4O2WA

Crystal structure of the third rcc1-like domain of herc1
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
365
structure length
365
Chain Sequence
KCDVYLWGAGRHGQLAEAGRNVMVPAAAPSFSQAQQVICGQNCTFVIQANGTVLACGEGSYGRLGQGNSDDLHVLTVISALQGFVVTQLVTSCGSDGHSMALTESGEVFSWGDGDYGKLGHGNSDRQRRPRQIEALQGEEVVQMSCGFKHSAVVTSDGKLFTFGNGDYGRLGLGNTSNKKLPERVTALEGYQIGQVACGLNHTLAVSADGSMVWAFGDGDYGKLGLGNSTAKSSPQKIDVLCGIGIKKVACGTQFSVALTKDGHVYTFGQDRLIGLPEGRARNHNRPQQIPVLAGVIIEDVAVGAEHTLALASNGDVYAWGSNSEGQLGLGHTNHVREPTLVTGLQGKNVRQISAGRCHSAAWTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ligase
molecule keywords E3 ubiquitin-protein ligase HERC1
publication title Crystal structure of the third RCC1-like domain of HERC1
rcsb
source organism Homo sapiens
total genus 104
structure length 365
sequence length 365
chains with identical sequence B, C, D
ec nomenclature ec 2.3.2.26: HECT-type E3 ubiquitin transferase.
pdb deposition date 2013-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00415 RCC1 Regulator of chromosome condensation (RCC1) repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.30 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Regulator of chromosome condensation 1/beta-lactamase-inhibitor protein II 4o2wA00
3QHYB 4JHNA 4NC4A 4DNUA 3OF7A 1A12A 1I2MB 4L1MA 4JHPC 4NAAA 3MVDK 4QAMA 4NBMA 4D9SA 3QI0A 4DNWA 4DNVA 4O2WA 1JTDB 3KCIA
chains in the Genus database with same CATH superfamily
1P22A 3BG1A 2XZGA 1K32A 4U7AA 4DNUA 1VZ3A 5KDOB 3N0EA 3SXTD 4AMYA 2H9PA 4RE5A 5HE0B 2H6QA 2HU5A 4Z7NA 4NENA 2XL2A 1GOHA 2AQ5A 5FLXg 1XIPA 4D6VA 3VI4A 5I5JA 4ZOZA 3V4VA 4JD2C 3GREA 2H9LA 2EIDA 3PVUB 4JHNA 4XEIC 3ZDZA 5EM2B 2VDLA 4FB1D 4OWRA 4CY2A 4U1EI 3PXSD 3RRMC 4A11A 4AN1A 3DWLC 4X60B 1I2MB 4BH6A 4BCCA 5M5RA 1JV2A 4JHPC 5CXCA 5E6UA 2Z2NA 3MXXA 3N0DA 4K3JB 3DXMC 4EWRA 3UKRC 4QQEA 4O02A 3EQ9A 5GXIA 1GP2B 1S4UX 5FKTA 1TBGA 2IWFA 4AN0A 2H3XA 1YFQA 2YBAA 3UVNA 2VZ1A 4GGAA 2H9NA 4HDJA 3W15A 3PSCB 3RSEC 5EMMB 2H13A 5EM2A 3I2NA 3JZNA 4JSNC 3UKUC 5AMSA 4J0XA 2XYIA 4ES0A 4G55A 2YMUA 1NR0A 2VDMA 3AL9A 2HJBA 4JSXC 3OKTA 2QR5A 2H6NA 4O1QD 2PBIB 4ZOXA 5H14A 4J8GA 3F3PA 4J79A 2CN3A 5IC7A 3NIGA 5EMJB 3EQ7A 3OW8A 1C9IA 2OVQB 2IUPA 1E5TA 4FAVD 1FWXA 5K1CC 3PXWD 4MK0B 4J8BA 4FA9D 2I0SA 3EI1B 2MTAH 3I89A 2B5LA 3EMHA 3PSLA 2AGZA 3MZKA 3JZHA 2I0TA 3SMRA 3I7KA 1TYQC 1YR2A 2IWKA 4MMZA 2XU7A 4WJKA 4A2MA 2HXCA 4XYHA 3RN1D 4GMBA 5GXHA 3NIDA 5THAA 4PNKB 3MMYA 1PI6A 5M5TA 2P9KC 3UVMA 2G99A 5HE1B 4X3EA 2XDWA 1UTCA 3C5MA 4QAMA 5FFGA 1K8KC 3SLED 3UR4A 3JROA 3VA6A 4GQ2P 4BP8A 4J81A 4A0AB 3T3PA 4JT6C 3OL2B 5FKSA 3I7LA 2P9UC 5C86A 2CE8A 5A2Qg 4ZOVA 3EI1A 5HE3B 4OZUA 2YNPA 4J78A 2CE9A 1UOPA 5CXCB 3SBPA 4FA1D 3IULA 4G1EA 3I7OA 2GNQA 2Z2OA 4NAAA 5EALA 1C9LA 2VDRA 4GM9A 1GXRA 1R5MA 4QRJA 3L4OD 4J0WA 3DXKC 1QFSA 3SWSD 2YNOA 4N14A 4BP9A 1Q47A 3HFQA 3NVXA 4A09B 5SXMA 1VYHC 3T3MA 4FA5D 3IURA 1VE6A 4G1MA 3RFHA 4AX4A 5AJAA 4UM9A 4PBZA 3IJEA 3OF7A 4GQBB 1L5GA 2H9MA 2H6KA 3UVOA 4A0AA 2YNNA 1H2YA 3OL2A 3GD1I 3K6SA 5HQGA 4J82A 3I7HA 4ERZA 3JRPA 2HESX 4NSXA 3ZDYA 4WK0A 2OVPB 2VDNA 4L1QD 3UVKA 1N6DA 4GGCA 3V4PA 3I7NA 4ZOYA 2I3SA 1GOFA 3SCYA 3EI4B 3MKQA 3SJLD 2OK6A 5H1MA 4L3GD 5FQDA 4L3HD 2VZ3A 3PVWB 4CY5A 2OK4A 4ESGA 3GC3B 5E6RA 2PM9B 4BCDA 2EBSA 1BPOA 4X63B 2AH0A 4FAND 4A09A 5EAMA 4JT5C 3V5WB 2BBKH 5IJ7E 3C99A 3PE7A 4D9SA 2HJ4A 3QI0A 2QXVA 5FKQA 3IUQA 1B9YA 3SBQA 4CI1A 5FXYA 4A08B 3BG0A 2VDQA 4GM3A 3ODTA 5E6SA 5H17A 2EIBA 4PSWB 3NVNA 5HDBA 2AGXA 2BKLA 3IVMA 4R7AB 4WK4A 3EI4A 5GMKn 3JZGA 5I5IA 3O4HA 4RE6A 1GOTB 4TZ4A 4O3TB 5FKRA 5TEEA 5B4WA 3SN6B 1K3IA 2PM9A 3E0CA 4JXMA 4UM8A 3MKSB 3PXTD 3AFCA 3EI3B 1N6FA 1TYEA 1UOQA 3VH0A 3ORVD 2CNXA 5EMKB 3IIYA 3B7FA 4CY3A 2VDKA 4Y7RA 4FWWA 5K19A 4PC0A 3OTTA 4ZN4A 2Z2PA 5HE2B 1MDAH 2EIEA 3C75H 3DSMA 4BUJC 3JB9L 4A0BB 1OMWB 3JPXA 4ERQA 1GOGA 2AGWA 1PGUA 2WQ8A 3CFVA 4LGNA 1OLZA 2B5NA 5M5VA 3J80g 3KCIA 4H5IA 4GGDA 4ERYA 4NC4A 1B9XA 4YVDA 2QC5A 1O6FA 4IRZA 2J55H 3EQ8A 2HU7A 3RFGA 2P9LC 3K72A 1E8MA 2W18A 1VZ2A 4H5JA 2AGLA 4GM8A 1ERJA 4X61B 5CYKB 5JWZA 4J73A 5IGQA 3I8EA 2JKXA 2H47A 3EG6A 3K26A 3IJCA 5M61A 2XL3A 4DNVA 2P9SC 3KRWB 3V7DB 1RI6A 4CZXA 5HYNB 2PM7B 3DM0A 3EI2B 2HYEA 3EWEA 3CIKB 4AEZA 3FGBA 1XHMA 2G9AA 3K71A 4PSXB 1E8NA 4FHLA 5EAPA 4A0BA 1JMXB 4MMXA 2IUVA 3VGZA 1JMZB 2EICA 1PBYB 1O6GA 2I0RA 3L4MD 3IUJA 3ULEC 3GFCA 1A12A 4IA9A 4WK2A 4GZ8A 3J81g 1U4CA 4E54B 4JSVC 5C92A 1GG2B 2CO0C 1H2XA 1SQJA 2GC4A 2OIZA 1UOOA 3V9FA 4A7JA 3DDUA 3SHFA 1VE7A 3JAMg 3FCUA 1N6EA 2XE4A 4G56B 5C9ZB 3RLMD 2HKRA 2AH1A 2IUQA 2CN2A 5CYKA 4BL0A 5GSAA 3AH8B 3OKYB 4CC9A 3MUOA 2BCJB 2J56H 2H68A 4AOWA 4CI3A 2QZPA 2IURA 3RN0D 1MG3A 3MUNA 5M5SA 4PXWA 1PEVA 4IMMA 3EI2A 1SQ9A 2CO0A 2OVRB 3NVQA 5C2VB 2HKMA 3IUMA 1NEXB 2P9NC 1XKSA 2VDPA 4DNWA 3EU7A 3ZWLB 4O2WA 3IKOA 4A2LA 2OJYA 5I5MA 1QFMA 1U2VC 4E54A 5IT9g 4O9DA 3CFSB 3VI3A 3I7PA 3ZE2A 3ZDXA 1JJUB 2AGYA 1T2XA 1A0RB 4QL1A 3FRXA 4MMYA 4J84A 5FA5B 2P9PC 3IJ0A 3SVWD 4E5ZB 4K3ID 3ZE1A 3BWSA 4D0KA 3P4FA 2TRCB 3O4JA 3U4YA 1H2WA 3IIWA 4Y5RD 4Z7OA 1JOFA 5CXBB 4NBMA 1M1XA 2UZYB 3C9CA 3OKYA 2UZXB 4LG8A 4CI2A 1L0QA 2P9IC 3F3FA 3O4GA 4GQ1A 5TF2A 4CY1A 4QT8A 1MG2A 4FA4D 2B4EA 4UI9R 3QHYB 1QNIA 2PM6B 5C2WB 4J87A 3AL8B 2YB8B 2VC2A 3FCSA 4PBYA 5EMLB 2VDOA 2J57G 4O3UB 3I8CA 3O4IA 3MZLA 4O45A 4AMZA 3OKWA 1SHYB 3RMZD 4A08A 5M5UA 4E5ZA 4CI8A 5EARA 2Q7QA 3UVLA 3SFZA 3IJ1A 3NIFA 4CZYA 3SBRA 3IUNA 3KRXB 5CXBA 2O9KA 3K27A 4JSPC 4L9OA 4J77A 3A0FA 4Z8LA 1U8CA 4I79A 5TEFA 5AFU3 5IGOA 2B5MA 4KFMB 4CZVA 1H2ZA 4L1MA 2GC7A 2H14A 5IJ8E 3MVDK 2HU8A 3ZE0A 5TDHB 2IAAA 4A11B 3FM0A 5FFOA 4XYIA 3F3GA 4BCBA 3EI3A 3AL8A 4J86A 1JTDB 2I3TA 4Z7QA 4LG9A
chains in the Genus database with same CATH topology
3QHYB 4JHNA 4NC4A 4DNUA 3OF7A 1A12A 1I2MB 4L1MA 4JHPC 4NAAA 3MVDK 4QAMA 4NBMA 4D9SA 3QI0A 4DNWA 4DNVA 4O2WA 1JTDB 3KCIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QHY B;  4JHN A;  4NC4 A;  4DNU A;  3OF7 A;  1A12 A;  1I2M B;  4L1M A;  4JHP C;  4NAA A;  3MVD K;  4QAM A;  4NBM A;  4D9S A;  3QI0 A;  4DNW A;  4DNV A;  4O2W A;  1JTD B;  3KCI A; 
#chains in the Genus database with same CATH topology
 1P22 A;  3BG1 A;  2XZG A;  1K32 A;  4U7A A;  4DNU A;  1VZ3 A;  5KDO B;  3N0E A;  3SXT D;  4AMY A;  2H9P A;  4RE5 A;  5HE0 B;  2H6Q A;  2HU5 A;  4Z7N A;  4NEN A;  2XL2 A;  1GOH A;  2AQ5 A;  5FLX g;  1XIP A;  4D6V A;  3VI4 A;  5I5J A;  4ZOZ A;  3V4V A;  4JD2 C;  3GRE A;  2H9L A;  2EID A;  3PVU B;  4JHN A;  4XEI C;  3ZDZ A;  5EM2 B;  2VDL A;  4FB1 D;  4OWR A;  4CY2 A;  4U1E I;  3PXS D;  3RRM C;  4A11 A;  4AN1 A;  3DWL C;  4X60 B;  1I2M B;  4BH6 A;  4BCC A;  5M5R A;  1JV2 A;  4JHP C;  5CXC A;  5E6U A;  2Z2N A;  3MXX A;  3N0D A;  4K3J B;  3DXM C;  4EWR A;  3UKR C;  4QQE A;  4O02 A;  3EQ9 A;  5GXI A;  1GP2 B;  1S4U X;  5FKT A;  1TBG A;  2IWF A;  4AN0 A;  2H3X A;  1YFQ A;  2YBA A;  3UVN A;  2VZ1 A;  4GGA A;  2H9N A;  4HDJ A;  3W15 A;  3PSC B;  3RSE C;  5EMM B;  2H13 A;  5EM2 A;  3I2N A;  3JZN A;  4JSN C;  3UKU C;  5AMS A;  4J0X A;  2XYI A;  4ES0 A;  4G55 A;  2YMU A;  1NR0 A;  2VDM A;  3AL9 A;  2HJB A;  4JSX C;  3OKT A;  2QR5 A;  2H6N A;  4O1Q D;  2PBI B;  4ZOX A;  5H14 A;  4J8G A;  3F3P A;  4J79 A;  2CN3 A;  5IC7 A;  3NIG A;  5EMJ B;  3EQ7 A;  3OW8 A;  1C9I A;  2OVQ B;  2IUP A;  1E5T A;  4FAV D;  1FWX A;  5K1C C;  3PXW D;  4MK0 B;  4J8B A;  4FA9 D;  2I0S A;  3EI1 B;  2MTA H;  3I89 A;  2B5L A;  3EMH A;  3PSL A;  2AGZ A;  3MZK A;  3JZH A;  2I0T A;  3SMR A;  3I7K A;  1TYQ C;  1YR2 A;  2IWK A;  4MMZ A;  2XU7 A;  4WJK A;  4A2M A;  2HXC A;  4XYH A;  3RN1 D;  4GMB A;  5GXH A;  3NID A;  5THA A;  4PNK B;  3MMY A;  1PI6 A;  5M5T A;  2P9K C;  3UVM A;  2G99 A;  5HE1 B;  4X3E A;  2XDW A;  1UTC A;  3C5M A;  4QAM A;  5FFG A;  1K8K C;  3SLE D;  3UR4 A;  3JRO A;  3VA6 A;  4GQ2 P;  4BP8 A;  4J81 A;  4A0A B;  3T3P A;  4JT6 C;  3OL2 B;  5FKS A;  3I7L A;  2P9U C;  5C86 A;  2CE8 A;  5A2Q g;  4ZOV A;  3EI1 A;  5HE3 B;  4OZU A;  2YNP A;  4J78 A;  2CE9 A;  1UOP A;  5CXC B;  3SBP A;  4FA1 D;  3IUL A;  4G1E A;  3I7O A;  2GNQ A;  2Z2O A;  4NAA A;  5EAL A;  1C9L A;  2VDR A;  4GM9 A;  1GXR A;  1R5M A;  4QRJ A;  3L4O D;  4J0W A;  3DXK C;  1QFS A;  3SWS D;  2YNO A;  4N14 A;  4BP9 A;  1Q47 A;  3HFQ A;  3NVX A;  4A09 B;  5SXM A;  1VYH C;  3T3M A;  4FA5 D;  3IUR A;  1VE6 A;  4G1M A;  3RFH A;  4AX4 A;  5AJA A;  4UM9 A;  4PBZ A;  3IJE A;  3OF7 A;  4GQB B;  1L5G A;  2H9M A;  2H6K A;  3UVO A;  4A0A A;  2YNN A;  1H2Y A;  3OL2 A;  3GD1 I;  3K6S A;  5HQG A;  4J82 A;  3I7H A;  4ERZ A;  3JRP A;  2HES X;  4NSX A;  3ZDY A;  4WK0 A;  2OVP B;  2VDN A;  4L1Q D;  3UVK A;  1N6D A;  4GGC A;  3V4P A;  3I7N A;  4ZOY A;  2I3S A;  1GOF A;  3SCY A;  3EI4 B;  3MKQ A;  3SJL D;  2OK6 A;  5H1M A;  4L3G D;  5FQD A;  4L3H D;  2VZ3 A;  3PVW B;  4CY5 A;  2OK4 A;  4ESG A;  3GC3 B;  5E6R A;  2PM9 B;  4BCD A;  2EBS A;  1BPO A;  4X63 B;  2AH0 A;  4FAN D;  4A09 A;  5EAM A;  4JT5 C;  3V5W B;  2BBK H;  5IJ7 E;  3C99 A;  3PE7 A;  4D9S A;  2HJ4 A;  3QI0 A;  2QXV A;  5FKQ A;  3IUQ A;  1B9Y A;  3SBQ A;  4CI1 A;  5FXY A;  4A08 B;  3BG0 A;  2VDQ A;  4GM3 A;  3ODT A;  5E6S A;  5H17 A;  2EIB A;  4PSW B;  3NVN A;  5HDB A;  2AGX A;  2BKL A;  3IVM A;  4R7A B;  4WK4 A;  3EI4 A;  5GMK n;  3JZG A;  5I5I A;  3O4H A;  4RE6 A;  1GOT B;  4TZ4 A;  4O3T B;  5FKR A;  5TEE A;  5B4W A;  3SN6 B;  1K3I A;  2PM9 A;  3E0C A;  4JXM A;  4UM8 A;  3MKS B;  3PXT D;  3AFC A;  3EI3 B;  1N6F A;  1TYE A;  1UOQ A;  3VH0 A;  3ORV D;  2CNX A;  5EMK B;  3IIY A;  3B7F A;  4CY3 A;  2VDK A;  4Y7R A;  4FWW A;  5K19 A;  4PC0 A;  3OTT A;  4ZN4 A;  2Z2P A;  5HE2 B;  1MDA H;  2EIE A;  3C75 H;  3DSM A;  4BUJ C;  3JB9 L;  4A0B B;  1OMW B;  3JPX A;  4ERQ A;  1GOG A;  2AGW A;  1PGU A;  2WQ8 A;  3CFV A;  4LGN A;  1OLZ A;  2B5N A;  5M5V A;  3J80 g;  3KCI A;  4H5I A;  4GGD A;  4ERY A;  4NC4 A;  1B9X A;  4YVD A;  2QC5 A;  1O6F A;  4IRZ A;  2J55 H;  3EQ8 A;  2HU7 A;  3RFG A;  2P9L C;  3K72 A;  1E8M A;  2W18 A;  1VZ2 A;  4H5J A;  2AGL A;  4GM8 A;  1ERJ A;  4X61 B;  5CYK B;  5JWZ A;  4J73 A;  5IGQ A;  3I8E A;  2JKX A;  2H47 A;  3EG6 A;  3K26 A;  3IJC A;  5M61 A;  2XL3 A;  4DNV A;  2P9S C;  3KRW B;  3V7D B;  1RI6 A;  4CZX A;  5HYN B;  2PM7 B;  3DM0 A;  3EI2 B;  2HYE A;  3EWE A;  3CIK B;  4AEZ A;  3FGB A;  1XHM A;  2G9A A;  3K71 A;  4PSX B;  1E8N A;  4FHL A;  5EAP A;  4A0B A;  1JMX B;  4MMX A;  2IUV A;  3VGZ A;  1JMZ B;  2EIC A;  1PBY B;  1O6G A;  2I0R A;  3L4M D;  3IUJ A;  3ULE C;  3GFC A;  1A12 A;  4IA9 A;  4WK2 A;  4GZ8 A;  3J81 g;  1U4C A;  4E54 B;  4JSV C;  5C92 A;  1GG2 B;  2CO0 C;  1H2X A;  1SQJ A;  2GC4 A;  2OIZ A;  1UOO A;  3V9F A;  4A7J A;  3DDU A;  3SHF A;  1VE7 A;  3JAM g;  3FCU A;  1N6E A;  2XE4 A;  4G56 B;  5C9Z B;  3RLM D;  2HKR A;  2AH1 A;  2IUQ A;  2CN2 A;  5CYK A;  4BL0 A;  5GSA A;  3AH8 B;  3OKY B;  4CC9 A;  3MUO A;  2BCJ B;  2J56 H;  2H68 A;  4AOW A;  4CI3 A;  2QZP A;  2IUR A;  3RN0 D;  1MG3 A;  3MUN A;  5M5S A;  4PXW A;  1PEV A;  4IMM A;  3EI2 A;  1SQ9 A;  2CO0 A;  2OVR B;  3NVQ A;  5C2V B;  2HKM A;  3IUM A;  1NEX B;  2P9N C;  1XKS A;  2VDP A;  4DNW A;  3EU7 A;  3ZWL B;  4O2W A;  3IKO A;  4A2L A;  2OJY A;  5I5M A;  1QFM A;  1U2V C;  4E54 A;  5IT9 g;  4O9D A;  3CFS B;  3VI3 A;  3I7P A;  3ZE2 A;  3ZDX A;  1JJU B;  2AGY A;  1T2X A;  1A0R B;  4QL1 A;  3FRX A;  4MMY A;  4J84 A;  5FA5 B;  2P9P C;  3IJ0 A;  3SVW D;  4E5Z B;  4K3I D;  3ZE1 A;  3BWS A;  4D0K A;  3P4F A;  2TRC B;  3O4J A;  3U4Y A;  1H2W A;  3IIW A;  4Y5R D;  4Z7O A;  1JOF A;  5CXB B;  4NBM A;  1M1X A;  2UZY B;  3C9C A;  3OKY A;  2UZX B;  4LG8 A;  4CI2 A;  1L0Q A;  2P9I C;  3F3F A;  3O4G A;  4GQ1 A;  5TF2 A;  4CY1 A;  4QT8 A;  1MG2 A;  4FA4 D;  2B4E A;  4UI9 R;  3QHY B;  1QNI A;  2PM6 B;  5C2W B;  4J87 A;  3AL8 B;  2YB8 B;  2VC2 A;  3FCS A;  4PBY A;  5EML B;  2VDO A;  2J57 G;  4O3U B;  3I8C A;  3O4I A;  3MZL A;  4O45 A;  4AMZ A;  3OKW A;  1SHY B;  3RMZ D;  4A08 A;  5M5U A;  4E5Z A;  4CI8 A;  5EAR A;  2Q7Q A;  3UVL A;  3SFZ A;  3IJ1 A;  3NIF A;  4CZY A;  3SBR A;  3IUN A;  3KRX B;  5CXB A;  2O9K A;  3K27 A;  4JSP C;  4L9O A;  4J77 A;  3A0F A;  4Z8L A;  1U8C A;  4I79 A;  5TEF A;  5AFU 3;  5IGO A;  2B5M A;  4KFM B;  4CZV A;  1H2Z A;  4L1M A;  2GC7 A;  2H14 A;  5IJ8 E;  3MVD K;  2HU8 A;  3ZE0 A;  5TDH B;  2IAA A;  4A11 B;  3FM0 A;  5FFO A;  4XYI A;  3F3G A;  4BCB A;  3EI3 A;  3AL8 A;  4J86 A;  1JTD B;  2I3T A;  4Z7Q A;  4LG9 A; 
#chains in the Genus database with same CATH homology
 3QHY B;  4JHN A;  4NC4 A;  4DNU A;  3OF7 A;  1A12 A;  1I2M B;  4L1M A;  4JHP C;  4NAA A;  3MVD K;  4QAM A;  4NBM A;  4D9S A;  3QI0 A;  4DNW A;  4DNV A;  4O2W A;  1JTD B;  3KCI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...