4AMZ A;  1PEV A;  2HU7 A;  2PM6 B;  3O4J A;  5TEE A;  3OKT A;  3MZL A;  3I8C A;  4EWR A;  4FA1 D;  5I5I A;  1NEX B;  2QR5 A;  2HU5 A;  4XYH A;  3AL8 A;  1JJU B;  2XYI A;  3VI3 A;  3F3P A;  4IRZ A;  5FQD A;  4CY5 A;  3V7D B;  3EWE A;  3HFQ A;  4J84 A;  5M5S A;  2I3T A;  2P9K C;  2Z2P A;  5IJ7 E;  3I7N A;  2XZG A;  3EU7 A;  2QZP A;  4J73 A;  1H2Z A;  2TRC B;  2VDQ A;  3RFG A;  1XIP A;  3RSE C;  4J0W A;  4OWR A;  3EI2 B;  5E6R A;  1O6G A;  2BBK H;  4A08 B;  3IVM A;  1M1X A;  3L4O D;  2AQ5 A;  1S4U X;  3RRM C;  3UVO A;  4Z7Q A;  2H13 A;  4JSP C;  1H2X A;  3OW8 A;  3UR4 A;  2P9P C;  3V5W B;  4L1M A;  5M5U A;  2XU7 A;  3F3F A;  3EI3 A;  3KRW B;  1GOH A;  2AGL A;  3EI4 B;  4BCD A;  5A2Q g;  2VC2 A;  3ZDZ A;  3P4F A;  1E8N A;  4ZOV A;  4G55 A;  2P9I C;  5AMS A;  4XYI A;  1C9L A;  4NBM A;  2WQ8 A;  3VA6 A;  5EMJ B;  4CI2 A;  3VGZ A;  4ES0 A;  2H9P A;  5AJA A;  4GZ8 A;  2YMU A;  3PVW B;  4FB1 D;  4WK2 A;  1MDA H;  5FKT A;  3MZK A;  1PGU A;  2AGW A;  2H47 A;  4L9O A;  1BPO A;  2YNO A;  5M61 A;  2AH1 A;  5KDO B;  4MMZ A;  4K3I D;  5K1C C;  3I7K A;  3RMZ D;  4RE5 A;  4GGC A;  5THA A;  4CZV A;  2IUQ A;  1MG2 A;  1O6F A;  5TEF A;  1N6E A;  1QNI A;  3EI2 A;  2VDL A;  4AN1 A;  4CY3 A;  3JZH A;  4J87 A;  3OKY B;  4A08 A;  2YNN A;  1SHY B;  3BG1 A;  3DWL C;  3OF7 A;  5EAP A;  1JTD B;  1B9X A;  5JWZ A;  1GOT B;  2YNP A;  3EQ8 A;  3I7H A;  3ZDY A;  5TDH B;  2CNX A;  3RN0 D;  3RN1 D;  4L3G D;  4A7J A;  4U7A A;  4GM9 A;  4ZN4 A;  3F3G A;  4ZOX A;  2OK6 A;  4QL1 A;  3W15 A;  4QAM A;  3I7O A;  2UZY B;  4GQB B;  4PNK B;  4BUJ C;  3OKW A;  3I7L A;  4GM8 A;  2B5L A;  2H14 A;  2J55 H;  1OMW B;  5EAL A;  3O4G A;  5E6U A;  4LG9 A;  2OJY A;  3PXW D;  3MUO A;  1GXR A;  4X61 B;  3SFZ A;  2PM9 B;  1B9Y A;  4CI8 A;  2CN2 A;  2W18 A;  4FA5 D;  3IJ1 A;  3ORV D;  3V4V A;  1N6D A;  3SWS D;  2UZX B;  1NR0 A;  3CFS B;  5FA5 B;  4E5Z B;  3JZG A;  2B5N A;  4J77 A;  4JSX C;  5HE2 B;  3AH8 B;  2YBA A;  3K72 A;  2OIZ A;  3A0F A;  2XL2 A;  4DNV A;  4CI3 A;  2PM7 B;  4NAA A;  3AFC A;  2VDK A;  1A0R B;  1RI6 A;  4O2W A;  4JSN C;  5GXI A;  4ESG A;  3IUL A;  3NIF A;  3OKY A;  4AEZ A;  4G56 B;  1JMX B;  4TZ4 A;  4HDJ A;  1QFM A;  3I2N A;  3SMR A;  3I7P A;  2H3X A;  1TYE A;  2IWF A;  3I8E A;  2BKL A;  2OK4 A;  2H9N A;  1T2X A;  4QQE A;  2HES X;  3J80 g;  2AGZ A;  4NSX A;  4ERY A;  3OL2 B;  4PBY A;  2VDR A;  1GOF A;  3OTT A;  4CI1 A;  3SHF A;  4CZX A;  3JB9 L;  2JKX A;  3GC3 B;  2VDO A;  3MMY A;  5C9Z B;  4YVD A;  2EID A;  4A0B B;  4JXM A;  4Y5R D;  5C92 A;  1Q47 A;  4MMX A;  3FRX A;  4MK0 B;  3SCY A;  2VZ1 A;  4FHL A;  2PM9 A;  4JD2 C;  4GQ2 P;  3RFH A;  4JT5 C;  1U4C A;  3CFV A;  4BP9 A;  5C86 A;  5FKS A;  5C2V B;  4GM3 A;  4DNU A;  3MKQ A;  5IGO A;  3ZWL B;  3U4Y A;  4E5Z A;  2HJB A;  3IJ0 A;  3GD1 I;  3SLE D;  3ZE2 A;  4A09 A;  3N0E A;  5GMK n;  5B4W A;  4J79 A;  2HYE A;  3MVD K;  1H2Y A;  3V9F A;  5K19 A;  4AN0 A;  2CO0 A;  4UI9 R;  3EQ9 A;  3DDU A;  3JRO A;  3DXK C;  4GQ1 A;  4JHP C;  1YR2 A;  5EAR A;  3EG6 A;  3MUN A;  1R5M A;  3PXS D;  3ZDX A;  3O4I A;  2GC4 A;  3BWS A;  4A11 B;  3VH0 A;  4J82 A;  5FFG A;  1L0Q A;  2I3S A;  2HKR A;  5IGQ A;  3GRE A;  2OVP B;  3K26 A;  4J8B A;  1E8M A;  2EIC A;  3DM0 A;  5CXC B;  2P9U C;  4ERZ A;  4BCB A;  1U2V C;  2Z2O A;  2VDM A;  3VI4 A;  3OL2 A;  3NID A;  3UKR C;  4DNW A;  2J56 H;  4AOW A;  1VYH C;  3EMH A;  3BG0 A;  4X63 B;  4PSW B;  5H1M A;  4PSX B;  2OVR B;  4A0B A;  2CO0 C;  3ODT A;  3IUN A;  4E54 B;  5H17 A;  3IJE A;  1OLZ A;  5CYK B;  1TBG A;  2IUV A;  2EIE A;  2I0T A;  1UOP A;  3O4H A; 
#chains in the Genus database with same CATH homology
 5FLX g;  2H68 A;  4ZOZ A;  2H6Q A;  4L1Q D;  3SVW D;  3SN6 B;  4U1E I;  3DXM C;  2YB8 B;  1FWX A;  3UKU C;  4BL0 A;  4O3U B;  2B4E A;  5HE0 B;  1K8K C;  2P9L C;  2G9A A;  2QC5 A;  4X60 B;  1GP2 B;  4A09 B;  4KFM B;  1PBY B;  4A11 A;  1MG3 A;  3B7F A;  2EBS A;  1YFQ A;  5EMK B;  2CN3 A;  1PI6 A;  2HJ4 A;  3I89 A;  2I0R A;  3MXX A;  5GXH A;  5C2W B;  5EM2 B;  5CXC A;  5AFU 3;  4D6V A;  5EMM B;  3E0C A;  2AGX A;  4IA9 A;  5HE3 B;  3MKS B;  5IT9 g;  3PSC B;  2IUR A;  3C75 H;  4CC9 A;  4H5J A;  4E54 A;  1XHM A;  4I79 A;  3UVL A;  2AH0 A;  5CYK A;  1P22 A;  4PBZ A;  4CY1 A;  3IIW A;  3NVN A;  4D0K A;  3SBR A;  3L4M D;  2B5M A;  1TYQ C;  3SBP A;  3FGB A;  3PE7 A;  2IAA A;  5IJ8 E;  3UVN A;  3PVU B;  1K32 A;  2I0S A;  3J81 g;  4PXW A;  5CXB A;  2HKM A;  5TF2 A;  3EI1 A;  2IUP A;  1SQ9 A;  4LG8 A;  3UVM A;  4CZY A;  3FM0 A;  4Z8L A;  5EAM A;  2IWK A;  3SXT D;  5EM2 A;  3DSM A;  2XL3 A;  4O45 A;  4XEI C;  5SXM A;  4A2L A;  5HE1 B;  4PC0 A;  3SJL D;  4JT6 C;  4A0A B;  2CE8 A;  2H9L A;  4BH6 A;  4J0X A;  2HXC A;  4A2M A;  3JZN A;  3C9C A;  2O9K A;  4J86 A;  3C99 A;  3IJC A;  4FAN D;  4QRJ A;  4JSV C;  4O1Q D;  5HQG A;  4GGD A;  1SQJ A;  4X3E A;  4J8G A;  3JRP A;  1GG2 B;  2BCJ B;  4H5I A;  5HYN B;  2OVQ B;  1N6F A;  3NVX A;  1JMZ B;  3UVK A;  3AL8 B;  4GGA A;  3CIK B;  3JAM g;  3C5M A;  3N0D A;  3RLM D;  4N14 A;  3IKO A;  3ULE C;  4Y7R A;  2QXV A;  5FKR A;  5H14 A;  2H6K A;  2Z2N A;  2G99 A;  4O9D A;  4QT8 A;  4FAV D;  2P9S C;  4O3T B;  2PBI B;  3IIY A;  3K27 A;  5EML B;  4IMM A;  2H6N A;  3GFC A;  4FA9 D;  2AGY A;  4GMB A;  4FA4 D;  1ERJ A;  3EI4 A;  4OZU A;  1XKS A;  3AL9 A;  2Q7Q A;  2P9N C;  4FWW A;  5I5M A;  5CXB B;  4CY2 A;  4R7A B;  4A0A A;  5I5J A;  5GSA A;  2CE9 A;  4K3J B;  3EI3 B;  4J78 A;  3EI1 B;  4ZOY A;  2J57 G;  3PSL A;  5FKQ A;  3JPX A;  3NVQ A;  2GC7 A;  5IC7 A;  5FXY A;  3SBQ A;  2H9M A;  4J81 A;  4LGN A;  4L3H D;  2MTA H;  1JOF A;  2GNQ A;  3PXT D;  4ERQ A;  3KRX B;  1PEV A;  2PM6 B;  5TEE A;  3OKT A;  3MZL A;  3I8C A;  4EWR A;  4FA1 D;  5I5I A;  1NEX B;  4XYH A;  3AL8 A;  1JJU B;  2XYI A;  3F3P A;  5FQD A;  4CY5 A;  3V7D B;  3EWE A;  3HFQ A;  4J84 A;  2I3T A;  2P9K C;  2Z2P A;  5IJ7 E;  3I7N A;  3EU7 A;  4J73 A;  2TRC B;  3RFG A;  1XIP A;  3RSE C;  4J0W A;  4OWR A;  3EI2 B;  2BBK H;  4A08 B;  3L4O D;  2AQ5 A;  1S4U X;  3RRM C;  3UVO A;  2H13 A;  4JSP C;  3OW8 A;  3UR4 A;  2P9P C;  3V5W B;  2XU7 A;  3F3F A;  3EI3 A;  3KRW B;  2AGL A;  3EI4 B;  5A2Q g;  3P4F A;  4ZOV A;  2P9I C;  5AMS A;  4XYI A;  3VA6 A;  5EMJ B;  4CI2 A;  3VGZ A;  4ES0 A;  2H9P A;  5AJA A;  4GZ8 A;  2YMU A;  3PVW B;  4FB1 D;  1MDA H;  5FKT A;  3MZK A;  1PGU A;  2AGW A;  2H47 A;  4L9O A;  2YNO A;  2AH1 A;  5KDO B;  4K3I D;  5K1C C;  3I7K A;  3RMZ D;  4GGC A;  5THA A;  4CZV A;  2IUQ A;  1MG2 A;  5TEF A;  1N6E A;  1QNI A;  3EI2 A;  4CY3 A;  3JZH A;  4J87 A;  3OKY B;  4A08 A;  2YNN A;  1SHY B;  3BG1 A;  3DWL C;  5EAP A;  1B9X A;  5JWZ A;  1GOT B;  2YNP A;  3I7H A;  5TDH B;  2CNX A;  3RN0 D;  3RN1 D;  4L3G D;  4A7J A;  4U7A A;  4GM9 A;  4ZN4 A;  3F3G A;  4ZOX A;  2OK6 A;  4QL1 A;  3W15 A;  3I7O A;  2UZY B;  4GQB B;  4PNK B;  4BUJ C;  3OKW A;  3I7L A;  4GM8 A;  2B5L A;  2H14 A;  2J55 H;  1OMW B;  5EAL A;  4LG9 A;  2OJY A;  3PXW D;  3SFZ A;  1GXR A;  4X61 B;  2PM9 B;  1B9Y A;  4CI8 A;  2CN2 A;  2W18 A;  4FA5 D;  3IJ1 A;  3ORV D;  1N6D A;  3SWS D;  2UZX B;  1NR0 A;  3CFS B;  5FA5 B;  4E5Z B;  3JZG A;  2B5N A;  4J77 A;  4JSX C;  5HE2 B;  3AH8 B;  2YBA A;  2OIZ A;  3A0F A;  2XL2 A;  4CI3 A;  2PM7 B;  3AFC A;  1A0R B;  1RI6 A;  4JSN C;  5GXI A;  4ESG A;  3OKY A;  4AEZ A;  4G56 B;  1JMX B;  4TZ4 A;  4HDJ A;  3I2N A;  3SMR A;  3I7P A;  2H3X A;  2IWF A;  3I8E A;  2OK4 A;  2H9N A;  4QQE A;  2HES X;  3J80 g;  2AGZ A;  4NSX A;  4ERY A;  3OL2 B;  4PBY A;  3OTT A;  4CI1 A;  3SHF A;  4CZX A;  3JB9 L;  3MMY A;  5C9Z B;  4YVD A;  4A0B B;  4JXM A;  4Y5R D;  1Q47 A;  3FRX A;  4MK0 B;  3SCY A;  4FHL A;  2PM9 A;  4JD2 C;  4GQ2 P;  3RFH A;  4JT5 C;  1U4C A;  3CFV A;  5C2V B;  5FKS A;  4GM3 A;  3MKQ A;  5IGO A;  3ZWL B;  3U4Y A;  4E5Z A;  2HJB A;  3IJ0 A;  3SLE D;  4A09 A;  3N0E A;  5GMK n;  5B4W A;  4J79 A;  2HYE A;  3V9F A;  5K19 A;  2CO0 A;  4UI9 R;  4GQ1 A;  3JRO A;  3DXK C;  5EAR A;  3EG6 A;  1R5M A;  3PXS D;  2GC4 A;  3BWS A;  4A11 B;  3VH0 A;  4J82 A;  1L0Q A;  2I3S A;  2HKR A;  5IGQ A;  3GRE A;  2OVP B;  3K26 A;  4J8B A;  3DM0 A;  5CXC B;  2P9U C;  4ERZ A;  1U2V C;  2Z2O A;  3OL2 A;  3UKR C;  2J56 H;  4AOW A;  1VYH C;  3EMH A;  3BG0 A;  4X63 B;  4PSW B;  5H1M A;  4PSX B;  2OVR B;  4A0B A;  2CO0 C;  3ODT A;  4E54 B;  5H17 A;  1OLZ A;  5CYK B;  1TBG A;  2IUV A;  2I0T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...