4O2WA

Crystal structure of the third rcc1-like domain of herc1
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
365
structure length
365
Chain Sequence
KCDVYLWGAGRHGQLAEAGRNVMVPAAAPSFSQAQQVICGQNCTFVIQANGTVLACGEGSYGRLGQGNSDDLHVLTVISALQGFVVTQLVTSCGSDGHSMALTESGEVFSWGDGDYGKLGHGNSDRQRRPRQIEALQGEEVVQMSCGFKHSAVVTSDGKLFTFGNGDYGRLGLGNTSNKKLPERVTALEGYQIGQVACGLNHTLAVSADGSMVWAFGDGDYGKLGLGNSTAKSSPQKIDVLCGIGIKKVACGTQFSVALTKDGHVYTFGQDRLIGLPEGRARNHNRPQQIPVLAGVIIEDVAVGAEHTLALASNGDVYAWGSNSEGQLGLGHTNHVREPTLVTGLQGKNVRQISAGRCHSAAWTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the third RCC1-like domain of HERC1
rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords E3 ubiquitin-protein ligase HERC1
total genus 104
structure length 365
sequence length 365
chains with identical sequence B, C, D
ec nomenclature ec 2.3.2.26: HECT-type E3 ubiquitin transferase.
pdb deposition date 2013-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00415 RCC1 Regulator of chromosome condensation (RCC1) repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.30 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Regulator of chromosome condensation 1/beta-lactamase-inhibitor protein II 4o2wA00
1A12A 1JTDB 4L1MA 4DNWA 3MVDK 4DNUA 4DNVA 3OF7A 3QHYB 3QI0A 4NC4A 4NBMA 4QAMA 4D9SA 4JHPC 4JHNA 3KCIA 4O2WA 4NAAA 1I2MB
chains in the Genus database with same CATH superfamily
1GG2B 1OLZA 3GD1I 3IJCA 4GGCA 1O6FA 3V7DB 1N6DA 3RFHA 4J84A 2MTAH 3O4IA 3ZE0A 2HJ4A 3EQ7A 3NVNA 4J77A 4CI2A 4D6VA 3DWLC 1MG3A 1JMXB 3DXMC 4K3JB 3I2NA 3SJLD 3MUNA 4DNVA 5THAA 1ERJA 2HU5A 4ERZA 1MDAH 4G56B 2B5LA 1GOFA 1M1XA 2EIBA 5FKRA 4X61B 3AL9A 4UM9A 1GP2B 1U4CA 3K6SA 3MXXA 4NENA 5IJ7E 4BCCA 3OL2A 3EMHA 3QHYB 3IKOA 4ZOVA 2CNXA 3ZDXA 3NIGA 4GGDA 4MMXA 1N6EA 3O4JA 1GOTB 5HE1B 3F3PA 4G55A 2TRCB 3W15A 4CC9A 3SWSD 1A0RB 3OL2B 3RMZD 3OW8A 5GSAA 3T3MA 1RI6A 2H9PA 4A7JA 2AH1A 4JT6C 4QQEA 5EALA 2H6KA 2HU7A 1E8NA 3FCUA 5IT9g 5M5TA 2H3XA 3RFGA 2B4EA 5I5MA 2VDPA 3BWSA 3OTTA 5EARA 5I5JA 4Z7NA 3FM0A 2CE8A 2GNQA 4IMMA 2I0SA 3L4OD 4CY2A 1SHYB 3ULEC 2OVQB 1QFMA 4X3EA 2P9LC 3OKYB 3JZGA 3V4PA 3K72A 3ORVD 4FA5D 3PE7A 3IUNA 4BP9A 2HESX 3AH8B 3EQ8A 5EAPA 5CXCB 3EI1B 1P22A 3V5WB 4FAND 3IURA 2YNOA 1Q47A 4NBMA 5TDHB 3UVMA 3CFVA 1JMZB 4A08B 4CY5A 2AGWA 1JTDB 5A2Qg 4MMZA 4GZ8A 5H14A 2BBKH 3IIYA 4PBZA 3JZHA 3B7FA 3O4HA 4AOWA 3DDUA 3OF7A 4Z7QA 1C9IA 5H17A 2VC2A 4JT5C 3UVNA 4LG9A 4BCDA 4AMYA 3RLMD 4JSXC 5SXMA 2IURA 4A2LA 5C2VB 3QI0A 3IUMA 5IJ8E 4XEIC 1K3IA 1N6FA 4O3TB 4O9DA 4X60B 4AX4A 4BP8A 4J0WA 5IC7A 4A0BB 3EI2A 1PEVA 4JD2C 1UOQA 5TEFA 5AMSA 3VI4A 5EMMB 2CN2A 1XHMA 2H9NA 5TF2A 4YVDA 5FKSA 5FFOA 2Q7QA 1MG2A 3FGBA 1JOFA 2W18A 2PM7B 1L5GA 4L1QD 4GM9A 3I7PA 2YNNA 3L4MD 3VA6A 3VH0A 2HKMA 5M5UA 5C86A 4QAMA 2H6QA 3OKTA 5M5RA 2JKXA 3MUOA 1PBYB 4J8BA 4DNWA 4K3ID 3EG6A 5TEEA 2P9NC 3I89A 3KCIA 4FA1D 5EM2B 5HQGA 2P9SC 3ODTA 4AMZA 4UM8A 2H68A 5M5VA 3SVWD 3SLED 2VDRA 4QT8A 3C9CA 3A0FA 3UKUC 2IUQA 3PXSD 5FKQA 5IGQA 3JZNA 4O2WA 4U1EI 3VGZA 2CO0A 5K19A 2VDQA 3I7KA 3I8CA 4FA4D 4OZUA 1B9YA 2IWFA 3N0EA 4ES0A 3OKYA 3ZE2A 1OMWB 2XU7A 3EU7A 4CZXA 2CE9A 3EI4A 1PGUA 4J86A 3RN0D 5E6SA 1QNIA 4J0XA 4J8GA 2BKLA 4J81A 3AL8B 5AJAA 2VDKA 2XL3A 3ZDYA 2P9IC 4ZOZA 2O9KA 3N0DA 4WK4A 1H2XA 3PXWD 4A09B 2CO0C 3CIKB 4L9OA 4R7AB 2QXVA 2HU8A 4FB1D 2OVRB 2P9PC 1I2MB 2I0RA 4CZYA 3MVDK 4JXMA 2VZ1A 1H2WA 4H5IA 5IGOA 1TYQC 5M5SA 5FQDA 2VZ3A 2PM6B 3DXKC 2IWKA 3V9FA 2PM9A 3IJ1A 2I0TA 4HDJA 1VYHC 2XDWA 4A2MA 2H6NA 4BL0A 2P9KC 2OJYA 3I7HA 4NAAA 3EQ9A 4PC0A 4OWRA 3IVMA 2XL2A 3I7NA 5C2WB 2VDLA 3V4VA 3F3FA 3JROA 2OK4A 4NSXA 3K27A 5CXBB 3SXTD 2G9AA 5HYNB 4A08A 4CI3A 3U4YA 1VZ3A 3IUQA 4AN0A 2H14A 3PXTD 5C92A 4MMYA 4J78A 4GQ2P 2J55H 2PBIB 2EIDA 3BG0A 3I7OA 4I79A 5HDBA 1YR2A 3PVWB 4A11A 1E8MA 1K8KC 1XKSA 5FA5B 2IUVA 3CFSB 5B4WA 4Z7OA 1JV2A 4E5ZB 1S4UX 3KRXB 2QZPA 4G1EA 3JB9L 5CXBA 4CY1A 3DM0A 3C5MA 3SCYA 3K71A 3JAMg 4JSVC 5AFU3 4UI9R 3SBRA 2H9MA 1L0QA 1C9LA 4D0KA 3OKWA 1SQJA 2IUPA 3F3GA 4QL1A 3AFCA 4CZVA 3IIWA 1GOHA 2PM9B 2B5MA 3NVQA 4D9SA 3FCSA 2AGXA 4J73A 3UR4A 5FXYA 2AGYA 4TZ4A 1NEXB 2HXCA 3PVUB 2VDOA 3K26A 2Z2PA 2EICA 4U7AA 3UVKA 2HYEA 4H5JA 4MK0B 2AGZA 5CYKB 4AEZA 1JJUB 2EIEA 2YBAA 4JSPC 4DNUA 4CI8A 3O4GA 4JHPC 4IRZA 4GM3A 3MZKA 2AH0A 2H9LA 4XYHA 2H47A 3EI3A 2I3SA 4ESGA 4Y5RD 3NIDA 2Z2NA 2OK6A 4A09A 2IAAA 4FHLA 4GM8A 3MKQA 3SFZA 3NVXA 3RSEC 4A11B 3EI2B 5HE0B 3IJ0A 1UOPA 1BPOA 1PI6A 3JRPA 2QR5A 3EI4B 3T3PA 4BCBA 2BCJB 4O3UB 5FLXg 1GXRA 1VE7A 1UOOA 3RRMC 5C9ZB 3GREA 1NR0A 5JWZA 4WK0A 1FWXA 4WK2A 2OVPB 4ERQA 5GXHA 5I5IA 4Y7RA 5EMJB 5EAMA 2QC5A 2VDMA 4A0AA 4J82A 4FAVD 2I3TA 2UZXB 2VDNA 4J87A 2P9UC 2G99A 4E54A 3BG1A 4PBYA 2H13A 3NIFA 3J80g 4J79A 4AN1A 5FKTA 1O6GA 3SMRA 3EI1A 5EM2A 5FFGA 3PSLA 1XIPA 5CXCA 3GC3B 2XYIA 5HE3B 4XYIA 1H2ZA 2EBSA 2Z2OA 4ZOXA 3DSMA 4LG8A 2GC4A 1H2YA 4A0AB 1TBGA 5K1CC 3I7LA 4O02A 4GMBA 4FA9D 2J57G 4GQBB 3IUJA 3P4FA 4EWRA 2B5NA 1VZ2A 3IULA 4JHNA 2WQ8A 4FWWA 3UKRC 4LGNA 2XE4A 1TYEA 4BH6A 2GC7A 3E0CA 4JSNC 4RE6A 4L3HD 1GOGA 1E5TA 3UVLA 4RE5A 3AL8A 1U8CA 4A0BA 3J81g 2YB8B 2J56H 3SHFA 4PXWA 5GXIA 4KFMB 3HFQA 3C75H 2HKRA 3SBQA 3FRXA 4WJKA 3MZLA 2YNPA 4L3GD 4O1QD 3RN1D 2XZGA 3SN6B 3EWEA 1A12A 4PNKB 4BUJC 4CY3A 4PSXB 4ZN4A 3EI3B 5KDOB 5EMLB 4N14A 4NC4A 2OIZA 4G1MA 5HE2B 3I8EA 3MMYA 2HJBA 4Z8LA 1B9XA 4GQ1A 4L1MA 1YFQA 4PSWB 3C99A 5CYKA 4E5ZA 2CN3A 4X63B 3SBPA 5E6RA 4CI1A 3IJEA 3JPXA 4IA9A 1K32A 5M61A 3ZWLB 5H1MA 5GMKn 4GGAA 5E6UA 3PSCB 1SQ9A 4ZOYA 1T2XA 2UZYB 3KRWB 3VI3A 1UTCA 2AGLA 5EMKB 3UVOA 1R5MA 2AQ5A 4E54B 1U2VC 4QRJA 3MKSB 4ERYA 1QFSA 2YMUA 3GFCA 4O45A 3ZE1A 1VE6A 3ZDZA
chains in the Genus database with same CATH topology
1A12A 1JTDB 4L1MA 4DNWA 3MVDK 4DNUA 4DNVA 3OF7A 3QHYB 3QI0A 4NC4A 4NBMA 4QAMA 4D9SA 4JHPC 4JHNA 3KCIA 4O2WA 4NAAA 1I2MB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A12 A;  1JTD B;  4L1M A;  4DNW A;  3MVD K;  4DNU A;  4DNV A;  3OF7 A;  3QHY B;  3QI0 A;  4NC4 A;  4NBM A;  4QAM A;  4D9S A;  4JHP C;  4JHN A;  3KCI A;  4O2W A;  4NAA A;  1I2M B; 
#chains in the Genus database with same CATH topology
 1GG2 B;  1OLZ A;  3GD1 I;  3IJC A;  4GGC A;  1O6F A;  3V7D B;  1N6D A;  3RFH A;  4J84 A;  2MTA H;  3O4I A;  3ZE0 A;  2HJ4 A;  3EQ7 A;  3NVN A;  4J77 A;  4CI2 A;  4D6V A;  3DWL C;  1MG3 A;  1JMX B;  3DXM C;  4K3J B;  3I2N A;  3SJL D;  3MUN A;  4DNV A;  5THA A;  1ERJ A;  2HU5 A;  4ERZ A;  1MDA H;  4G56 B;  2B5L A;  1GOF A;  1M1X A;  2EIB A;  5FKR A;  4X61 B;  3AL9 A;  4UM9 A;  1GP2 B;  1U4C A;  3K6S A;  3MXX A;  4NEN A;  5IJ7 E;  4BCC A;  3OL2 A;  3EMH A;  3QHY B;  3IKO A;  4ZOV A;  2CNX A;  3ZDX A;  3NIG A;  4GGD A;  4MMX A;  1N6E A;  3O4J A;  1GOT B;  5HE1 B;  3F3P A;  4G55 A;  2TRC B;  3W15 A;  4CC9 A;  3SWS D;  1A0R B;  3OL2 B;  3RMZ D;  3OW8 A;  5GSA A;  3T3M A;  1RI6 A;  2H9P A;  4A7J A;  2AH1 A;  4JT6 C;  4QQE A;  5EAL A;  2H6K A;  2HU7 A;  1E8N A;  3FCU A;  5IT9 g;  5M5T A;  2H3X A;  3RFG A;  2B4E A;  5I5M A;  2VDP A;  3BWS A;  3OTT A;  5EAR A;  5I5J A;  4Z7N A;  3FM0 A;  2CE8 A;  2GNQ A;  4IMM A;  2I0S A;  3L4O D;  4CY2 A;  1SHY B;  3ULE C;  2OVQ B;  1QFM A;  4X3E A;  2P9L C;  3OKY B;  3JZG A;  3V4P A;  3K72 A;  3ORV D;  4FA5 D;  3PE7 A;  3IUN A;  4BP9 A;  2HES X;  3AH8 B;  3EQ8 A;  5EAP A;  5CXC B;  3EI1 B;  1P22 A;  3V5W B;  4FAN D;  3IUR A;  2YNO A;  1Q47 A;  4NBM A;  5TDH B;  3UVM A;  3CFV A;  1JMZ B;  4A08 B;  4CY5 A;  2AGW A;  1JTD B;  5A2Q g;  4MMZ A;  4GZ8 A;  5H14 A;  2BBK H;  3IIY A;  4PBZ A;  3JZH A;  3B7F A;  3O4H A;  4AOW A;  3DDU A;  3OF7 A;  4Z7Q A;  1C9I A;  5H17 A;  2VC2 A;  4JT5 C;  3UVN A;  4LG9 A;  4BCD A;  4AMY A;  3RLM D;  4JSX C;  5SXM A;  2IUR A;  4A2L A;  5C2V B;  3QI0 A;  3IUM A;  5IJ8 E;  4XEI C;  1K3I A;  1N6F A;  4O3T B;  4O9D A;  4X60 B;  4AX4 A;  4BP8 A;  4J0W A;  5IC7 A;  4A0B B;  3EI2 A;  1PEV A;  4JD2 C;  1UOQ A;  5TEF A;  5AMS A;  3VI4 A;  5EMM B;  2CN2 A;  1XHM A;  2H9N A;  5TF2 A;  4YVD A;  5FKS A;  5FFO A;  2Q7Q A;  1MG2 A;  3FGB A;  1JOF A;  2W18 A;  2PM7 B;  1L5G A;  4L1Q D;  4GM9 A;  3I7P A;  2YNN A;  3L4M D;  3VA6 A;  3VH0 A;  2HKM A;  5M5U A;  5C86 A;  4QAM A;  2H6Q A;  3OKT A;  5M5R A;  2JKX A;  3MUO A;  1PBY B;  4J8B A;  4DNW A;  4K3I D;  3EG6 A;  5TEE A;  2P9N C;  3I89 A;  3KCI A;  4FA1 D;  5EM2 B;  5HQG A;  2P9S C;  3ODT A;  4AMZ A;  4UM8 A;  2H68 A;  5M5V A;  3SVW D;  3SLE D;  2VDR A;  4QT8 A;  3C9C A;  3A0F A;  3UKU C;  2IUQ A;  3PXS D;  5FKQ A;  5IGQ A;  3JZN A;  4O2W A;  4U1E I;  3VGZ A;  2CO0 A;  5K19 A;  2VDQ A;  3I7K A;  3I8C A;  4FA4 D;  4OZU A;  1B9Y A;  2IWF A;  3N0E A;  4ES0 A;  3OKY A;  3ZE2 A;  1OMW B;  2XU7 A;  3EU7 A;  4CZX A;  2CE9 A;  3EI4 A;  1PGU A;  4J86 A;  3RN0 D;  5E6S A;  1QNI A;  4J0X A;  4J8G A;  2BKL A;  4J81 A;  3AL8 B;  5AJA A;  2VDK A;  2XL3 A;  3ZDY A;  2P9I C;  4ZOZ A;  2O9K A;  3N0D A;  4WK4 A;  1H2X A;  3PXW D;  4A09 B;  2CO0 C;  3CIK B;  4L9O A;  4R7A B;  2QXV A;  2HU8 A;  4FB1 D;  2OVR B;  2P9P C;  1I2M B;  2I0R A;  4CZY A;  3MVD K;  4JXM A;  2VZ1 A;  1H2W A;  4H5I A;  5IGO A;  1TYQ C;  5M5S A;  5FQD A;  2VZ3 A;  2PM6 B;  3DXK C;  2IWK A;  3V9F A;  2PM9 A;  3IJ1 A;  2I0T A;  4HDJ A;  1VYH C;  2XDW A;  4A2M A;  2H6N A;  4BL0 A;  2P9K C;  2OJY A;  3I7H A;  4NAA A;  3EQ9 A;  4PC0 A;  4OWR A;  3IVM A;  2XL2 A;  3I7N A;  5C2W B;  2VDL A;  3V4V A;  3F3F A;  3JRO A;  2OK4 A;  4NSX A;  3K27 A;  5CXB B;  3SXT D;  2G9A A;  5HYN B;  4A08 A;  4CI3 A;  3U4Y A;  1VZ3 A;  3IUQ A;  4AN0 A;  2H14 A;  3PXT D;  5C92 A;  4MMY A;  4J78 A;  4GQ2 P;  2J55 H;  2PBI B;  2EID A;  3BG0 A;  3I7O A;  4I79 A;  5HDB A;  1YR2 A;  3PVW B;  4A11 A;  1E8M A;  1K8K C;  1XKS A;  5FA5 B;  2IUV A;  3CFS B;  5B4W A;  4Z7O A;  1JV2 A;  4E5Z B;  1S4U X;  3KRX B;  2QZP A;  4G1E A;  3JB9 L;  5CXB A;  4CY1 A;  3DM0 A;  3C5M A;  3SCY A;  3K71 A;  3JAM g;  4JSV C;  5AFU 3;  4UI9 R;  3SBR A;  2H9M A;  1L0Q A;  1C9L A;  4D0K A;  3OKW A;  1SQJ A;  2IUP A;  3F3G A;  4QL1 A;  3AFC A;  4CZV A;  3IIW A;  1GOH A;  2PM9 B;  2B5M A;  3NVQ A;  4D9S A;  3FCS A;  2AGX A;  4J73 A;  3UR4 A;  5FXY A;  2AGY A;  4TZ4 A;  1NEX B;  2HXC A;  3PVU B;  2VDO A;  3K26 A;  2Z2P A;  2EIC A;  4U7A A;  3UVK A;  2HYE A;  4H5J A;  4MK0 B;  2AGZ A;  5CYK B;  4AEZ A;  1JJU B;  2EIE A;  2YBA A;  4JSP C;  4DNU A;  4CI8 A;  3O4G A;  4JHP C;  4IRZ A;  4GM3 A;  3MZK A;  2AH0 A;  2H9L A;  4XYH A;  2H47 A;  3EI3 A;  2I3S A;  4ESG A;  4Y5R D;  3NID A;  2Z2N A;  2OK6 A;  4A09 A;  2IAA A;  4FHL A;  4GM8 A;  3MKQ A;  3SFZ A;  3NVX A;  3RSE C;  4A11 B;  3EI2 B;  5HE0 B;  3IJ0 A;  1UOP A;  1BPO A;  1PI6 A;  3JRP A;  2QR5 A;  3EI4 B;  3T3P A;  4BCB A;  2BCJ B;  4O3U B;  5FLX g;  1GXR A;  1VE7 A;  1UOO A;  3RRM C;  5C9Z B;  3GRE A;  1NR0 A;  5JWZ A;  4WK0 A;  1FWX A;  4WK2 A;  2OVP B;  4ERQ A;  5GXH A;  5I5I A;  4Y7R A;  5EMJ B;  5EAM A;  2QC5 A;  2VDM A;  4A0A A;  4J82 A;  4FAV D;  2I3T A;  2UZX B;  2VDN A;  4J87 A;  2P9U C;  2G99 A;  4E54 A;  3BG1 A;  4PBY A;  2H13 A;  3NIF A;  3J80 g;  4J79 A;  4AN1 A;  5FKT A;  1O6G A;  3SMR A;  3EI1 A;  5EM2 A;  5FFG A;  3PSL A;  1XIP A;  5CXC A;  3GC3 B;  2XYI A;  5HE3 B;  4XYI A;  1H2Z A;  2EBS A;  2Z2O A;  4ZOX A;  3DSM A;  4LG8 A;  2GC4 A;  1H2Y A;  4A0A B;  1TBG A;  5K1C C;  3I7L A;  4O02 A;  4GMB A;  4FA9 D;  2J57 G;  4GQB B;  3IUJ A;  3P4F A;  4EWR A;  2B5N A;  1VZ2 A;  3IUL A;  4JHN A;  2WQ8 A;  4FWW A;  3UKR C;  4LGN A;  2XE4 A;  1TYE A;  4BH6 A;  2GC7 A;  3E0C A;  4JSN C;  4RE6 A;  4L3H D;  1GOG A;  1E5T A;  3UVL A;  4RE5 A;  3AL8 A;  1U8C A;  4A0B A;  3J81 g;  2YB8 B;  2J56 H;  3SHF A;  4PXW A;  5GXI A;  4KFM B;  3HFQ A;  3C75 H;  2HKR A;  3SBQ A;  3FRX A;  4WJK A;  3MZL A;  2YNP A;  4L3G D;  4O1Q D;  3RN1 D;  2XZG A;  3SN6 B;  3EWE A;  1A12 A;  4PNK B;  4BUJ C;  4CY3 A;  4PSX B;  4ZN4 A;  3EI3 B;  5KDO B;  5EML B;  4N14 A;  4NC4 A;  2OIZ A;  4G1M A;  5HE2 B;  3I8E A;  3MMY A;  2HJB A;  4Z8L A;  1B9X A;  4GQ1 A;  4L1M A;  1YFQ A;  4PSW B;  3C99 A;  5CYK A;  4E5Z A;  2CN3 A;  4X63 B;  3SBP A;  5E6R A;  4CI1 A;  3IJE A;  3JPX A;  4IA9 A;  1K32 A;  5M61 A;  3ZWL B;  5H1M A;  5GMK n;  4GGA A;  5E6U A;  3PSC B;  1SQ9 A;  4ZOY A;  1T2X A;  2UZY B;  3KRW B;  3VI3 A;  1UTC A;  2AGL A;  5EMK B;  3UVO A;  1R5M A;  2AQ5 A;  4E54 B;  1U2V C;  4QRJ A;  3MKS B;  4ERY A;  1QFS A;  2YMU A;  3GFC A;  4O45 A;  3ZE1 A;  1VE6 A;  3ZDZ A; 
#chains in the Genus database with same CATH homology
 1A12 A;  1JTD B;  4L1M A;  4DNW A;  3MVD K;  4DNU A;  4DNV A;  3OF7 A;  3QHY B;  3QI0 A;  4NC4 A;  4NBM A;  4QAM A;  4D9S A;  4JHP C;  4JHN A;  3KCI A;  4O2W A;  4NAA A;  1I2M B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...