4O2WA

Crystal structure of the third rcc1-like domain of herc1
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
365
structure length
365
Chain Sequence
KCDVYLWGAGRHGQLAEAGRNVMVPAAAPSFSQAQQVICGQNCTFVIQANGTVLACGEGSYGRLGQGNSDDLHVLTVISALQGFVVTQLVTSCGSDGHSMALTESGEVFSWGDGDYGKLGHGNSDRQRRPRQIEALQGEEVVQMSCGFKHSAVVTSDGKLFTFGNGDYGRLGLGNTSNKKLPERVTALEGYQIGQVACGLNHTLAVSADGSMVWAFGDGDYGKLGLGNSTAKSSPQKIDVLCGIGIKKVACGTQFSVALTKDGHVYTFGQDRLIGLPEGRARNHNRPQQIPVLAGVIIEDVAVGAEHTLALASNGDVYAWGSNSEGQLGLGHTNHVREPTLVTGLQGKNVRQISAGRCHSAAWTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 ubiquitin-protein ligase HERC1
publication title Crystal structure of the third RCC1-like domain of HERC1
rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 104
structure length 365
sequence length 365
chains with identical sequence B, C, D
ec nomenclature ec 2.3.2.26: HECT-type E3 ubiquitin transferase.
pdb deposition date 2013-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00415 RCC1 Regulator of chromosome condensation (RCC1) repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.30 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Regulator of chromosome condensation 1/beta-lactamase-inhibitor protein II 4o2wA00
4QAMA 3QI0A 4NC4A 4O2WA 4JHPC 4DNWA 4NAAA 1JTDB 4L1MA 4D9SA 3QHYB 3KCIA 4DNVA 4NBMA 1A12A 3OF7A 4DNUA 1I2MB 4JHNA 3MVDK
chains in the Genus database with same CATH superfamily
2EIBA 3SFZA 2HKMA 3AFCA 3OKWA 2J57G 4HDJA 5CXCA 3ZDZA 5CYKB 4A08A 5M5RA 5B4WA 3I7OA 4X63B 1N6EA 4J0WA 2VDNA 1H2WA 4ZOVA 3QHYB 2HU5A 3MXXA 5GMKn 4A09B 2AQ5A 4AMZA 3NIGA 3SHFA 4CZYA 4A7JA 4BCCA 3OL2B 2I3SA 4D6VA 3L4MD 4K3JB 4J82A 2B5MA 4H5IA 5AMSA 2Z2OA 4JHNA 3FCUA 5E6SA 5AJAA 3BG1A 3EI2B 1UOQA 2XE4A 4UM8A 2G9AA 5GSAA 4IA9A 3NVQA 1JMXB 5TEFA 4I79A 4E54B 2H68A 3DDUA 5TEEA 4GM3A 1C9LA 3BWSA 4A2MA 1GOFA 3I2NA 4XYHA 4L3HD 3IURA 4J86A 3DWLC 2AGXA 4G56B 4O9DA 3T3PA 2Q7QA 1JJUB 5JWZA 3A0FA 2HU7A 3RSEC 3UKRC 5CYKA 3EMHA 4CY3A 2GNQA 4Z8LA 2W18A 4IMMA 4J0XA 4A09A 3ODTA 3FGBA 1C9IA 1SQ9A 2OVQB 1PI6A 3OL2A 1S4UX 4QT8A 4U7AA 4YVDA 5HQGA 3ZDYA 3OF7A 3CIKB 4H5JA 3C9CA 2VDKA 3EQ7A 4J79A 2JKXA 3C99A 3K6SA 3GFCA 1TBGA 4XEIC 1PGUA 1I2MB 2P9LC 3EI2A 4Z7OA 5TF2A 2CE9A 2BKLA 3PXTD 2G99A 2H6NA 3DSMA 2WQ8A 4JHPC 4ERQA 4CZVA 2OJYA 4E54A 2P9UC 2H9PA 2XL2A 3AL8B 3SN6B 4AOWA 3C75H 2PM9B 3CFVA 1TYQC 2CN2A 3ULEC 4GQ1A 1A0RB 3IUQA 4L3GD 5HE3B 4J8BA 3MZLA 3UVNA 3IUMA 5C86A 3SJLD 3RFGA 2EIDA 3U4YA 4E5ZB 5I5JA 2IWFA 3V9FA 4UI9R 3PSLA 5H1MA 2H6QA 4NSXA 3VA6A 3RLMD 2QZPA 2P9KC 1XKSA 2VC2A 4BUJC 4O3UB 1XIPA 2OK6A 4BP8A 4PNKB 4DNVA 3UVKA 3MUOA 5IC7A 1ERJA 1XHMA 5M61A 5C2VB 3IJ1A 1OMWB 5FLXg 5FKRA 1MG3A 4LG9A 2HESX 1NR0A 3K26A 4JT5C 4G55A 1H2XA 5HE2B 2Z2NA 2VDRA 3DM0A 4GGCA 4QAMA 3SWSD 3V7DB 5IT9g 5I5MA 5EAMA 3AL9A 2O9KA 5THAA 4MMYA 3AL8A 4NAAA 1GG2B 2GC4A 2PM9A 2OVPB 3KCIA 3UKUC 3JAMg 3I8EA 4UM9A 3CFSB 3RN0D 2B5LA 3O4JA 5M5VA 4JSXC 2YB8B 4BP9A 5H14A 3SMRA 4E5ZA 4WJKA 4ZOZA 3B7FA 1MDAH 3FM0A 4GM8A 5AFU3 2IAAA 4J81A 2BBKH 2OVRB 5FKSA 3MVDK 3DXMC 4AMYA 4BCBA 5HE0B 5K1CC 2VZ3A 3C5MA 4J84A 2GC7A 1GOGA 4J87A 1K8KC 4BCDA 2XDWA 1U4CA 2QC5A 3PXWD 2XL3A 3F3PA 3DXKC 3FCSA 2PM7B 5EMJB 1GP2B 3NIDA 5E6RA 4ES0A 2H9MA 2YMUA 1FWXA 1R5MA 1YR2A 3IJ0A 1N6FA 5EMLB 4QRJA 4FA9D 3SCYA 2H14A 2P9PC 4L1QD 4GZ8A 3I8CA 4JSPC 2XYIA 3SLED 4FAVD 5FKTA 3PVUB 1VE7A 3ZE2A 3OTTA 5HE1B 1L5GA 4JSNC 3OKYB 4ZOYA 1SQJA 2IWKA 1UOPA 3EI1B 2XU7A 3PXSD 2CO0A 1H2ZA 4JT6C 2VDPA 3IULA 3IJCA 3O4IA 1A12A 4O02A 2H47A 3KRWB 1GXRA 2AH1A 4GMBA 4TZ4A 2IURA 2VDOA 3N0DA 4JXMA 1N6DA 4A0BB 5M5TA 2AGZA 3UVOA 4KFMB 4AEZA 5I5IA 2I0RA 5HYNB 2YBAA 2IUQA 4LGNA 2HJBA 4A11B 5M5SA 4ZOXA 1UOOA 3JZNA 1E8NA 4Z7NA 1GOHA 1JV2A 5FXYA 2B5NA 5TDHB 2XZGA 4D9SA 3I7LA 5EM2B 5EAPA 3V5WB 4FA1D 3IIWA 5CXBB 3NIFA 2PBIB 2Z2PA 3MMYA 1VZ3A 2H3XA 3GD1I 3ORVD 4FA5D 2EIEA 1JTDB 3RRMC 3F3GA 4J8GA 5C2WB 1VE6A 3NVXA 5KDOB 4AX4A 3FRXA 4PBZA 4EWRA 3SVWD 3OKYA 3RMZD 3J80g 2VDLA 1TYEA 3EI1A 1BPOA 4CI2A 3I7KA 2VDQA 4QQEA 3MKSB 2OIZA 3V4VA 3I7HA 1E8MA 4WK4A 4A0AB 3E0CA 1K32A 1QNIA 5GXIA 4A0BA 2I3TA 3I7PA 3ZE1A 1QFMA 4O3TB 2AGWA 4JD2C 4NC4A 4A11A 3VGZA 2YNOA 3PSCB 4RE5A 5EMMB 5EM2A 3GC3B 3UR4A 5C9ZB 4O1QD 5CXBA 4CI8A 1O6FA 4JSVC 5E6UA 4K3ID 1NEXB 3IIYA 1JOFA 2AGYA 4J77A 1UTCA 3OW8A 2VZ1A 4CY1A 3O4GA 4PSXB 4WK0A 2TRCB 2AH0A 4AN1A 4CI3A 2I0SA 3EU7A 4PC0A 3QI0A 2P9IC 3K27A 3SBQA 3IKOA 4XYIA 4DNWA 3J81g 2I0TA 3IJEA 4GM9A 5EARA 2HU8A 3RFHA 3ZDXA 3MUNA 4R7AB 2HXCA 3PE7A 1Q47A 1VZ2A 4Z7QA 4BL0A 4A0AA 2J55H 3T3MA 4MK0B 4RE6A 1B9YA 3SBPA 5A2Qg 1L0QA 3UVMA 3V4PA 3VI3A 4CI1A 2AGLA 4PBYA 3EWEA 4LG8A 4Y5RD 3EI3B 4GQBB 2P9SC 4N14A 5FFOA 4X60B 1P22A 1QFSA 4J78A 1JMZB 1MG2A 4L1MA 3RN1D 4NENA 3SXTD 5FFGA 3HFQA 4GGDA 4NBMA 4J73A 4GGAA 4Y7RA 3JROA 4IRZA 1SHYB 2CNXA 4O45A 1PEVA 3ZWLB 4L9OA 4X61B 3I89A 5FKQA 2CO0C 3W15A 5GXHA 2J56H 2IUVA 3JRPA 5IJ7E 4OZUA 4CC9A 2OK4A 1U2VC 4FHLA 1B9XA 1PBYB 4WK2A 4CY5A 4G1EA 2YNPA 4CZXA 1RI6A 2CE8A 3BG0A 5FQDA 4FAND 4FWWA 2HJ4A 4AN0A 3UVLA 4FB1D 2EICA 2VDMA 3EI4B 3MKQA 4QL1A 3SBRA 4OWRA 2H13A 4G1MA 5H17A 3EI3A 3GREA 3IVMA 3EQ9A 2BCJB 1E5TA 2YNNA 2B4EA 3K71A 5CXCB 3NVNA 4BH6A 4MMXA 2UZYB 4A08B 5HDBA 4ERZA 3JZGA 3VH0A 2P9NC 3JZHA 4A2LA 3I7NA 5SXMA 4CY2A 4PSWB 2CN3A 3PVWB 1YFQA 2MTAH 3JPXA 4D0KA 5EMKB 3EQ8A 4FA4D 3P4FA 3JB9L 5EALA 5IGQA 3OKTA 5M5UA 2QR5A 5K19A 1GOTB 4ZN4A 2QXVA 3VI4A 3IUJA 3IUNA 4O2WA 2H9NA 4X3EA 3L4OD 4PXWA 1U8CA 2H9LA 3K72A 2UZXB 2HKRA 3F3FA 3KRXB 4MMZA 5FA5B 3N0EA 2IUPA 5IGOA 4ESGA 1T2XA 1VYHC 2PM6B 2HYEA 3MZKA 3ZE0A 4GQ2P 5IJ8E 2EBSA 4ERYA 3O4HA 1O6GA 1M1XA 4U1EI 3EI4A 1K3IA 4DNUA 3EG6A 1OLZA 3AH8B 2H6KA 5C92A 1H2YA
chains in the Genus database with same CATH topology
4QAMA 3QI0A 4NC4A 4O2WA 4JHPC 4DNWA 4NAAA 1JTDB 4L1MA 4D9SA 3QHYB 3KCIA 4DNVA 4NBMA 1A12A 3OF7A 4DNUA 1I2MB 4JHNA 3MVDK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QAM A;  3QI0 A;  4NC4 A;  4O2W A;  4JHP C;  4DNW A;  4NAA A;  1JTD B;  4L1M A;  4D9S A;  3QHY B;  3KCI A;  4DNV A;  4NBM A;  1A12 A;  3OF7 A;  4DNU A;  1I2M B;  4JHN A;  3MVD K; 
#chains in the Genus database with same CATH topology
 2EIB A;  3SFZ A;  2HKM A;  3AFC A;  3OKW A;  2J57 G;  4HDJ A;  5CXC A;  3ZDZ A;  5CYK B;  4A08 A;  5M5R A;  5B4W A;  3I7O A;  4X63 B;  1N6E A;  4J0W A;  2VDN A;  1H2W A;  4ZOV A;  3QHY B;  2HU5 A;  3MXX A;  5GMK n;  4A09 B;  2AQ5 A;  4AMZ A;  3NIG A;  3SHF A;  4CZY A;  4A7J A;  4BCC A;  3OL2 B;  2I3S A;  4D6V A;  3L4M D;  4K3J B;  4J82 A;  2B5M A;  4H5I A;  5AMS A;  2Z2O A;  4JHN A;  3FCU A;  5E6S A;  5AJA A;  3BG1 A;  3EI2 B;  1UOQ A;  2XE4 A;  4UM8 A;  2G9A A;  5GSA A;  4IA9 A;  3NVQ A;  1JMX B;  5TEF A;  4I79 A;  4E54 B;  2H68 A;  3DDU A;  5TEE A;  4GM3 A;  1C9L A;  3BWS A;  4A2M A;  1GOF A;  3I2N A;  4XYH A;  4L3H D;  3IUR A;  4J86 A;  3DWL C;  2AGX A;  4G56 B;  4O9D A;  3T3P A;  2Q7Q A;  1JJU B;  5JWZ A;  3A0F A;  2HU7 A;  3RSE C;  3UKR C;  5CYK A;  3EMH A;  4CY3 A;  2GNQ A;  4Z8L A;  2W18 A;  4IMM A;  4J0X A;  4A09 A;  3ODT A;  3FGB A;  1C9I A;  1SQ9 A;  2OVQ B;  1PI6 A;  3OL2 A;  1S4U X;  4QT8 A;  4U7A A;  4YVD A;  5HQG A;  3ZDY A;  3OF7 A;  3CIK B;  4H5J A;  3C9C A;  2VDK A;  3EQ7 A;  4J79 A;  2JKX A;  3C99 A;  3K6S A;  3GFC A;  1TBG A;  4XEI C;  1PGU A;  1I2M B;  2P9L C;  3EI2 A;  4Z7O A;  5TF2 A;  2CE9 A;  2BKL A;  3PXT D;  2G99 A;  2H6N A;  3DSM A;  2WQ8 A;  4JHP C;  4ERQ A;  4CZV A;  2OJY A;  4E54 A;  2P9U C;  2H9P A;  2XL2 A;  3AL8 B;  3SN6 B;  4AOW A;  3C75 H;  2PM9 B;  3CFV A;  1TYQ C;  2CN2 A;  3ULE C;  4GQ1 A;  1A0R B;  3IUQ A;  4L3G D;  5HE3 B;  4J8B A;  3MZL A;  3UVN A;  3IUM A;  5C86 A;  3SJL D;  3RFG A;  2EID A;  3U4Y A;  4E5Z B;  5I5J A;  2IWF A;  3V9F A;  4UI9 R;  3PSL A;  5H1M A;  2H6Q A;  4NSX A;  3VA6 A;  3RLM D;  2QZP A;  2P9K C;  1XKS A;  2VC2 A;  4BUJ C;  4O3U B;  1XIP A;  2OK6 A;  4BP8 A;  4PNK B;  4DNV A;  3UVK A;  3MUO A;  5IC7 A;  1ERJ A;  1XHM A;  5M61 A;  5C2V B;  3IJ1 A;  1OMW B;  5FLX g;  5FKR A;  1MG3 A;  4LG9 A;  2HES X;  1NR0 A;  3K26 A;  4JT5 C;  4G55 A;  1H2X A;  5HE2 B;  2Z2N A;  2VDR A;  3DM0 A;  4GGC A;  4QAM A;  3SWS D;  3V7D B;  5IT9 g;  5I5M A;  5EAM A;  3AL9 A;  2O9K A;  5THA A;  4MMY A;  3AL8 A;  4NAA A;  1GG2 B;  2GC4 A;  2PM9 A;  2OVP B;  3KCI A;  3UKU C;  3JAM g;  3I8E A;  4UM9 A;  3CFS B;  3RN0 D;  2B5L A;  3O4J A;  5M5V A;  4JSX C;  2YB8 B;  4BP9 A;  5H14 A;  3SMR A;  4E5Z A;  4WJK A;  4ZOZ A;  3B7F A;  1MDA H;  3FM0 A;  4GM8 A;  5AFU 3;  2IAA A;  4J81 A;  2BBK H;  2OVR B;  5FKS A;  3MVD K;  3DXM C;  4AMY A;  4BCB A;  5HE0 B;  5K1C C;  2VZ3 A;  3C5M A;  4J84 A;  2GC7 A;  1GOG A;  4J87 A;  1K8K C;  4BCD A;  2XDW A;  1U4C A;  2QC5 A;  3PXW D;  2XL3 A;  3F3P A;  3DXK C;  3FCS A;  2PM7 B;  5EMJ B;  1GP2 B;  3NID A;  5E6R A;  4ES0 A;  2H9M A;  2YMU A;  1FWX A;  1R5M A;  1YR2 A;  3IJ0 A;  1N6F A;  5EML B;  4QRJ A;  4FA9 D;  3SCY A;  2H14 A;  2P9P C;  4L1Q D;  4GZ8 A;  3I8C A;  4JSP C;  2XYI A;  3SLE D;  4FAV D;  5FKT A;  3PVU B;  1VE7 A;  3ZE2 A;  3OTT A;  5HE1 B;  1L5G A;  4JSN C;  3OKY B;  4ZOY A;  1SQJ A;  2IWK A;  1UOP A;  3EI1 B;  2XU7 A;  3PXS D;  2CO0 A;  1H2Z A;  4JT6 C;  2VDP A;  3IUL A;  3IJC A;  3O4I A;  1A12 A;  4O02 A;  2H47 A;  3KRW B;  1GXR A;  2AH1 A;  4GMB A;  4TZ4 A;  2IUR A;  2VDO A;  3N0D A;  4JXM A;  1N6D A;  4A0B B;  5M5T A;  2AGZ A;  3UVO A;  4KFM B;  4AEZ A;  5I5I A;  2I0R A;  5HYN B;  2YBA A;  2IUQ A;  4LGN A;  2HJB A;  4A11 B;  5M5S A;  4ZOX A;  1UOO A;  3JZN A;  1E8N A;  4Z7N A;  1GOH A;  1JV2 A;  5FXY A;  2B5N A;  5TDH B;  2XZG A;  4D9S A;  3I7L A;  5EM2 B;  5EAP A;  3V5W B;  4FA1 D;  3IIW A;  5CXB B;  3NIF A;  2PBI B;  2Z2P A;  3MMY A;  1VZ3 A;  2H3X A;  3GD1 I;  3ORV D;  4FA5 D;  2EIE A;  1JTD B;  3RRM C;  3F3G A;  4J8G A;  5C2W B;  1VE6 A;  3NVX A;  5KDO B;  4AX4 A;  3FRX A;  4PBZ A;  4EWR A;  3SVW D;  3OKY A;  3RMZ D;  3J80 g;  2VDL A;  1TYE A;  3EI1 A;  1BPO A;  4CI2 A;  3I7K A;  2VDQ A;  4QQE A;  3MKS B;  2OIZ A;  3V4V A;  3I7H A;  1E8M A;  4WK4 A;  4A0A B;  3E0C A;  1K32 A;  1QNI A;  5GXI A;  4A0B A;  2I3T A;  3I7P A;  3ZE1 A;  1QFM A;  4O3T B;  2AGW A;  4JD2 C;  4NC4 A;  4A11 A;  3VGZ A;  2YNO A;  3PSC B;  4RE5 A;  5EMM B;  5EM2 A;  3GC3 B;  3UR4 A;  5C9Z B;  4O1Q D;  5CXB A;  4CI8 A;  1O6F A;  4JSV C;  5E6U A;  4K3I D;  1NEX B;  3IIY A;  1JOF A;  2AGY A;  4J77 A;  1UTC A;  3OW8 A;  2VZ1 A;  4CY1 A;  3O4G A;  4PSX B;  4WK0 A;  2TRC B;  2AH0 A;  4AN1 A;  4CI3 A;  2I0S A;  3EU7 A;  4PC0 A;  3QI0 A;  2P9I C;  3K27 A;  3SBQ A;  3IKO A;  4XYI A;  4DNW A;  3J81 g;  2I0T A;  3IJE A;  4GM9 A;  5EAR A;  2HU8 A;  3RFH A;  3ZDX A;  3MUN A;  4R7A B;  2HXC A;  3PE7 A;  1Q47 A;  1VZ2 A;  4Z7Q A;  4BL0 A;  4A0A A;  2J55 H;  3T3M A;  4MK0 B;  4RE6 A;  1B9Y A;  3SBP A;  5A2Q g;  1L0Q A;  3UVM A;  3V4P A;  3VI3 A;  4CI1 A;  2AGL A;  4PBY A;  3EWE A;  4LG8 A;  4Y5R D;  3EI3 B;  4GQB B;  2P9S C;  4N14 A;  5FFO A;  4X60 B;  1P22 A;  1QFS A;  4J78 A;  1JMZ B;  1MG2 A;  4L1M A;  3RN1 D;  4NEN A;  3SXT D;  5FFG A;  3HFQ A;  4GGD A;  4NBM A;  4J73 A;  4GGA A;  4Y7R A;  3JRO A;  4IRZ A;  1SHY B;  2CNX A;  4O45 A;  1PEV A;  3ZWL B;  4L9O A;  4X61 B;  3I89 A;  5FKQ A;  2CO0 C;  3W15 A;  5GXH A;  2J56 H;  2IUV A;  3JRP A;  5IJ7 E;  4OZU A;  4CC9 A;  2OK4 A;  1U2V C;  4FHL A;  1B9X A;  1PBY B;  4WK2 A;  4CY5 A;  4G1E A;  2YNP A;  4CZX A;  1RI6 A;  2CE8 A;  3BG0 A;  5FQD A;  4FAN D;  4FWW A;  2HJ4 A;  4AN0 A;  3UVL A;  4FB1 D;  2EIC A;  2VDM A;  3EI4 B;  3MKQ A;  4QL1 A;  3SBR A;  4OWR A;  2H13 A;  4G1M A;  5H17 A;  3EI3 A;  3GRE A;  3IVM A;  3EQ9 A;  2BCJ B;  1E5T A;  2YNN A;  2B4E A;  3K71 A;  5CXC B;  3NVN A;  4BH6 A;  4MMX A;  2UZY B;  4A08 B;  5HDB A;  4ERZ A;  3JZG A;  3VH0 A;  2P9N C;  3JZH A;  4A2L A;  3I7N A;  5SXM A;  4CY2 A;  4PSW B;  2CN3 A;  3PVW B;  1YFQ A;  2MTA H;  3JPX A;  4D0K A;  5EMK B;  3EQ8 A;  4FA4 D;  3P4F A;  3JB9 L;  5EAL A;  5IGQ A;  3OKT A;  5M5U A;  2QR5 A;  5K19 A;  1GOT B;  4ZN4 A;  2QXV A;  3VI4 A;  3IUJ A;  3IUN A;  4O2W A;  2H9N A;  4X3E A;  3L4O D;  4PXW A;  1U8C A;  2H9L A;  3K72 A;  2UZX B;  2HKR A;  3F3F A;  3KRX B;  4MMZ A;  5FA5 B;  3N0E A;  2IUP A;  5IGO A;  4ESG A;  1T2X A;  1VYH C;  2PM6 B;  2HYE A;  3MZK A;  3ZE0 A;  4GQ2 P;  5IJ8 E;  2EBS A;  4ERY A;  3O4H A;  1O6G A;  1M1X A;  4U1E I;  3EI4 A;  1K3I A;  4DNU A;  3EG6 A;  1OLZ A;  3AH8 B;  2H6K A;  5C92 A;  1H2Y A; 
#chains in the Genus database with same CATH homology
 4QAM A;  3QI0 A;  4NC4 A;  4O2W A;  4JHP C;  4DNW A;  4NAA A;  1JTD B;  4L1M A;  4D9S A;  3QHY B;  3KCI A;  4DNV A;  4NBM A;  1A12 A;  3OF7 A;  4DNU A;  1I2M B;  4JHN A;  3MVD K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...