4O2WA

Crystal structure of the third rcc1-like domain of herc1
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
365
structure length
365
Chain Sequence
KCDVYLWGAGRHGQLAEAGRNVMVPAAAPSFSQAQQVICGQNCTFVIQANGTVLACGEGSYGRLGQGNSDDLHVLTVISALQGFVVTQLVTSCGSDGHSMALTESGEVFSWGDGDYGKLGHGNSDRQRRPRQIEALQGEEVVQMSCGFKHSAVVTSDGKLFTFGNGDYGRLGLGNTSNKKLPERVTALEGYQIGQVACGLNHTLAVSADGSMVWAFGDGDYGKLGLGNSTAKSSPQKIDVLCGIGIKKVACGTQFSVALTKDGHVYTFGQDRLIGLPEGRARNHNRPQQIPVLAGVIIEDVAVGAEHTLALASNGDVYAWGSNSEGQLGLGHTNHVREPTLVTGLQGKNVRQISAGRCHSAAWTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 ubiquitin-protein ligase HERC1
publication title Crystal structure of the third RCC1-like domain of HERC1
rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 104
structure length 365
sequence length 365
chains with identical sequence B, C, D
ec nomenclature ec 2.3.2.26: HECT-type E3 ubiquitin transferase.
pdb deposition date 2013-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00415 RCC1 Regulator of chromosome condensation (RCC1) repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.30 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Regulator of chromosome condensation 1/beta-lactamase-inhibitor protein II 4o2wA00
4D9SA 1I2MB 4O2WA 4NAAA 4DNWA 3MVDK 1A12A 4NBMA 4JHPC 4NC4A 4L1MA 3OF7A 4QAMA 3KCIA 4JHNA 4DNUA 3QI0A 4DNVA 1JTDB 3QHYB
chains in the Genus database with same CATH superfamily
5FKRA 3DXKC 2AGWA 3NVQA 1SQ9A 2HKRA 4MMYA 1C9IA 4HDJA 5TF2A 3K72A 3CFVA 2YB8B 2VDQA 3I7PA 3IJ1A 4O9DA 3ZE2A 1GP2B 4H5IA 3IUNA 3MZLA 4JHPC 4NC4A 4PC0A 4AMYA 5K19A 1TBGA 2P9UC 3RRMC 3AH8B 4AX4A 3V7DB 3B7FA 5FQDA 1UOQA 2VC2A 3E0CA 3O4IA 4JHNA 2AH0A 2H6QA 3QHYB 5GXIA 4J8BA 3A0FA 4WK2A 2P9PC 2YBAA 2B5LA 3FCUA 5C86A 5GXHA 3MUNA 2B5MA 3UR4A 3O4HA 4PNKB 1NR0A 3UVNA 4E5ZA 2EIBA 3K26A 1XIPA 4A09B 3VGZA 4QAMA 5EM2B 4L9OA 5EMMB 3ZDXA 3FRXA 2PBIB 4PBYA 3DXMC 4JSPC 4KFMB 4DNUA 5M5VA 4CZXA 1TYEA 4ZOXA 1OLZA 3OKTA 5JWZA 2JKXA 2HXCA 4ERZA 2XL2A 1GOTB 5THAA 4A2MA 3GD1I 4CY2A 4FAVD 5EALA 2XE4A 2YMUA 1TYQC 2HYEA 3IUQA 2WQ8A 1JJUB 3T3PA 5C2VB 4FA9D 2BKLA 4A08A 1E8NA 3JZGA 4BCDA 5EAMA 2VZ3A 2OVQB 1H2XA 3C9CA 3F3PA 4U7AA 5EAPA 5E6RA 3JZNA 2UZYB 3MVDK 4J86A 4I79A 1R5MA 4X61B 2BBKH 2CO0A 3I8CA 1UOOA 3EI2B 4X3EA 2MTAH 1A0RB 2H9NA 3VI4A 3MUOA 1N6EA 4AN0A 4MMZA 2I3SA 2GC7A 4UM8A 3V9FA 4L3GD 5FKQA 1M1XA 2EICA 3GFCA 3EI1A 4CZYA 4ZOYA 3C99A 5I5IA 2AQ5A 5TEFA 3EI4A 4FA4D 3SXTD 2PM9B 4QQEA 1T2XA 1L0QA 4NBMA 4LG8A 4QL1A 5KDOB 4K3JB 3SWSD 1P22A 1U4CA 4E54A 2H9MA 3VI3A 3IIYA 2HU8A 3I7HA 2HU5A 2I0TA 1JMXB 2VDPA 4G56B 4AMZA 3NIDA 1E5TA 2YNPA 1OMWB 4U1EI 4H5JA 4ERQA 5E6SA 3EG6A 2QZPA 5EMLB 4CZVA 4D9SA 4WK4A 2HU7A 4K3ID 3IUJA 3V5WB 3T3MA 2XYIA 5CXCB 5M5UA 2H68A 2OIZA 2PM6B 3IUMA 2G99A 2VZ1A 3MMYA 3AL8B 3C75H 2B5NA 3K27A 3OL2B 3PXSD 3SBQA 4BCBA 3DWLC 2CE8A 4GM9A 4GGAA 3L4MD 3DM0A 3I7LA 4Z7QA 2P9IC 3GC3B 5H1MA 4BH6A 1GOGA 3UVLA 1PGUA 1JTDB 3NIGA 4O45A 2Z2OA 1GOFA 4TZ4A 1RI6A 4J84A 5EMKB 5HDBA 3EI3B 3OKYB 4DNWA 3IIWA 3I8EA 3SFZA 2AGXA 2AGYA 2XL3A 3ULEC 3OW8A 4J0WA 4R7AB 3ORVD 4O1QD 1QNIA 3MKQA 2XZGA 2H6KA 2VDMA 4L1MA 3EQ9A 4PSWB 2IWFA 1YR2A 1UOPA 3SN6B 2YNOA 1NEXB 1VZ3A 4QRJA 5CXBB 5E6UA 4J78A 4FB1D 3IULA 4L3HD 4GQ1A 4PXWA 3HFQA 4L1QD 3ODTA 2P9NC 5IGOA 4NAAA 4ZOVA 1FWXA 4A2LA 1SHYB 2H47A 4AOWA 5GSAA 5AMSA 4XYIA 5H14A 4JT5C 1SQJA 2VDKA 4IA9A 2Z2NA 2OK4A 4JSXC 4A7JA 4J77A 5C2WB 2J56H 3NVNA 3L4OD 4Y7RA 3IURA 3P4FA 2H9PA 3K71A 1GOHA 2H3XA 4MK0B 4A0AA 5FFOA 4ZOZA 4D6VA 4QT8A 5HE2B 4RE6A 4IRZA 3VA6A 4A11A 4D0KA 4G55A 3KRXB 1XHMA 3ZE1A 2H14A 4WK0A 1JV2A 3JZHA 4CI2A 2W18A 3RSEC 4CI8A 3GREA 4CY1A 2AH1A 4UI9R 4ESGA 4O02A 2I0RA 2IWKA 3EMHA 2OJYA 4CY5A 4EWRA 2AGZA 3EU7A 3DDUA 2G9AA 2QC5A 5SXMA 4O2WA 5M61A 5EMJB 4A08B 4BCCA 4ERYA 3W15A 2IURA 3PVWB 3DSMA 2CN3A 2Q7QA 4LG9A 3UKRC 2CE9A 3SLED 4WJKA 3MXXA 4Z8LA 5K1CC 4GZ8A 4X63B 2OK6A 3N0EA 4J79A 2P9KC 2Z2PA 3VH0A 4CI1A 1C9LA 3JROA 3PVUB 3SBPA 3RMZD 4A0BB 5CYKB 1VZ2A 2HJBA 4O3TB 3NVXA 3AL8A 1ERJA 2BCJB 3FCSA 1K8KC 2J55H 4BP8A 1UTCA 3IKOA 4XEIC 2IUVA 3U4YA 3FM0A 3K6SA 1A12A 5IGQA 2OVPB 3JPXA 2GNQA 4FHLA 4O3UB 2O9KA 3EI1B 3KCIA 3CIKB 2VDLA 4JSNC 3RN0D 3OKYA 3EI4B 4NSXA 2H6NA 3O4JA 5FKTA 1H2WA 4IMMA 2I0SA 5AJAA 1PEVA 1QFMA 3MKSB 3QI0A 3J81g 5HE3B 4E54B 1MG3A 1B9XA 4J73A 3C5MA 1MDAH 3UKUC 1JOFA 2UZXB 3SBRA 3JAMg 4A09A 4FWWA 4JXMA 4G1MA 4AN1A 5EM2A 2PM7B 3RFGA 5CXBA 4PSXB 2P9SC 3N0DA 5FFGA 4GQBB 4JT6C 4BL0A 1GXRA 1U2VC 1K3IA 3OF7A 4X60B 5HYNB 3IJEA 3SJLD 3BG0A 3ZDZA 2HKMA 1MG2A 1L5GA 3EWEA 3RFHA 4GM8A 4XYHA 4ES0A 3SVWD 1S4UX 1Q47A 4ZN4A 1O6FA 3UVMA 2XU7A 4CY3A 3BG1A 3F3FA 3I2NA 3RN1D 3UVKA 2H9LA 5C9ZB 5A2Qg 3ZDYA 3O4GA 5FKSA 1PI6A 1N6DA 3I7OA 1E8MA 3JRPA 3PE7A 3V4PA 5M5SA 2J57G 3I7NA 1QFSA 1O6GA 2YNNA 5AFU3 2P9LC 5M5RA 3ZWLB 2TRCB 3KRWB 4BUJC 3PSCB 1K32A 4E5ZB 4CI3A 5TEEA 2I3TA 3OTTA 5I5JA 4DNVA 3V4VA 3RLMD 1U8CA 4LGNA 1I2MB 3AL9A 4GM3A 2IUPA 3EI2A 1H2ZA 1N6FA 5HE0B 5HQGA 2VDNA 4JD2C 3PXTD 3UVOA 4J81A 4FA5D 4NENA 2CO0C 3ZE0A 5FLXg 5TDHB 3SHFA 1GG2B 3MZKA 3BWSA 2VDOA 4GGDA 4GQ2P 3AFCA 4J87A 2GC4A 4CC9A 3IJ0A 2PM9A 2AGLA 4N14A 5FXYA 2EIDA 5GMKn 2HJ4A 3I89A 3EQ8A 2QR5A 3OKWA 1VE7A 4J8GA 1JMZB 5IT9g 2CN2A 4YVDA 5B4WA 5IJ7E 1XKSA 4OZUA 3I7KA 2H13A 4MMXA 4OWRA 5C92A 4A0AB 4Y5RD 3IJCA 1H2YA 5H17A 1YFQA 5HE1B 4A0BA 5FA5B 5IC7A 5CYKA 4A11B 2HESX 5IJ8E 3PXWD 3JB9L 3FGBA 4GGCA 4RE5A 5CXCA 4UM9A 4BP9A 3F3GA 4J82A 3NIFA 1VE6A 4FAND 4J0XA 2EBSA 2B4EA 4AEZA 3EQ7A 2IUQA 3OL2A 5EARA 2OVRB 5I5MA 1B9YA 4Z7NA 4FA1D 5M5TA 3J80g 4G1EA 2XDWA 2CNXA 2QXVA 4GMBA 3IVMA 4Z7OA 1BPOA 4JSVC 3EI3A 3PSLA 2EIEA 2VDRA 2IAAA 4PBZA 1VYHC 3CFSB 3SMRA 1PBYB 3SCYA
chains in the Genus database with same CATH topology
4D9SA 1I2MB 4O2WA 4NAAA 4DNWA 3MVDK 1A12A 4NBMA 4JHPC 4NC4A 4L1MA 3OF7A 4QAMA 3KCIA 4JHNA 4DNUA 3QI0A 4DNVA 1JTDB 3QHYB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4D9S A;  1I2M B;  4O2W A;  4NAA A;  4DNW A;  3MVD K;  1A12 A;  4NBM A;  4JHP C;  4NC4 A;  4L1M A;  3OF7 A;  4QAM A;  3KCI A;  4JHN A;  4DNU A;  3QI0 A;  4DNV A;  1JTD B;  3QHY B; 
#chains in the Genus database with same CATH topology
 5FKR A;  3DXK C;  2AGW A;  3NVQ A;  1SQ9 A;  2HKR A;  4MMY A;  1C9I A;  4HDJ A;  5TF2 A;  3K72 A;  3CFV A;  2YB8 B;  2VDQ A;  3I7P A;  3IJ1 A;  4O9D A;  3ZE2 A;  1GP2 B;  4H5I A;  3IUN A;  3MZL A;  4JHP C;  4NC4 A;  4PC0 A;  4AMY A;  5K19 A;  1TBG A;  2P9U C;  3RRM C;  3AH8 B;  4AX4 A;  3V7D B;  3B7F A;  5FQD A;  1UOQ A;  2VC2 A;  3E0C A;  3O4I A;  4JHN A;  2AH0 A;  2H6Q A;  3QHY B;  5GXI A;  4J8B A;  3A0F A;  4WK2 A;  2P9P C;  2YBA A;  2B5L A;  3FCU A;  5C86 A;  5GXH A;  3MUN A;  2B5M A;  3UR4 A;  3O4H A;  4PNK B;  1NR0 A;  3UVN A;  4E5Z A;  2EIB A;  3K26 A;  1XIP A;  4A09 B;  3VGZ A;  4QAM A;  5EM2 B;  4L9O A;  5EMM B;  3ZDX A;  3FRX A;  2PBI B;  4PBY A;  3DXM C;  4JSP C;  4KFM B;  4DNU A;  5M5V A;  4CZX A;  1TYE A;  4ZOX A;  1OLZ A;  3OKT A;  5JWZ A;  2JKX A;  2HXC A;  4ERZ A;  2XL2 A;  1GOT B;  5THA A;  4A2M A;  3GD1 I;  4CY2 A;  4FAV D;  5EAL A;  2XE4 A;  2YMU A;  1TYQ C;  2HYE A;  3IUQ A;  2WQ8 A;  1JJU B;  3T3P A;  5C2V B;  4FA9 D;  2BKL A;  4A08 A;  1E8N A;  3JZG A;  4BCD A;  5EAM A;  2VZ3 A;  2OVQ B;  1H2X A;  3C9C A;  3F3P A;  4U7A A;  5EAP A;  5E6R A;  3JZN A;  2UZY B;  3MVD K;  4J86 A;  4I79 A;  1R5M A;  4X61 B;  2BBK H;  2CO0 A;  3I8C A;  1UOO A;  3EI2 B;  4X3E A;  2MTA H;  1A0R B;  2H9N A;  3VI4 A;  3MUO A;  1N6E A;  4AN0 A;  4MMZ A;  2I3S A;  2GC7 A;  4UM8 A;  3V9F A;  4L3G D;  5FKQ A;  1M1X A;  2EIC A;  3GFC A;  3EI1 A;  4CZY A;  4ZOY A;  3C99 A;  5I5I A;  2AQ5 A;  5TEF A;  3EI4 A;  4FA4 D;  3SXT D;  2PM9 B;  4QQE A;  1T2X A;  1L0Q A;  4NBM A;  4LG8 A;  4QL1 A;  5KDO B;  4K3J B;  3SWS D;  1P22 A;  1U4C A;  4E54 A;  2H9M A;  3VI3 A;  3IIY A;  2HU8 A;  3I7H A;  2HU5 A;  2I0T A;  1JMX B;  2VDP A;  4G56 B;  4AMZ A;  3NID A;  1E5T A;  2YNP A;  1OMW B;  4U1E I;  4H5J A;  4ERQ A;  5E6S A;  3EG6 A;  2QZP A;  5EML B;  4CZV A;  4D9S A;  4WK4 A;  2HU7 A;  4K3I D;  3IUJ A;  3V5W B;  3T3M A;  2XYI A;  5CXC B;  5M5U A;  2H68 A;  2OIZ A;  2PM6 B;  3IUM A;  2G99 A;  2VZ1 A;  3MMY A;  3AL8 B;  3C75 H;  2B5N A;  3K27 A;  3OL2 B;  3PXS D;  3SBQ A;  4BCB A;  3DWL C;  2CE8 A;  4GM9 A;  4GGA A;  3L4M D;  3DM0 A;  3I7L A;  4Z7Q A;  2P9I C;  3GC3 B;  5H1M A;  4BH6 A;  1GOG A;  3UVL A;  1PGU A;  1JTD B;  3NIG A;  4O45 A;  2Z2O A;  1GOF A;  4TZ4 A;  1RI6 A;  4J84 A;  5EMK B;  5HDB A;  3EI3 B;  3OKY B;  4DNW A;  3IIW A;  3I8E A;  3SFZ A;  2AGX A;  2AGY A;  2XL3 A;  3ULE C;  3OW8 A;  4J0W A;  4R7A B;  3ORV D;  4O1Q D;  1QNI A;  3MKQ A;  2XZG A;  2H6K A;  2VDM A;  4L1M A;  3EQ9 A;  4PSW B;  2IWF A;  1YR2 A;  1UOP A;  3SN6 B;  2YNO A;  1NEX B;  1VZ3 A;  4QRJ A;  5CXB B;  5E6U A;  4J78 A;  4FB1 D;  3IUL A;  4L3H D;  4GQ1 A;  4PXW A;  3HFQ A;  4L1Q D;  3ODT A;  2P9N C;  5IGO A;  4NAA A;  4ZOV A;  1FWX A;  4A2L A;  1SHY B;  2H47 A;  4AOW A;  5GSA A;  5AMS A;  4XYI A;  5H14 A;  4JT5 C;  1SQJ A;  2VDK A;  4IA9 A;  2Z2N A;  2OK4 A;  4JSX C;  4A7J A;  4J77 A;  5C2W B;  2J56 H;  3NVN A;  3L4O D;  4Y7R A;  3IUR A;  3P4F A;  2H9P A;  3K71 A;  1GOH A;  2H3X A;  4MK0 B;  4A0A A;  5FFO A;  4ZOZ A;  4D6V A;  4QT8 A;  5HE2 B;  4RE6 A;  4IRZ A;  3VA6 A;  4A11 A;  4D0K A;  4G55 A;  3KRX B;  1XHM A;  3ZE1 A;  2H14 A;  4WK0 A;  1JV2 A;  3JZH A;  4CI2 A;  2W18 A;  3RSE C;  4CI8 A;  3GRE A;  4CY1 A;  2AH1 A;  4UI9 R;  4ESG A;  4O02 A;  2I0R A;  2IWK A;  3EMH A;  2OJY A;  4CY5 A;  4EWR A;  2AGZ A;  3EU7 A;  3DDU A;  2G9A A;  2QC5 A;  5SXM A;  4O2W A;  5M61 A;  5EMJ B;  4A08 B;  4BCC A;  4ERY A;  3W15 A;  2IUR A;  3PVW B;  3DSM A;  2CN3 A;  2Q7Q A;  4LG9 A;  3UKR C;  2CE9 A;  3SLE D;  4WJK A;  3MXX A;  4Z8L A;  5K1C C;  4GZ8 A;  4X63 B;  2OK6 A;  3N0E A;  4J79 A;  2P9K C;  2Z2P A;  3VH0 A;  4CI1 A;  1C9L A;  3JRO A;  3PVU B;  3SBP A;  3RMZ D;  4A0B B;  5CYK B;  1VZ2 A;  2HJB A;  4O3T B;  3NVX A;  3AL8 A;  1ERJ A;  2BCJ B;  3FCS A;  1K8K C;  2J55 H;  4BP8 A;  1UTC A;  3IKO A;  4XEI C;  2IUV A;  3U4Y A;  3FM0 A;  3K6S A;  1A12 A;  5IGQ A;  2OVP B;  3JPX A;  2GNQ A;  4FHL A;  4O3U B;  2O9K A;  3EI1 B;  3KCI A;  3CIK B;  2VDL A;  4JSN C;  3RN0 D;  3OKY A;  3EI4 B;  4NSX A;  2H6N A;  3O4J A;  5FKT A;  1H2W A;  4IMM A;  2I0S A;  5AJA A;  1PEV A;  1QFM A;  3MKS B;  3QI0 A;  3J81 g;  5HE3 B;  4E54 B;  1MG3 A;  1B9X A;  4J73 A;  3C5M A;  1MDA H;  3UKU C;  1JOF A;  2UZX B;  3SBR A;  3JAM g;  4A09 A;  4FWW A;  4JXM A;  4G1M A;  4AN1 A;  5EM2 A;  2PM7 B;  3RFG A;  5CXB A;  4PSX B;  2P9S C;  3N0D A;  5FFG A;  4GQB B;  4JT6 C;  4BL0 A;  1GXR A;  1U2V C;  1K3I A;  3OF7 A;  4X60 B;  5HYN B;  3IJE A;  3SJL D;  3BG0 A;  3ZDZ A;  2HKM A;  1MG2 A;  1L5G A;  3EWE A;  3RFH A;  4GM8 A;  4XYH A;  4ES0 A;  3SVW D;  1S4U X;  1Q47 A;  4ZN4 A;  1O6F A;  3UVM A;  2XU7 A;  4CY3 A;  3BG1 A;  3F3F A;  3I2N A;  3RN1 D;  3UVK A;  2H9L A;  5C9Z B;  5A2Q g;  3ZDY A;  3O4G A;  5FKS A;  1PI6 A;  1N6D A;  3I7O A;  1E8M A;  3JRP A;  3PE7 A;  3V4P A;  5M5S A;  2J57 G;  3I7N A;  1QFS A;  1O6G A;  2YNN A;  5AFU 3;  2P9L C;  5M5R A;  3ZWL B;  2TRC B;  3KRW B;  4BUJ C;  3PSC B;  1K32 A;  4E5Z B;  4CI3 A;  5TEE A;  2I3T A;  3OTT A;  5I5J A;  4DNV A;  3V4V A;  3RLM D;  1U8C A;  4LGN A;  1I2M B;  3AL9 A;  4GM3 A;  2IUP A;  3EI2 A;  1H2Z A;  1N6F A;  5HE0 B;  5HQG A;  2VDN A;  4JD2 C;  3PXT D;  3UVO A;  4J81 A;  4FA5 D;  4NEN A;  2CO0 C;  3ZE0 A;  5FLX g;  5TDH B;  3SHF A;  1GG2 B;  3MZK A;  3BWS A;  2VDO A;  4GGD A;  4GQ2 P;  3AFC A;  4J87 A;  2GC4 A;  4CC9 A;  3IJ0 A;  2PM9 A;  2AGL A;  4N14 A;  5FXY A;  2EID A;  5GMK n;  2HJ4 A;  3I89 A;  3EQ8 A;  2QR5 A;  3OKW A;  1VE7 A;  4J8G A;  1JMZ B;  5IT9 g;  2CN2 A;  4YVD A;  5B4W A;  5IJ7 E;  1XKS A;  4OZU A;  3I7K A;  2H13 A;  4MMX A;  4OWR A;  5C92 A;  4A0A B;  4Y5R D;  3IJC A;  1H2Y A;  5H17 A;  1YFQ A;  5HE1 B;  4A0B A;  5FA5 B;  5IC7 A;  5CYK A;  4A11 B;  2HES X;  5IJ8 E;  3PXW D;  3JB9 L;  3FGB A;  4GGC A;  4RE5 A;  5CXC A;  4UM9 A;  4BP9 A;  3F3G A;  4J82 A;  3NIF A;  1VE6 A;  4FAN D;  4J0X A;  2EBS A;  2B4E A;  4AEZ A;  3EQ7 A;  2IUQ A;  3OL2 A;  5EAR A;  2OVR B;  5I5M A;  1B9Y A;  4Z7N A;  4FA1 D;  5M5T A;  3J80 g;  4G1E A;  2XDW A;  2CNX A;  2QXV A;  4GMB A;  3IVM A;  4Z7O A;  1BPO A;  4JSV C;  3EI3 A;  3PSL A;  2EIE A;  2VDR A;  2IAA A;  4PBZ A;  1VYH C;  3CFS B;  3SMR A;  1PBY B;  3SCY A; 
#chains in the Genus database with same CATH homology
 4D9S A;  1I2M B;  4O2W A;  4NAA A;  4DNW A;  3MVD K;  1A12 A;  4NBM A;  4JHP C;  4NC4 A;  4L1M A;  3OF7 A;  4QAM A;  3KCI A;  4JHN A;  4DNU A;  3QI0 A;  4DNV A;  1JTD B;  3QHY B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...