4O2WA

Crystal structure of the third rcc1-like domain of herc1
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
365
structure length
365
Chain Sequence
b'KCDVYLWGAGRHGQLAEAGRNVMVPAAAPSFSQAQQVICGQNCTFVIQANGTVLACGEGSYGRLGQGNSDDLHVLTVISALQGFVVTQLVTSCGSDGHSMALTESGEVFSWGDGDYGKLGHGNSDRQRRPRQIEALQGEEVVQMSCGFKHSAVVTSDGKLFTFGNGDYGRLGLGNTSNKKLPERVTALEGYQIGQVACGLNHTLAVSADGSMVWAFGDGDYGKLGLGNSTAKSSPQKIDVLCGIGIKKVACGTQFSVALTKDGHVYTFGQDRLIGLPEGRARNHNRPQQIPVLAGVIIEDVAVGAEHTLALASNGDVYAWGSNSEGQLGLGHTNHVREPTLVTGLQGKNVRQISAGRCHSAAWTA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 ubiquitin-protein ligase HERC1
publication title Crystal structure of the third RCC1-like domain of HERC1
rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 104
structure length 365
sequence length 365
chains with identical sequence B, C, D
ec nomenclature ec 2.3.2.26: HECT-type E3 ubiquitin transferase.
pdb deposition date 2013-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00415 RCC1 Regulator of chromosome condensation (RCC1) repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.30 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Regulator of chromosome condensation 1/beta-lactamase-inhibitor protein II 4o2wA00
4JHNA 4DNUA 3KCIA 3MVDK 4JHPC 3QI0A 4QAMA 4NC4A 4DNVA 3QHYB 4DNWA 4NAAA 3OF7A 4D9SA 1A12A 4O2WA 4L1MA 1JTDB 4NBMA 1I2MB
chains in the Genus database with same CATH superfamily
3BWSA 1C9LA 3AH8B 1H2YA 4U1EI 3I7OA 3ZE0A 4DNUA 3ZDZA 3IJ0A 2BBKH 5M5UA 3SN6B 3FRXA 3IJCA 3J80g 2VZ3A 1H2WA 5FFGA 3OKYB 3RSEC 2B5LA 1YR2A 2Z2NA 3V9FA 3EU7A 1UOOA 4H5JA 2OVRB 4WK0A 3HFQA 3JZNA 3IJ1A 1TYQC 5THAA 2H47A 1XKSA 2UZYB 4A11B 1UOPA 1PI6A 2HJ4A 4GMBA 5EALA 4GM3A 4A0BA 2EIBA 3UVOA 4PSXB 2AQ5A 3EWEA 3QI0A 5FFOA 3EI3B 4G56B 4FHLA 5C92A 2J57G 4PXWA 2GC4A 2J55H 4O02A 3IVMA 4TZ4A 1P22A 4X60B 5SXMA 5FKSA 4CY2A 5EARA 4BUJC 2BCJB 3EI1A 4NSXA 4JSPC 3IUQA 4CI3A 5B4WA 1SQJA 4Y5RD 4A09B 5HE1B 1MG2A 3O4HA 5FA5B 4A7JA 3RN0D 4I79A 1L0QA 5K1CC 3V7DB 2XDWA 5CXBB 4J79A 4AMZA 2EIDA 4ZOYA 3IKOA 3DXMC 3UVMA 4ZOZA 2AGLA 3IURA 5M61A 3RLMD 3AL8B 3T3MA 1A12A 1PBYB 2O9KA 1VZ3A 4KFMB 3B7FA 1JTDB 5TDHB 2AH0A 3EQ8A 5IJ8E 2OJYA 1E8NA 4NENA 5AMSA 3IULA 4PBZA 1L5GA 1SHYB 3ULEC 3DWLC 4CI8A 2H3XA 1NEXB 3AL9A 4O1QD 1K3IA 2W18A 5CXCB 2CN2A 3OF7A 3MXXA 1VE7A 3FCSA 5M5RA 2G99A 4GM9A 2YNNA 2VZ1A 1UOQA 4L9OA 4ERYA 3FM0A 4FAVD 2GNQA 3F3GA 4O3TB 2VDQA 1U8CA 2VDOA 3AFCA 3PXTD 5FKTA 4J84A 2IAAA 4JSXC 1SQ9A 5HE3B 3VA6A 4GGCA 5FQDA 3CFVA 3OKYA 4RE6A 3NIGA 3OL2A 3PVUB 2PM7B 3MMYA 3EG6A 4AMYA 5C2WB 1B9YA 3CIKB 1PGUA 3IUMA 3MZLA 2QC5A 4OZUA 4XYIA 2QR5A 4MMZA 4A11A 1M1XA 2OVPB 4X63B 1XIPA 5H17A 3SMRA 2PM6B 3UVNA 5HDBA 1PEVA 4UM9A 2I0RA 3IIYA 1OMWB 2H14A 2BKLA 3OKTA 5FKQA 3EI3A 3MKSB 5H14A 3IIWA 3SWSD 5FXYA 3N0EA 3A0FA 3I7HA 4JT6C 5IGOA 2AGYA 2XYIA 2YMUA 3OL2B 2P9KC 2B5MA 4ERQA 4GQ2P 2EIEA 4WK2A 1JMZB 3C9CA 4ZOXA 3V4PA 3MUNA 1A0RB 1GOTB 5HE0B 4A09A 2UZXB 3ZE2A 1GG2B 3I8CA 2IWKA 5CXBA 1JOFA 3K27A 2AGWA 3MUOA 3GC3B 4J86A 2JKXA 2HKRA 3DXKC 4L3GD 1TBGA 3UR4A 5K19A 1BPOA 1QNIA 3ORVD 4D0KA 3EQ9A 4PSWB 4E5ZB 2YB8B 1U2VC 2QZPA 3AL8A 2H6KA 4E54B 4D9SA 1C9IA 1H2ZA 2HU5A 3CFSB 4CY1A 2AH1A 5M5TA 1O6GA 4R7AB 3L4MD 5HQGA 4X3EA 4CZYA 2H9MA 4RE5A 3FGBA 3E0CA 4GQBB 3UVKA 3DM0A 4JD2C 2WQ8A 1MDAH 2HJBA 4G1MA 2H9PA 3OKWA 4WJKA 3RRMC 2IWFA 3UKUC 5C86A 3I7PA 1QFMA 4A0AB 1E8MA 2XL3A 3BG1A 4CI1A 3SBPA 5CXCA 4LG8A 2EICA 5IC7A 5C9ZB 4BH6A 3UKRC 1O6FA 3PXSD 1JMXB 2MTAH 4ZN4A 4K3JB 4A08B 3GD1I 3RMZD 4AN1A 3ZDYA 3W15A 3PSCB 3SHFA 2Z2PA 2YNPA 3VH0A 4NBMA 4Z7OA 5IT9g 5H1MA 5IGQA 1VZ2A 5GMKn 3L4OD 4J77A 5GXHA 1NR0A 1ERJA 3VI4A 3KRXB 4QAMA 2I0SA 1U4CA 3RFHA 3NVNA 4JSVC 4J87A 4QT8A 4L3HD 2EBSA 1JV2A 3JZHA 4MMXA 3K26A 3SJLD 3ZWLB 5FKRA 5IJ7E 4WK4A 3MZKA 4LGNA 5AFU3 3EI4B 2VDLA 4BP8A 2VDNA 4BL0A 3OW8A 3NIDA 4XYHA 4CY3A 3PXWD 4CC9A 5EAPA 2XU7A 3O4IA 5I5JA 2AGXA 5CYKB 1N6FA 3EI2B 2P9LC 3FCUA 2XE4A 4JT5C 3I7NA 4NAAA 3JB9L 1GXRA 2H68A 2XL2A 4L1QD 4XEIC 1YFQA 3SFZA 3NVXA 3UVLA 3K6SA 2I3SA 4Z8LA 2P9PC 4IRZA 1UTCA 2IURA 5EMLB 5FLXg 5A2Qg 3K71A 2YBAA 1N6DA 3DSMA 5GXIA 2VDRA 2GC7A 4PNKB 4EWRA 2PM9B 3ODTA 3MVDK 2I3TA 1H2XA 4GGDA 4CZXA 3SCYA 2VDKA 4E5ZA 4CZVA 5HE2B 2G9AA 5KDOB 4E54A 3EMHA 3J81g 2H6QA 3PSLA 5I5IA 3RN1D 2H13A 3VI3A 2P9SC 2CO0A 2OK4A 4J0WA 3RFGA 4PBYA 4JXMA 4L1MA 4BCDA 4O3UB 4GM8A 4MK0B 4J0XA 4IA9A 4A2LA 4QQEA 4Z7NA 4UI9R 1VYHC 1K8KC 1GP2B 4FAND 4A0AA 3JAMg 1GOGA 2HU8A 2HKMA 1TYEA 2P9UC 3V5WB 3VGZA 3V4VA 5E6SA 4A08A 5GSAA 3NIFA 3GFCA 3JZGA 2OK6A 4BP9A 4BCBA 4PC0A 3P4FA 2HESX 4G55A 4AN0A 1N6EA 4J8GA 5TF2A 5HYNB 4CY5A 2VC2A 3MKQA 3KCIA 2YNOA 3O4GA 3I8EA 3C5MA 3NVQA 3SBRA 5TEFA 4NC4A 1RI6A 4DNVA 4FA4D 4AX4A 2B4EA 4H5IA 2HYEA 2IUPA 3N0DA 4FB1D 3SLED 3I7KA 2H9LA 2IUVA 3JROA 1R5MA 1QFSA 4BCCA 3I7LA 3PVWB 4CI2A 3EI4A 1FWXA 2AGZA 4ZOVA 3ZE1A 1E5TA 2CO0C 3O4JA 3IUNA 5EAMA 2P9NC 4A0BB 2HXCA 1GOFA 2CNXA 3EI2A 5CYKA 3QHYB 1Q47A 4GQ1A 5I5MA 3GREA 4IMMA 5TEEA 2VDMA 4J82A 4O9DA 5M5SA 1K32A 4AEZA 2IUQA 4LG9A 4U7AA 5EMJB 3F3PA 5EMMB 3EI1B 2Z2OA 3F3FA 3BG0A 4J73A 4ESGA 2J56H 1S4UX 4QRJA 4FA5D 1I2MB 3K72A 2CE9A 2PM9A 2Q7QA 5JWZA 3OTTA 3C75H 4JSNC 2H9NA 4JHPC 5EM2A 4J78A 3ZDXA 5E6UA 2P9IC 3JPXA 4J81A 3SBQA 5C2VB 2OIZA 5E6RA 3T3PA 3EQ7A 4YVDA 4QL1A 2OVQB 1MG3A 1OLZA 3I89A 4OWRA 4FA1D 4UM8A 2B5NA 4MMYA 3PE7A 4ES0A 5AJAA 4GGAA 2H6NA 4G1EA 1GOHA 4D6VA 4AOWA 4N14A 1T2XA 3IJEA 5EMKB 3JRPA 1B9XA 4JHNA 4GZ8A 2PBIB 3I2NA 1XHMA 4X61B 4A2MA 4FWWA 2CE8A 2CN3A 4J8BA 4K3ID 4O45A 5EM2B 4DNWA 4HDJA 4ERZA 3IUJA 3SVWD 5M5VA 2TRCB 2VDPA 3SXTD 2I0TA 4Y7RA 3U4YA 2XZGA 2HU7A 3C99A 4FA9D 1JJUB 4Z7QA 4O2WA 2QXVA 3DDUA 3KRWB 1VE6A
chains in the Genus database with same CATH topology
4JHNA 4DNUA 3KCIA 3MVDK 4JHPC 3QI0A 4QAMA 4NC4A 4DNVA 3QHYB 4DNWA 4NAAA 3OF7A 4D9SA 1A12A 4O2WA 4L1MA 1JTDB 4NBMA 1I2MB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JHN A;  4DNU A;  3KCI A;  3MVD K;  4JHP C;  3QI0 A;  4QAM A;  4NC4 A;  4DNV A;  3QHY B;  4DNW A;  4NAA A;  3OF7 A;  4D9S A;  1A12 A;  4O2W A;  4L1M A;  1JTD B;  4NBM A;  1I2M B; 
#chains in the Genus database with same CATH topology
 3BWS A;  1C9L A;  3AH8 B;  1H2Y A;  4U1E I;  3I7O A;  3ZE0 A;  4DNU A;  3ZDZ A;  3IJ0 A;  2BBK H;  5M5U A;  3SN6 B;  3FRX A;  3IJC A;  3J80 g;  2VZ3 A;  1H2W A;  5FFG A;  3OKY B;  3RSE C;  2B5L A;  1YR2 A;  2Z2N A;  3V9F A;  3EU7 A;  1UOO A;  4H5J A;  2OVR B;  4WK0 A;  3HFQ A;  3JZN A;  3IJ1 A;  1TYQ C;  5THA A;  2H47 A;  1XKS A;  2UZY B;  4A11 B;  1UOP A;  1PI6 A;  2HJ4 A;  4GMB A;  5EAL A;  4GM3 A;  4A0B A;  2EIB A;  3UVO A;  4PSX B;  2AQ5 A;  3EWE A;  3QI0 A;  5FFO A;  3EI3 B;  4G56 B;  4FHL A;  5C92 A;  2J57 G;  4PXW A;  2GC4 A;  2J55 H;  4O02 A;  3IVM A;  4TZ4 A;  1P22 A;  4X60 B;  5SXM A;  5FKS A;  4CY2 A;  5EAR A;  4BUJ C;  2BCJ B;  3EI1 A;  4NSX A;  4JSP C;  3IUQ A;  4CI3 A;  5B4W A;  1SQJ A;  4Y5R D;  4A09 B;  5HE1 B;  1MG2 A;  3O4H A;  5FA5 B;  4A7J A;  3RN0 D;  4I79 A;  1L0Q A;  5K1C C;  3V7D B;  2XDW A;  5CXB B;  4J79 A;  4AMZ A;  2EID A;  4ZOY A;  3IKO A;  3DXM C;  3UVM A;  4ZOZ A;  2AGL A;  3IUR A;  5M61 A;  3RLM D;  3AL8 B;  3T3M A;  1A12 A;  1PBY B;  2O9K A;  1VZ3 A;  4KFM B;  3B7F A;  1JTD B;  5TDH B;  2AH0 A;  3EQ8 A;  5IJ8 E;  2OJY A;  1E8N A;  4NEN A;  5AMS A;  3IUL A;  4PBZ A;  1L5G A;  1SHY B;  3ULE C;  3DWL C;  4CI8 A;  2H3X A;  1NEX B;  3AL9 A;  4O1Q D;  1K3I A;  2W18 A;  5CXC B;  2CN2 A;  3OF7 A;  3MXX A;  1VE7 A;  3FCS A;  5M5R A;  2G99 A;  4GM9 A;  2YNN A;  2VZ1 A;  1UOQ A;  4L9O A;  4ERY A;  3FM0 A;  4FAV D;  2GNQ A;  3F3G A;  4O3T B;  2VDQ A;  1U8C A;  2VDO A;  3AFC A;  3PXT D;  5FKT A;  4J84 A;  2IAA A;  4JSX C;  1SQ9 A;  5HE3 B;  3VA6 A;  4GGC A;  5FQD A;  3CFV A;  3OKY A;  4RE6 A;  3NIG A;  3OL2 A;  3PVU B;  2PM7 B;  3MMY A;  3EG6 A;  4AMY A;  5C2W B;  1B9Y A;  3CIK B;  1PGU A;  3IUM A;  3MZL A;  2QC5 A;  4OZU A;  4XYI A;  2QR5 A;  4MMZ A;  4A11 A;  1M1X A;  2OVP B;  4X63 B;  1XIP A;  5H17 A;  3SMR A;  2PM6 B;  3UVN A;  5HDB A;  1PEV A;  4UM9 A;  2I0R A;  3IIY A;  1OMW B;  2H14 A;  2BKL A;  3OKT A;  5FKQ A;  3EI3 A;  3MKS B;  5H14 A;  3IIW A;  3SWS D;  5FXY A;  3N0E A;  3A0F A;  3I7H A;  4JT6 C;  5IGO A;  2AGY A;  2XYI A;  2YMU A;  3OL2 B;  2P9K C;  2B5M A;  4ERQ A;  4GQ2 P;  2EIE A;  4WK2 A;  1JMZ B;  3C9C A;  4ZOX A;  3V4P A;  3MUN A;  1A0R B;  1GOT B;  5HE0 B;  4A09 A;  2UZX B;  3ZE2 A;  1GG2 B;  3I8C A;  2IWK A;  5CXB A;  1JOF A;  3K27 A;  2AGW A;  3MUO A;  3GC3 B;  4J86 A;  2JKX A;  2HKR A;  3DXK C;  4L3G D;  1TBG A;  3UR4 A;  5K19 A;  1BPO A;  1QNI A;  3ORV D;  4D0K A;  3EQ9 A;  4PSW B;  4E5Z B;  2YB8 B;  1U2V C;  2QZP A;  3AL8 A;  2H6K A;  4E54 B;  4D9S A;  1C9I A;  1H2Z A;  2HU5 A;  3CFS B;  4CY1 A;  2AH1 A;  5M5T A;  1O6G A;  4R7A B;  3L4M D;  5HQG A;  4X3E A;  4CZY A;  2H9M A;  4RE5 A;  3FGB A;  3E0C A;  4GQB B;  3UVK A;  3DM0 A;  4JD2 C;  2WQ8 A;  1MDA H;  2HJB A;  4G1M A;  2H9P A;  3OKW A;  4WJK A;  3RRM C;  2IWF A;  3UKU C;  5C86 A;  3I7P A;  1QFM A;  4A0A B;  1E8M A;  2XL3 A;  3BG1 A;  4CI1 A;  3SBP A;  5CXC A;  4LG8 A;  2EIC A;  5IC7 A;  5C9Z B;  4BH6 A;  3UKR C;  1O6F A;  3PXS D;  1JMX B;  2MTA H;  4ZN4 A;  4K3J B;  4A08 B;  3GD1 I;  3RMZ D;  4AN1 A;  3ZDY A;  3W15 A;  3PSC B;  3SHF A;  2Z2P A;  2YNP A;  3VH0 A;  4NBM A;  4Z7O A;  5IT9 g;  5H1M A;  5IGQ A;  1VZ2 A;  5GMK n;  3L4O D;  4J77 A;  5GXH A;  1NR0 A;  1ERJ A;  3VI4 A;  3KRX B;  4QAM A;  2I0S A;  1U4C A;  3RFH A;  3NVN A;  4JSV C;  4J87 A;  4QT8 A;  4L3H D;  2EBS A;  1JV2 A;  3JZH A;  4MMX A;  3K26 A;  3SJL D;  3ZWL B;  5FKR A;  5IJ7 E;  4WK4 A;  3MZK A;  4LGN A;  5AFU 3;  3EI4 B;  2VDL A;  4BP8 A;  2VDN A;  4BL0 A;  3OW8 A;  3NID A;  4XYH A;  4CY3 A;  3PXW D;  4CC9 A;  5EAP A;  2XU7 A;  3O4I A;  5I5J A;  2AGX A;  5CYK B;  1N6F A;  3EI2 B;  2P9L C;  3FCU A;  2XE4 A;  4JT5 C;  3I7N A;  4NAA A;  3JB9 L;  1GXR A;  2H68 A;  2XL2 A;  4L1Q D;  4XEI C;  1YFQ A;  3SFZ A;  3NVX A;  3UVL A;  3K6S A;  2I3S A;  4Z8L A;  2P9P C;  4IRZ A;  1UTC A;  2IUR A;  5EML B;  5FLX g;  5A2Q g;  3K71 A;  2YBA A;  1N6D A;  3DSM A;  5GXI A;  2VDR A;  2GC7 A;  4PNK B;  4EWR A;  2PM9 B;  3ODT A;  3MVD K;  2I3T A;  1H2X A;  4GGD A;  4CZX A;  3SCY A;  2VDK A;  4E5Z A;  4CZV A;  5HE2 B;  2G9A A;  5KDO B;  4E54 A;  3EMH A;  3J81 g;  2H6Q A;  3PSL A;  5I5I A;  3RN1 D;  2H13 A;  3VI3 A;  2P9S C;  2CO0 A;  2OK4 A;  4J0W A;  3RFG A;  4PBY A;  4JXM A;  4L1M A;  4BCD A;  4O3U B;  4GM8 A;  4MK0 B;  4J0X A;  4IA9 A;  4A2L A;  4QQE A;  4Z7N A;  4UI9 R;  1VYH C;  1K8K C;  1GP2 B;  4FAN D;  4A0A A;  3JAM g;  1GOG A;  2HU8 A;  2HKM A;  1TYE A;  2P9U C;  3V5W B;  3VGZ A;  3V4V A;  5E6S A;  4A08 A;  5GSA A;  3NIF A;  3GFC A;  3JZG A;  2OK6 A;  4BP9 A;  4BCB A;  4PC0 A;  3P4F A;  2HES X;  4G55 A;  4AN0 A;  1N6E A;  4J8G A;  5TF2 A;  5HYN B;  4CY5 A;  2VC2 A;  3MKQ A;  3KCI A;  2YNO A;  3O4G A;  3I8E A;  3C5M A;  3NVQ A;  3SBR A;  5TEF A;  4NC4 A;  1RI6 A;  4DNV A;  4FA4 D;  4AX4 A;  2B4E A;  4H5I A;  2HYE A;  2IUP A;  3N0D A;  4FB1 D;  3SLE D;  3I7K A;  2H9L A;  2IUV A;  3JRO A;  1R5M A;  1QFS A;  4BCC A;  3I7L A;  3PVW B;  4CI2 A;  3EI4 A;  1FWX A;  2AGZ A;  4ZOV A;  3ZE1 A;  1E5T A;  2CO0 C;  3O4J A;  3IUN A;  5EAM A;  2P9N C;  4A0B B;  2HXC A;  1GOF A;  2CNX A;  3EI2 A;  5CYK A;  3QHY B;  1Q47 A;  4GQ1 A;  5I5M A;  3GRE A;  4IMM A;  5TEE A;  2VDM A;  4J82 A;  4O9D A;  5M5S A;  1K32 A;  4AEZ A;  2IUQ A;  4LG9 A;  4U7A A;  5EMJ B;  3F3P A;  5EMM B;  3EI1 B;  2Z2O A;  3F3F A;  3BG0 A;  4J73 A;  4ESG A;  2J56 H;  1S4U X;  4QRJ A;  4FA5 D;  1I2M B;  3K72 A;  2CE9 A;  2PM9 A;  2Q7Q A;  5JWZ A;  3OTT A;  3C75 H;  4JSN C;  2H9N A;  4JHP C;  5EM2 A;  4J78 A;  3ZDX A;  5E6U A;  2P9I C;  3JPX A;  4J81 A;  3SBQ A;  5C2V B;  2OIZ A;  5E6R A;  3T3P A;  3EQ7 A;  4YVD A;  4QL1 A;  2OVQ B;  1MG3 A;  1OLZ A;  3I89 A;  4OWR A;  4FA1 D;  4UM8 A;  2B5N A;  4MMY A;  3PE7 A;  4ES0 A;  5AJA A;  4GGA A;  2H6N A;  4G1E A;  1GOH A;  4D6V A;  4AOW A;  4N14 A;  1T2X A;  3IJE A;  5EMK B;  3JRP A;  1B9X A;  4JHN A;  4GZ8 A;  2PBI B;  3I2N A;  1XHM A;  4X61 B;  4A2M A;  4FWW A;  2CE8 A;  2CN3 A;  4J8B A;  4K3I D;  4O45 A;  5EM2 B;  4DNW A;  4HDJ A;  4ERZ A;  3IUJ A;  3SVW D;  5M5V A;  2TRC B;  2VDP A;  3SXT D;  2I0T A;  4Y7R A;  3U4Y A;  2XZG A;  2HU7 A;  3C99 A;  4FA9 D;  1JJU B;  4Z7Q A;  4O2W A;  2QXV A;  3DDU A;  3KRW B;  1VE6 A; 
#chains in the Genus database with same CATH homology
 4JHN A;  4DNU A;  3KCI A;  3MVD K;  4JHP C;  3QI0 A;  4QAM A;  4NC4 A;  4DNV A;  3QHY B;  4DNW A;  4NAA A;  3OF7 A;  4D9S A;  1A12 A;  4O2W A;  4L1M A;  1JTD B;  4NBM A;  1I2M B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...