4O2WA

Crystal structure of the third rcc1-like domain of herc1
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
365
structure length
365
Chain Sequence
KCDVYLWGAGRHGQLAEAGRNVMVPAAAPSFSQAQQVICGQNCTFVIQANGTVLACGEGSYGRLGQGNSDDLHVLTVISALQGFVVTQLVTSCGSDGHSMALTESGEVFSWGDGDYGKLGHGNSDRQRRPRQIEALQGEEVVQMSCGFKHSAVVTSDGKLFTFGNGDYGRLGLGNTSNKKLPERVTALEGYQIGQVACGLNHTLAVSADGSMVWAFGDGDYGKLGLGNSTAKSSPQKIDVLCGIGIKKVACGTQFSVALTKDGHVYTFGQDRLIGLPEGRARNHNRPQQIPVLAGVIIEDVAVGAEHTLALASNGDVYAWGSNSEGQLGLGHTNHVREPTLVTGLQGKNVRQISAGRCHSAAWTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the third RCC1-like domain of HERC1
rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords E3 ubiquitin-protein ligase HERC1
total genus 104
structure length 365
sequence length 365
chains with identical sequence B, C, D
ec nomenclature ec 2.3.2.26: HECT-type E3 ubiquitin transferase.
pdb deposition date 2013-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00415 RCC1 Regulator of chromosome condensation (RCC1) repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.30 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Regulator of chromosome condensation 1/beta-lactamase-inhibitor protein II 4o2wA00
4D9SA 4DNVA 4DNUA 3KCIA 3QI0A 3MVDK 4NBMA 4NAAA 4NC4A 1A12A 4JHPC 4JHNA 4L1MA 4O2WA 4QAMA 4DNWA 3QHYB 3OF7A 1JTDB 1I2MB
chains in the Genus database with same CATH superfamily
4ES0A 3C75H 4J73A 5HE1B 1H2XA 2HKMA 4JHNA 4ZN4A 2AGZA 2EIBA 2BBKH 4BCDA 5IGOA 2GNQA 1A0RB 3AL8A 5I5JA 3V9FA 2PBIB 4GQ2P 5H17A 2H6KA 4WK0A 3W15A 2HJBA 4AMZA 4MK0B 2H68A 3PVWB 3MKQA 4OWRA 5HYNB 4G1EA 1T2XA 3F3GA 3ZWLB 2IUVA 5AJAA 1JMZB 3KRXB 5C9ZB 1YFQA 2MTAH 5HE2B 1RI6A 5CYKA 4A08B 4FAVD 2J57G 4UM9A 1JJUB 2J56H 2WQ8A 3HFQA 4O02A 3PSCB 3UR4A 5FKTA 3E0CA 5M5UA 3BG0A 4E54B 5H1MA 5EMKB 2PM9A 3I8EA 2P9LC 3VI3A 1K32A 2HU5A 2QR5A 3AFCA 3SXTD 2YNOA 5FXYA 2GC4A 1A12A 2CN3A 4EWRA 2AGLA 3I7PA 4CI2A 4A2LA 4Z7OA 5C92A 2TRCB 1H2WA 4OZUA 1VZ2A 5I5MA 2HU8A 3MMYA 1MDAH 3L4MD 3O4IA 4J87A 4JSNC 3K6SA 2H9PA 3EI3B 3RLMD 3UVOA 3ZDXA 4ZOVA 1MG2A 3OKWA 4NBMA 1TBGA 4A09A 2XE4A 5H14A 3I89A 1C9IA 3O4HA 4MMYA 2CNXA 2H14A 4CZVA 2H6QA 4L3GD 1O6FA 3UVMA 3I7KA 3EI4B 4J81A 4DNVA 1B9YA 2OK6A 3MVDK 2G9AA 2EIEA 2H9MA 4K3JB 1JMXB 3NVXA 3JZHA 4A2MA 3EMHA 3MUNA 4PBZA 5FFGA 2H9NA 4J8BA 1JOFA 3IJCA 3JRPA 1GG2B 1FWXA 3AH8B 4TZ4A 4PC0A 1XKSA 5EALA 2CE9A 4CI3A 4PXWA 1GOFA 5EMLB 3SMRA 2AH0A 3SBRA 3EI4A 1GOTB 3CFVA 5HE0B 4Y5RD 5IJ7E 2P9SC 5FLXg 2IWKA 2VDPA 4O9DA 4UI9R 3ZDZA 4X60B 4L9OA 4AMYA 3I7NA 4L1MA 3NVQA 1GOHA 1PEVA 4ERQA 2HYEA 5GXIA 3EQ8A 5IC7A 2UZXB 4J0WA 5CYKB 4RE5A 1MG3A 2HXCA 5TF2A 4D0KA 4Y7RA 3N0DA 3SJLD 1SQ9A 3KCIA 2H9LA 5EAPA 5A2Qg 1L0QA 1C9LA 4CY5A 4ERYA 4I79A 2I0SA 5C2VB 4NSXA 2PM9B 2PM6B 1R5MA 1U2VC 4D6VA 2EIDA 3DDUA 3EI1B 3OKTA 3FCSA 2I3SA 1NEXB 3EI3A 4HDJA 3MZLA 3VH0A 4GQBB 3IURA 4JHPC 4O2WA 3C99A 4WK4A 3L4OD 1QNIA 1BPOA 3U4YA 1UTCA 3V7DB 1H2YA 2AGWA 3O4JA 2B5MA 2OIZA 3MKSB 1QFSA 1PGUA 4IA9A 2OJYA 4L3HD 3SBPA 2CE8A 2YNPA 2IWFA 5HE3B 4BP9A 4J0XA 5M5TA 3I7OA 3K26A 3IJ1A 1N6FA 4JXMA 3VI4A 2OVQB 4GZ8A 3NIGA 1GOGA 3CFSB 4A0AB 2Z2NA 3ODTA 4ERZA 4FA4D 5CXBA 3GC3B 3UVKA 5FA5B 1XHMA 1XIPA 5HQGA 4O3UB 3OW8A 2I0RA 2GC7A 4H5JA 4FA5D 2P9IC 1TYQC 3ZDYA 2EBSA 2BKLA 1I2MB 3JPXA 1E8NA 3EWEA 2B5LA 3RRMC 3I8CA 3K72A 5HDBA 5M61A 2P9NC 4BCCA 4MMZA 2BCJB 4LG9A 5TEFA 4G56B 4YVDA 4JD2C 3A0FA 4DNUA 5M5SA 5EMMB 3MXXA 3K71A 4XYIA 3NVNA 1N6EA 5B4WA 4J8GA 2PM7B 4AEZA 3QHYB 2VDOA 2OK4A 3O4GA 4O45A 3OL2A 4ZOXA 4BUJC 4CC9A 2H13A 3RN0D 3FRXA 2YNNA 4G1MA 2G99A 4J79A 4NAAA 4Z7NA 3PXWD 2VDKA 3RSEC 4WK2A 4CY2A 5THAA 4BL0A 3I7HA 4FWWA 5GXHA 2IUQA 4IMMA 2Q7QA 4PBYA 3SLED 1ERJA 4GM8A 3SFZA 2QZPA 3IJEA 1UOOA 3MZKA 3OTTA 4U7AA 3J80g 3GD1I 3SCYA 5EM2A 5CXBB 1H2ZA 1VZ3A 1U4CA 3EG6A 5FKSA 4JT6C 1VE6A 1O6GA 3UVLA 5E6UA 2Z2OA 4E5ZA 1PI6A 4J84A 4RE6A 3J81g 4K3ID 1K8KC 2VDNA 4Z7QA 2YBAA 1L5GA 4A0BA 5K1CC 5IGQA 1SQJA 2AGYA 2VZ1A 5C2WB 3SVWD 4R7AB 3ULEC 3V4VA 5GSAA 3GFCA 3IUJA 4A11A 3FCUA 4CZYA 4GM3A 5EARA 3F3PA 4LGNA 3PXSD 2YB8B 4XYHA 4AN0A 4X61B 5FQDA 3BWSA 4QL1A 2JKXA 4AN1A 3UKUC 4A7JA 3FM0A 3ZE2A 4PNKB 4GQ1A 3SWSD 4FB1D 1E5TA 4FAND 5CXCB 3RFHA 4G55A 2VDLA 4KFMB 4JSXC 2H3XA 3SHFA 3V5WB 2P9PC 3AL9A 2HKRA 3IIWA 4O1QD 3B7FA 4FA1D 3OKYA 3EI2B 3ZE1A 4LG8A 2AH1A 3QI0A 1GXRA 4J82A 3P4FA 3JROA 3EI1A 3IUQA 2VDMA 4O3TB 4BCBA 5M5RA 4D9SA 4QQEA 2AQ5A 1P22A 3DSMA 4DNWA 4GGCA 1OMWB 4ESGA 5EMJB 2XL2A 3DM0A 1GP2B 2J55H 3C5MA 4A09B 4U1EI 2CO0A 2EICA 1JV2A 4FHLA 3DXMC 3EI2A 2HU7A 2H47A 1N6DA 2XYIA 3DXKC 4NENA 2VDRA 5I5IA 3F3FA 4QAMA 1PBYB 2IUPA 3MUOA 5IT9g 3SN6B 4JSPC 1UOPA 1QFMA 3IUMA 5FKQA 4PSWB 5E6RA 3C9CA 3PSLA 4Z8LA 5K19A 4L1QD 4XEIC 3BG1A 3UVNA 3KRWB 4BH6A 5SXMA 1VE7A 5EAMA 3IIYA 4GMBA 1VYHC 3RFGA 3T3PA 3CIKB 2HESX 1JTDB 2XDWA 3NIFA 4FA9D 1E8MA 4X63B 1U8CA 3IKOA 2CN2A 5M5VA 4QT8A 3FGBA 2H6NA 2XL3A 4H5IA 3AL8B 3GREA 5FFOA 2IAAA 2W18A 4GGDA 3JZGA 4CY1A 4E5ZB 4J77A 2OVPB 5TDHB 5E6SA 3SBQA 5TEEA 3OKYB 2XU7A 4UM8A 3IJ0A 3JZNA 3JB9L 5EM2B 3IVMA 4MMXA 4ZOYA 1TYEA 3OL2B 1NR0A 4PSXB 3EU7A 4X3EA 4CY3A 2P9UC 3N0EA 4N14A 4QRJA 4AX4A 3I2NA 5CXCA 3RN1D 3EQ9A 4J86A 2QXVA 4CZXA 3V4PA 3DWLC 5FKRA 3VGZA 2QC5A 5AMSA 2B4EA 3OF7A 2VDQA 4CI1A 3IULA 1B9XA 3I7LA 2P9KC 4J78A 3PVUB 2I3TA 3JAMg 2VZ3A 4A11B 4NC4A 2I0TA 3UKRC 4WJKA 3ORVD 1M1XA 1S4UX 5GMKn 4E54A 3RMZD 2VC2A 3IUNA 3K27A 3PE7A 5JWZA 4A0BB 1UOQA 5AFU3 3VA6A 3T3MA 1OLZA 4A08A 4JSVC 4ZOZA 1SHYB 2IURA 3ZE0A 2Z2PA 1Q47A 3PXTD 2HJ4A 3EQ7A 4GGAA 4IRZA 5IJ8E 2B5NA 5KDOB 4BP8A 4JT5C 3NIDA 4GM9A 2AGXA 2YMUA 2CO0C 4A0AA 5C86A 1YR2A 4CI8A 4AOWA 2XZGA 1K3IA 2UZYB 2OVRB 2O9KA
chains in the Genus database with same CATH topology
4D9SA 4DNVA 4DNUA 3KCIA 3QI0A 3MVDK 4NBMA 4NAAA 4NC4A 1A12A 4JHPC 4JHNA 4L1MA 4O2WA 4QAMA 4DNWA 3QHYB 3OF7A 1JTDB 1I2MB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4D9S A;  4DNV A;  4DNU A;  3KCI A;  3QI0 A;  3MVD K;  4NBM A;  4NAA A;  4NC4 A;  1A12 A;  4JHP C;  4JHN A;  4L1M A;  4O2W A;  4QAM A;  4DNW A;  3QHY B;  3OF7 A;  1JTD B;  1I2M B; 
#chains in the Genus database with same CATH topology
 4ES0 A;  3C75 H;  4J73 A;  5HE1 B;  1H2X A;  2HKM A;  4JHN A;  4ZN4 A;  2AGZ A;  2EIB A;  2BBK H;  4BCD A;  5IGO A;  2GNQ A;  1A0R B;  3AL8 A;  5I5J A;  3V9F A;  2PBI B;  4GQ2 P;  5H17 A;  2H6K A;  4WK0 A;  3W15 A;  2HJB A;  4AMZ A;  4MK0 B;  2H68 A;  3PVW B;  3MKQ A;  4OWR A;  5HYN B;  4G1E A;  1T2X A;  3F3G A;  3ZWL B;  2IUV A;  5AJA A;  1JMZ B;  3KRX B;  5C9Z B;  1YFQ A;  2MTA H;  5HE2 B;  1RI6 A;  5CYK A;  4A08 B;  4FAV D;  2J57 G;  4UM9 A;  1JJU B;  2J56 H;  2WQ8 A;  3HFQ A;  4O02 A;  3PSC B;  3UR4 A;  5FKT A;  3E0C A;  5M5U A;  3BG0 A;  4E54 B;  5H1M A;  5EMK B;  2PM9 A;  3I8E A;  2P9L C;  3VI3 A;  1K32 A;  2HU5 A;  2QR5 A;  3AFC A;  3SXT D;  2YNO A;  5FXY A;  2GC4 A;  1A12 A;  2CN3 A;  4EWR A;  2AGL A;  3I7P A;  4CI2 A;  4A2L A;  4Z7O A;  5C92 A;  2TRC B;  1H2W A;  4OZU A;  1VZ2 A;  5I5M A;  2HU8 A;  3MMY A;  1MDA H;  3L4M D;  3O4I A;  4J87 A;  4JSN C;  3K6S A;  2H9P A;  3EI3 B;  3RLM D;  3UVO A;  3ZDX A;  4ZOV A;  1MG2 A;  3OKW A;  4NBM A;  1TBG A;  4A09 A;  2XE4 A;  5H14 A;  3I89 A;  1C9I A;  3O4H A;  4MMY A;  2CNX A;  2H14 A;  4CZV A;  2H6Q A;  4L3G D;  1O6F A;  3UVM A;  3I7K A;  3EI4 B;  4J81 A;  4DNV A;  1B9Y A;  2OK6 A;  3MVD K;  2G9A A;  2EIE A;  2H9M A;  4K3J B;  1JMX B;  3NVX A;  3JZH A;  4A2M A;  3EMH A;  3MUN A;  4PBZ A;  5FFG A;  2H9N A;  4J8B A;  1JOF A;  3IJC A;  3JRP A;  1GG2 B;  1FWX A;  3AH8 B;  4TZ4 A;  4PC0 A;  1XKS A;  5EAL A;  2CE9 A;  4CI3 A;  4PXW A;  1GOF A;  5EML B;  3SMR A;  2AH0 A;  3SBR A;  3EI4 A;  1GOT B;  3CFV A;  5HE0 B;  4Y5R D;  5IJ7 E;  2P9S C;  5FLX g;  2IWK A;  2VDP A;  4O9D A;  4UI9 R;  3ZDZ A;  4X60 B;  4L9O A;  4AMY A;  3I7N A;  4L1M A;  3NVQ A;  1GOH A;  1PEV A;  4ERQ A;  2HYE A;  5GXI A;  3EQ8 A;  5IC7 A;  2UZX B;  4J0W A;  5CYK B;  4RE5 A;  1MG3 A;  2HXC A;  5TF2 A;  4D0K A;  4Y7R A;  3N0D A;  3SJL D;  1SQ9 A;  3KCI A;  2H9L A;  5EAP A;  5A2Q g;  1L0Q A;  1C9L A;  4CY5 A;  4ERY A;  4I79 A;  2I0S A;  5C2V B;  4NSX A;  2PM9 B;  2PM6 B;  1R5M A;  1U2V C;  4D6V A;  2EID A;  3DDU A;  3EI1 B;  3OKT A;  3FCS A;  2I3S A;  1NEX B;  3EI3 A;  4HDJ A;  3MZL A;  3VH0 A;  4GQB B;  3IUR A;  4JHP C;  4O2W A;  3C99 A;  4WK4 A;  3L4O D;  1QNI A;  1BPO A;  3U4Y A;  1UTC A;  3V7D B;  1H2Y A;  2AGW A;  3O4J A;  2B5M A;  2OIZ A;  3MKS B;  1QFS A;  1PGU A;  4IA9 A;  2OJY A;  4L3H D;  3SBP A;  2CE8 A;  2YNP A;  2IWF A;  5HE3 B;  4BP9 A;  4J0X A;  5M5T A;  3I7O A;  3K26 A;  3IJ1 A;  1N6F A;  4JXM A;  3VI4 A;  2OVQ B;  4GZ8 A;  3NIG A;  1GOG A;  3CFS B;  4A0A B;  2Z2N A;  3ODT A;  4ERZ A;  4FA4 D;  5CXB A;  3GC3 B;  3UVK A;  5FA5 B;  1XHM A;  1XIP A;  5HQG A;  4O3U B;  3OW8 A;  2I0R A;  2GC7 A;  4H5J A;  4FA5 D;  2P9I C;  1TYQ C;  3ZDY A;  2EBS A;  2BKL A;  1I2M B;  3JPX A;  1E8N A;  3EWE A;  2B5L A;  3RRM C;  3I8C A;  3K72 A;  5HDB A;  5M61 A;  2P9N C;  4BCC A;  4MMZ A;  2BCJ B;  4LG9 A;  5TEF A;  4G56 B;  4YVD A;  4JD2 C;  3A0F A;  4DNU A;  5M5S A;  5EMM B;  3MXX A;  3K71 A;  4XYI A;  3NVN A;  1N6E A;  5B4W A;  4J8G A;  2PM7 B;  4AEZ A;  3QHY B;  2VDO A;  2OK4 A;  3O4G A;  4O45 A;  3OL2 A;  4ZOX A;  4BUJ C;  4CC9 A;  2H13 A;  3RN0 D;  3FRX A;  2YNN A;  4G1M A;  2G99 A;  4J79 A;  4NAA A;  4Z7N A;  3PXW D;  2VDK A;  3RSE C;  4WK2 A;  4CY2 A;  5THA A;  4BL0 A;  3I7H A;  4FWW A;  5GXH A;  2IUQ A;  4IMM A;  2Q7Q A;  4PBY A;  3SLE D;  1ERJ A;  4GM8 A;  3SFZ A;  2QZP A;  3IJE A;  1UOO A;  3MZK A;  3OTT A;  4U7A A;  3J80 g;  3GD1 I;  3SCY A;  5EM2 A;  5CXB B;  1H2Z A;  1VZ3 A;  1U4C A;  3EG6 A;  5FKS A;  4JT6 C;  1VE6 A;  1O6G A;  3UVL A;  5E6U A;  2Z2O A;  4E5Z A;  1PI6 A;  4J84 A;  4RE6 A;  3J81 g;  4K3I D;  1K8K C;  2VDN A;  4Z7Q A;  2YBA A;  1L5G A;  4A0B A;  5K1C C;  5IGQ A;  1SQJ A;  2AGY A;  2VZ1 A;  5C2W B;  3SVW D;  4R7A B;  3ULE C;  3V4V A;  5GSA A;  3GFC A;  3IUJ A;  4A11 A;  3FCU A;  4CZY A;  4GM3 A;  5EAR A;  3F3P A;  4LGN A;  3PXS D;  2YB8 B;  4XYH A;  4AN0 A;  4X61 B;  5FQD A;  3BWS A;  4QL1 A;  2JKX A;  4AN1 A;  3UKU C;  4A7J A;  3FM0 A;  3ZE2 A;  4PNK B;  4GQ1 A;  3SWS D;  4FB1 D;  1E5T A;  4FAN D;  5CXC B;  3RFH A;  4G55 A;  2VDL A;  4KFM B;  4JSX C;  2H3X A;  3SHF A;  3V5W B;  2P9P C;  3AL9 A;  2HKR A;  3IIW A;  4O1Q D;  3B7F A;  4FA1 D;  3OKY A;  3EI2 B;  3ZE1 A;  4LG8 A;  2AH1 A;  3QI0 A;  1GXR A;  4J82 A;  3P4F A;  3JRO A;  3EI1 A;  3IUQ A;  2VDM A;  4O3T B;  4BCB A;  5M5R A;  4D9S A;  4QQE A;  2AQ5 A;  1P22 A;  3DSM A;  4DNW A;  4GGC A;  1OMW B;  4ESG A;  5EMJ B;  2XL2 A;  3DM0 A;  1GP2 B;  2J55 H;  3C5M A;  4A09 B;  4U1E I;  2CO0 A;  2EIC A;  1JV2 A;  4FHL A;  3DXM C;  3EI2 A;  2HU7 A;  2H47 A;  1N6D A;  2XYI A;  3DXK C;  4NEN A;  2VDR A;  5I5I A;  3F3F A;  4QAM A;  1PBY B;  2IUP A;  3MUO A;  5IT9 g;  3SN6 B;  4JSP C;  1UOP A;  1QFM A;  3IUM A;  5FKQ A;  4PSW B;  5E6R A;  3C9C A;  3PSL A;  4Z8L A;  5K19 A;  4L1Q D;  4XEI C;  3BG1 A;  3UVN A;  3KRW B;  4BH6 A;  5SXM A;  1VE7 A;  5EAM A;  3IIY A;  4GMB A;  1VYH C;  3RFG A;  3T3P A;  3CIK B;  2HES X;  1JTD B;  2XDW A;  3NIF A;  4FA9 D;  1E8M A;  4X63 B;  1U8C A;  3IKO A;  2CN2 A;  5M5V A;  4QT8 A;  3FGB A;  2H6N A;  2XL3 A;  4H5I A;  3AL8 B;  3GRE A;  5FFO A;  2IAA A;  2W18 A;  4GGD A;  3JZG A;  4CY1 A;  4E5Z B;  4J77 A;  2OVP B;  5TDH B;  5E6S A;  3SBQ A;  5TEE A;  3OKY B;  2XU7 A;  4UM8 A;  3IJ0 A;  3JZN A;  3JB9 L;  5EM2 B;  3IVM A;  4MMX A;  4ZOY A;  1TYE A;  3OL2 B;  1NR0 A;  4PSX B;  3EU7 A;  4X3E A;  4CY3 A;  2P9U C;  3N0E A;  4N14 A;  4QRJ A;  4AX4 A;  3I2N A;  5CXC A;  3RN1 D;  3EQ9 A;  4J86 A;  2QXV A;  4CZX A;  3V4P A;  3DWL C;  5FKR A;  3VGZ A;  2QC5 A;  5AMS A;  2B4E A;  3OF7 A;  2VDQ A;  4CI1 A;  3IUL A;  1B9X A;  3I7L A;  2P9K C;  4J78 A;  3PVU B;  2I3T A;  3JAM g;  2VZ3 A;  4A11 B;  4NC4 A;  2I0T A;  3UKR C;  4WJK A;  3ORV D;  1M1X A;  1S4U X;  5GMK n;  4E54 A;  3RMZ D;  2VC2 A;  3IUN A;  3K27 A;  3PE7 A;  5JWZ A;  4A0B B;  1UOQ A;  5AFU 3;  3VA6 A;  3T3M A;  1OLZ A;  4A08 A;  4JSV C;  4ZOZ A;  1SHY B;  2IUR A;  3ZE0 A;  2Z2P A;  1Q47 A;  3PXT D;  2HJ4 A;  3EQ7 A;  4GGA A;  4IRZ A;  5IJ8 E;  2B5N A;  5KDO B;  4BP8 A;  4JT5 C;  3NID A;  4GM9 A;  2AGX A;  2YMU A;  2CO0 C;  4A0A A;  5C86 A;  1YR2 A;  4CI8 A;  4AOW A;  2XZG A;  1K3I A;  2UZY B;  2OVR B;  2O9K A; 
#chains in the Genus database with same CATH homology
 4D9S A;  4DNV A;  4DNU A;  3KCI A;  3QI0 A;  3MVD K;  4NBM A;  4NAA A;  4NC4 A;  1A12 A;  4JHP C;  4JHN A;  4L1M A;  4O2W A;  4QAM A;  4DNW A;  3QHY B;  3OF7 A;  1JTD B;  1I2M B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...