2VDNA

Re-refinement of integrin alphaiibbeta3 headpiece bound to antagonist eptifibatide
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
452
structure length
452
Chain Sequence
LNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell adhesion/immune system
molecule keywords INTEGRIN ALPHA-IIB
publication title Structural Basis for Distinctive Recognition of Fibrinogen Gammac Peptide by the Platelet Integrin Alphaiibbeta3.
pubmed doi rcsb
source organism Homo sapiens
total genus 106
structure length 452
sequence length 452
ec nomenclature
pdb deposition date 2007-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01839 FG-GAP FG-GAP repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 2vdnA00
3ZDZA 2VDPA 2VDMA 4MMYA 4WK0A 4WK4A 4MMZA 5FFOA 3ZE0A 3V4PA 5FFGA 3ZE1A 3T3MA 3ZDYA 2VDLA 3NIFA 4WJKA 2VDOA 5E6SA 3VI4A 4Z7NA 4NENA 3ZE2A 4MMXA 3FCUA 3FCSA 4G1MA 3V4VA 4UM9A 2VDQA 1JV2A 4G1EA 3IJEA 3K72A 3T3PA 3NIGA 4O02A 2VDNA 4IRZA 4WK2A 1M1XA 3NIDA 3K6SA 4Z7OA 1L5GA 2VC2A 4UM8A 3ZDXA 5HDBA 3VI3A 2VDKA 4Z7QA 1TYEA 1U8CA 5E6UA 3K71A 2VDRA 5E6RA
chains in the Genus database with same CATH superfamily
3ZDZA 1QNIA 4R7AB 4D0KA 4DNVA 3A0FA 2B5LA 4PC0A 4GM8A 3IIWA 4H5IA 1U2VC 5E6SA 3VI4A 5M5VA 2BCJB 3V9FA 1SHYB 5CXBA 1JV2A 3PSLA 3RSEC 3OKTA 3UVKA 1UOOA 3GD1I 3I7KA 2OVQB 2G99A 4Z7OA 2OIZA 5CXBB 4A0BA 3JAMg 3DXMC 5CYKA 4QQEA 1NR0A 2P9UC 1C9LA 5EMMB 4LG8A 4J86A 1PGUA 5FFGA 2QXVA 2PM9A 4A0BB 1S4UX 4GQBB 4LG9A 1GOHA 2B5NA 3FCUA 3I7OA 4MMXA 5CYKB 3SBRA 3DSMA 1JJUB 4MK0B 5JWZA 2OVRB 1PI6A 3IJEA 3OKWA 4AOWA 3IUJA 2H6KA 3F3PA 1K8KC 1GOGA 1O6GA 2CO0A 2PM9B 3NIDA 2CN3A 5HYNB 1OLZA 4XYHA 1UOPA 4H5JA 3AL8A 5GXIA 3GFCA 5I5IA 5FFOA 3JZGA 2YB8B 3F3GA 3SN6B 3DWLC 2CE8A 2W18A 5EAMA 5HQGA 5HE0B 3NIFA 4JHPC 4JSVC 1B9YA 4UI9R 2CN2A 2H68A 1YR2A 2UZYB 3SJLD 4JD2C 2J55H 1SQJA 4IRZA 1M1XA 1VYHC 4GGDA 5GXHA 1JMZB 5C2WB 2EICA 3AFCA 4ESGA 4E54A 4NAAA 4J0XA 3FGBA 3OF7A 3OTTA 3JROA 4FWWA 3K27A 4MMYA 3V7DB 2XE4A 1YFQA 4J81A 4D6VA 3MUOA 2H14A 3SBPA 2H9NA 4RE5A 3ZE2A 4A7JA 2YNPA 3I7HA 3SXTD 4J73A 4QRJA 4BP9A 3VH0A 3PVWB 1GOTB 3AL9A 3EU7A 1OMWB 5EMJB 4ZOYA 4A0AA 2AH0A 3IIYA 4FAVD 3BG1A 3RLMD 4X63B 1UTCA 4CC9A 3KRXB 5EAPA 4FHLA 1H2ZA 2P9SC 1PBYB 3UVMA 4CI3A 1I2MB 2HKRA 2IUQA 4O9DA 4A0AB 1JTDB 2YMUA 2QC5A 3ZDYA 5C86A 4GGAA 2GNQA 2QR5A 3I7PA 3VA6A 3L4OD 5EMLB 3I8EA 2YBAA 3C5MA 1XHMA 4J79A 4JT6C 3U4YA 2EIBA 5IJ8E 4U1EI 2H9MA 5CXCB 3UR4A 1MG2A 4AN0A 1GXRA 2H3XA 4QAMA 1E8NA 5M5TA 5M5RA 2HYEA 3JPXA 2I3TA 4J84A 4L9OA 4FAND 2HJBA 3EWEA 1N6FA 5FXYA 4BCDA 3VGZA 1E8MA 3CIKB 3T3MA 4CY5A 4G55A 2I3SA 4L3HD 3IURA 4ZN4A 3AH8B 4L1QD 2PM7B 2GC7A 5AMSA 4NC4A 4BUJC 4O2WA 5SXMA 4A08B 3F3FA 5TDHB 4CY1A 4ERZA 3J81g 1QFSA 3QI0A 4U7AA 3PVUB 4PNKB 2H13A 2VDKA 3I8CA 3PXWD 3VI3A 5E6UA 3UVNA 4ERQA 1TYQC 1U4CA 2UZXB 4A2MA 2EIDA 1GG2B 1H2XA 1SQ9A 2HKMA 2P9KC 3N0EA 2VZ1A 1GOFA 3K26A 1XKSA 2IUVA 2VDOA 4O3UB 2IURA 5H14A 4J77A 1C9IA 4UM9A 4Y5RD 2PBIB 4JSXC 4D9SA 4J78A 3I7LA 4PXWA 2AQ5A 3PXSD 1VZ3A 2XL2A 4XEIC 2Z2OA 4I79A 3MKSB 4CZXA 4UM8A 2EIEA 1BPOA 3O4HA 5TEFA 5GSAA 3SVWD 1R5MA 2H6QA 1PEVA 5B4WA 1K3IA 5HE3B 2P9LC 4Y7RA 5IC7A 4DNWA 3O4IA 4LGNA 4G56B 4BH6A 4CZVA 4AMYA 1A12A 2OK6A 2IAAA 3FCSA 3V4VA 5FKSA 3IVMA 4X61B 4ZOVA 2VZ3A 3SBQA 3SFZA 3BG0A 3W15A 4Z8LA 1N6DA 2OJYA 4O3TB 2I0TA 4O1QD 2I0RA 3RFHA 5FKTA 3OKYA 5E6RA 2YNOA 2VDMA 3NVQA 2H47A 3IULA 5TF2A 5HE2B 4BL0A 3EQ7A 3MMYA 3DDUA 5FKQA 3RMZD 4EWRA 5I5MA 3EI2A 3JZNA 3OKYB 2JKXA 2XDWA 5IGOA 2AGZA 3SMRA 3OL2A 2H6NA 5AFU3 1UOQA 4GMBA 4K3JB 4XYIA 4IMMA 3NIGA 4O02A 3ZWLB 4JSPC 3EI2B 3MXXA 5A2Qg 3OL2B 5TEEA 3OW8A 1ERJA 4A11A 1U8CA 3PE7A 3UVOA 4DNUA 2J56H 2AGLA 2VDPA 2IWKA 4CI8A 5EALA 1A0RB 2QZPA 5CXCA 3CFVA 1JOFA 3MVDK 3ULEC 2AGXA 4A11B 4X3EA 2HXCA 4BP8A 5GMKn 4O45A 4AN1A 3QHYB 4QL1A 4PBZA 2HJ4A 5M5SA 1QFMA 4N14A 4G1EA 2Q7QA 3RN0D 3ODTA 3CFSB 3SHFA 5M5UA 1H2WA 4KFMB 4GZ8A 2B5MA 4ES0A 4GM3A 2VC2A 1MG3A 1H2YA 4BCCA 4JHNA 4CY2A 1JMXB 4TZ4A 4FA1D 1VE6A 2XU7A 3KCIA 3MZKA 5EARA 5FQDA 1K32A 3NVXA 3UKRC 3EQ9A 2H9LA 4X60B 5C92A 5I5JA 2VDLA 4A08A 4Z7NA 4L3GD 4PBYA 2P9IC 1Q47A 2XZGA 1T2XA 2HU8A 4ERYA 2VDNA 4J8GA 2B4EA 4CY3A 4FA9D 2J57G 3ZDXA 2PM6B 3EI4A 4JSNC 5FLXg 4J8BA 4A09B 5THAA 3C99A 5HE1B 1O6FA 4JXMA 2AGYA 4ZOZA 3IUNA 2WQ8A 3EI4B 3GC3B 4GQ1A 4AMZA 3C9CA 2AH1A 4JT5C 5IGQA 2HU7A 4AX4A 2VDQA 3EI1A 4RE6A 3NVNA 1NEXB 2YNNA 4FA5D 2XL3A 3KRWB 3FM0A 5C2VB 1MDAH 4IA9A 3JZHA 5M61A 2CNXA 2H9PA 4GM9A 5EMKB 3EI1B 1E5TA 2HESX 3DM0A 3RRMC 3IKOA 3IJCA 4FA4D 4MMZA 3L4MD 4K3ID 2Z2NA 1TBGA 3J80g 1RI6A 1P22A 3RN1D 1XIPA 5IJ7E 2CE9A 3EMHA 3I89A 3ORVD 3IJ1A 2CO0C 2GC4A 3PXTD 2O9KA 3EI3A 3FRXA 2P9NC 5AJAA 1TYEA 1VZ2A 3K71A 3SCYA 5H1MA 3JB9L 3O4GA 5IT9g 3ZE0A 3N0DA 4L1MA 3ZE1A 2MTAH 1B9XA 3EI3B 3E0CA 4WJKA 4YVDA 3AL8B 4NENA 3P4FA 3V5WB 2BBKH 2OVPB 3SWSD 3SLED 2XYIA 2P9PC 3MUNA 4PSXB 2G9AA 3DXKC 2OK4A 1GP2B 2Z2PA 3K6SA 5HDBA 3MZLA 3HFQA 3UVLA 4WK0A 3EQ8A 4WK4A 2BKLA 3GREA 5FA5B 3IUQA 2EBSA 3V4PA 1VE7A 4BCBA 4J0WA 4GGCA 3JRPA 4E54B 4HDJA 3IUMA 3UKUC 4CI2A 3B7FA 4FB1D 3T3PA 4AEZA 4NSXA 4OZUA 4J82A 5C9ZB 4J87A 4NBMA 4E5ZA 5FKRA 1L5GA 5K1CC 2IWFA 3RFGA 2AGWA 4Z7QA 4QT8A 4OWRA 4ZOXA 1FWXA 4A2LA 2HU5A 4GQ2P 5EM2A 4E5ZB 3O4JA 5KDOB 3C75H 2I0SA 3I2NA 3BWSA 3I7NA 4G1MA 2TRCB 1N6EA 4CI1A 5K19A 4PSWB 3IJ0A 3K72A 3EG6A 5EM2B 2IUPA 4A09A 4WK2A 1L0QA 3MKQA 3PSCB 5H17A 4CZYA 2VDRA
chains in the Genus database with same CATH topology
3ZDZA 2VDPA 2VDMA 4MMYA 4WK0A 4WK4A 4MMZA 5FFOA 3ZE0A 3V4PA 5FFGA 3ZE1A 3T3MA 3ZDYA 2VDLA 3NIFA 4WJKA 2VDOA 5E6SA 3VI4A 4Z7NA 4NENA 3ZE2A 4MMXA 3FCUA 3FCSA 4G1MA 3V4VA 4UM9A 2VDQA 1JV2A 4G1EA 3IJEA 3K72A 3T3PA 3NIGA 4O02A 2VDNA 4IRZA 4WK2A 1M1XA 3NIDA 3K6SA 4Z7OA 1L5GA 2VC2A 4UM8A 3ZDXA 5HDBA 3VI3A 2VDKA 4Z7QA 1TYEA 1U8CA 5E6UA 3K71A 2VDRA 5E6RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZDZ A;  2VDP A;  2VDM A;  4MMY A;  4WK0 A;  4WK4 A;  4MMZ A;  5FFO A;  3ZE0 A;  3V4P A;  5FFG A;  3ZE1 A;  3T3M A;  3ZDY A;  2VDL A;  3NIF A;  4WJK A;  2VDO A;  5E6S A;  3VI4 A;  4Z7N A;  4NEN A;  3ZE2 A;  4MMX A;  3FCU A;  3FCS A;  4G1M A;  3V4V A;  4UM9 A;  2VDQ A;  1JV2 A;  4G1E A;  3IJE A;  3K72 A;  3T3P A;  3NIG A;  4O02 A;  2VDN A;  4IRZ A;  4WK2 A;  1M1X A;  3NID A;  3K6S A;  4Z7O A;  1L5G A;  2VC2 A;  4UM8 A;  3ZDX A;  5HDB A;  3VI3 A;  2VDK A;  4Z7Q A;  1TYE A;  1U8C A;  5E6U A;  3K71 A;  2VDR A;  5E6R A; 
#chains in the Genus database with same CATH topology
 3ZDZ A;  1QNI A;  4R7A B;  4D0K A;  4DNV A;  3A0F A;  2B5L A;  4PC0 A;  4GM8 A;  3IIW A;  4H5I A;  1U2V C;  5E6S A;  3VI4 A;  5M5V A;  2BCJ B;  3V9F A;  1SHY B;  5CXB A;  1JV2 A;  3PSL A;  3RSE C;  3OKT A;  3UVK A;  1UOO A;  3GD1 I;  3I7K A;  2OVQ B;  2G99 A;  4Z7O A;  2OIZ A;  5CXB B;  4A0B A;  3JAM g;  3DXM C;  5CYK A;  4QQE A;  1NR0 A;  2P9U C;  1C9L A;  5EMM B;  4LG8 A;  4J86 A;  1PGU A;  5FFG A;  2QXV A;  2PM9 A;  4A0B B;  1S4U X;  4GQB B;  4LG9 A;  1GOH A;  2B5N A;  3FCU A;  3I7O A;  4MMX A;  5CYK B;  3SBR A;  3DSM A;  1JJU B;  4MK0 B;  5JWZ A;  2OVR B;  1PI6 A;  3IJE A;  3OKW A;  4AOW A;  3IUJ A;  2H6K A;  3F3P A;  1K8K C;  1GOG A;  1O6G A;  2CO0 A;  2PM9 B;  3NID A;  2CN3 A;  5HYN B;  1OLZ A;  4XYH A;  1UOP A;  4H5J A;  3AL8 A;  5GXI A;  3GFC A;  5I5I A;  5FFO A;  3JZG A;  2YB8 B;  3F3G A;  3SN6 B;  3DWL C;  2CE8 A;  2W18 A;  5EAM A;  5HQG A;  5HE0 B;  3NIF A;  4JHP C;  4JSV C;  1B9Y A;  4UI9 R;  2CN2 A;  2H68 A;  1YR2 A;  2UZY B;  3SJL D;  4JD2 C;  2J55 H;  1SQJ A;  4IRZ A;  1M1X A;  1VYH C;  4GGD A;  5GXH A;  1JMZ B;  5C2W B;  2EIC A;  3AFC A;  4ESG A;  4E54 A;  4NAA A;  4J0X A;  3FGB A;  3OF7 A;  3OTT A;  3JRO A;  4FWW A;  3K27 A;  4MMY A;  3V7D B;  2XE4 A;  1YFQ A;  4J81 A;  4D6V A;  3MUO A;  2H14 A;  3SBP A;  2H9N A;  4RE5 A;  3ZE2 A;  4A7J A;  2YNP A;  3I7H A;  3SXT D;  4J73 A;  4QRJ A;  4BP9 A;  3VH0 A;  3PVW B;  1GOT B;  3AL9 A;  3EU7 A;  1OMW B;  5EMJ B;  4ZOY A;  4A0A A;  2AH0 A;  3IIY A;  4FAV D;  3BG1 A;  3RLM D;  4X63 B;  1UTC A;  4CC9 A;  3KRX B;  5EAP A;  4FHL A;  1H2Z A;  2P9S C;  1PBY B;  3UVM A;  4CI3 A;  1I2M B;  2HKR A;  2IUQ A;  4O9D A;  4A0A B;  1JTD B;  2YMU A;  2QC5 A;  3ZDY A;  5C86 A;  4GGA A;  2GNQ A;  2QR5 A;  3I7P A;  3VA6 A;  3L4O D;  5EML B;  3I8E A;  2YBA A;  3C5M A;  1XHM A;  4J79 A;  4JT6 C;  3U4Y A;  2EIB A;  5IJ8 E;  4U1E I;  2H9M A;  5CXC B;  3UR4 A;  1MG2 A;  4AN0 A;  1GXR A;  2H3X A;  4QAM A;  1E8N A;  5M5T A;  5M5R A;  2HYE A;  3JPX A;  2I3T A;  4J84 A;  4L9O A;  4FAN D;  2HJB A;  3EWE A;  1N6F A;  5FXY A;  4BCD A;  3VGZ A;  1E8M A;  3CIK B;  3T3M A;  4CY5 A;  4G55 A;  2I3S A;  4L3H D;  3IUR A;  4ZN4 A;  3AH8 B;  4L1Q D;  2PM7 B;  2GC7 A;  5AMS A;  4NC4 A;  4BUJ C;  4O2W A;  5SXM A;  4A08 B;  3F3F A;  5TDH B;  4CY1 A;  4ERZ A;  3J81 g;  1QFS A;  3QI0 A;  4U7A A;  3PVU B;  4PNK B;  2H13 A;  2VDK A;  3I8C A;  3PXW D;  3VI3 A;  5E6U A;  3UVN A;  4ERQ A;  1TYQ C;  1U4C A;  2UZX B;  4A2M A;  2EID A;  1GG2 B;  1H2X A;  1SQ9 A;  2HKM A;  2P9K C;  3N0E A;  2VZ1 A;  1GOF A;  3K26 A;  1XKS A;  2IUV A;  2VDO A;  4O3U B;  2IUR A;  5H14 A;  4J77 A;  1C9I A;  4UM9 A;  4Y5R D;  2PBI B;  4JSX C;  4D9S A;  4J78 A;  3I7L A;  4PXW A;  2AQ5 A;  3PXS D;  1VZ3 A;  2XL2 A;  4XEI C;  2Z2O A;  4I79 A;  3MKS B;  4CZX A;  4UM8 A;  2EIE A;  1BPO A;  3O4H A;  5TEF A;  5GSA A;  3SVW D;  1R5M A;  2H6Q A;  1PEV A;  5B4W A;  1K3I A;  5HE3 B;  2P9L C;  4Y7R A;  5IC7 A;  4DNW A;  3O4I A;  4LGN A;  4G56 B;  4BH6 A;  4CZV A;  4AMY A;  1A12 A;  2OK6 A;  2IAA A;  3FCS A;  3V4V A;  5FKS A;  3IVM A;  4X61 B;  4ZOV A;  2VZ3 A;  3SBQ A;  3SFZ A;  3BG0 A;  3W15 A;  4Z8L A;  1N6D A;  2OJY A;  4O3T B;  2I0T A;  4O1Q D;  2I0R A;  3RFH A;  5FKT A;  3OKY A;  5E6R A;  2YNO A;  2VDM A;  3NVQ A;  2H47 A;  3IUL A;  5TF2 A;  5HE2 B;  4BL0 A;  3EQ7 A;  3MMY A;  3DDU A;  5FKQ A;  3RMZ D;  4EWR A;  5I5M A;  3EI2 A;  3JZN A;  3OKY B;  2JKX A;  2XDW A;  5IGO A;  2AGZ A;  3SMR A;  3OL2 A;  2H6N A;  5AFU 3;  1UOQ A;  4GMB A;  4K3J B;  4XYI A;  4IMM A;  3NIG A;  4O02 A;  3ZWL B;  4JSP C;  3EI2 B;  3MXX A;  5A2Q g;  3OL2 B;  5TEE A;  3OW8 A;  1ERJ A;  4A11 A;  1U8C A;  3PE7 A;  3UVO A;  4DNU A;  2J56 H;  2AGL A;  2VDP A;  2IWK A;  4CI8 A;  5EAL A;  1A0R B;  2QZP A;  5CXC A;  3CFV A;  1JOF A;  3MVD K;  3ULE C;  2AGX A;  4A11 B;  4X3E A;  2HXC A;  4BP8 A;  5GMK n;  4O45 A;  4AN1 A;  3QHY B;  4QL1 A;  4PBZ A;  2HJ4 A;  5M5S A;  1QFM A;  4N14 A;  4G1E A;  2Q7Q A;  3RN0 D;  3ODT A;  3CFS B;  3SHF A;  5M5U A;  1H2W A;  4KFM B;  4GZ8 A;  2B5M A;  4ES0 A;  4GM3 A;  2VC2 A;  1MG3 A;  1H2Y A;  4BCC A;  4JHN A;  4CY2 A;  1JMX B;  4TZ4 A;  4FA1 D;  1VE6 A;  2XU7 A;  3KCI A;  3MZK A;  5EAR A;  5FQD A;  1K32 A;  3NVX A;  3UKR C;  3EQ9 A;  2H9L A;  4X60 B;  5C92 A;  5I5J A;  2VDL A;  4A08 A;  4Z7N A;  4L3G D;  4PBY A;  2P9I C;  1Q47 A;  2XZG A;  1T2X A;  2HU8 A;  4ERY A;  2VDN A;  4J8G A;  2B4E A;  4CY3 A;  4FA9 D;  2J57 G;  3ZDX A;  2PM6 B;  3EI4 A;  4JSN C;  5FLX g;  4J8B A;  4A09 B;  5THA A;  3C99 A;  5HE1 B;  1O6F A;  4JXM A;  2AGY A;  4ZOZ A;  3IUN A;  2WQ8 A;  3EI4 B;  3GC3 B;  4GQ1 A;  4AMZ A;  3C9C A;  2AH1 A;  4JT5 C;  5IGQ A;  2HU7 A;  4AX4 A;  2VDQ A;  3EI1 A;  4RE6 A;  3NVN A;  1NEX B;  2YNN A;  4FA5 D;  2XL3 A;  3KRW B;  3FM0 A;  5C2V B;  1MDA H;  4IA9 A;  3JZH A;  5M61 A;  2CNX A;  2H9P A;  4GM9 A;  5EMK B;  3EI1 B;  1E5T A;  2HES X;  3DM0 A;  3RRM C;  3IKO A;  3IJC A;  4FA4 D;  4MMZ A;  3L4M D;  4K3I D;  2Z2N A;  1TBG A;  3J80 g;  1RI6 A;  1P22 A;  3RN1 D;  1XIP A;  5IJ7 E;  2CE9 A;  3EMH A;  3I89 A;  3ORV D;  3IJ1 A;  2CO0 C;  2GC4 A;  3PXT D;  2O9K A;  3EI3 A;  3FRX A;  2P9N C;  5AJA A;  1TYE A;  1VZ2 A;  3K71 A;  3SCY A;  5H1M A;  3JB9 L;  3O4G A;  5IT9 g;  3ZE0 A;  3N0D A;  4L1M A;  3ZE1 A;  2MTA H;  1B9X A;  3EI3 B;  3E0C A;  4WJK A;  4YVD A;  3AL8 B;  4NEN A;  3P4F A;  3V5W B;  2BBK H;  2OVP B;  3SWS D;  3SLE D;  2XYI A;  2P9P C;  3MUN A;  4PSX B;  2G9A A;  3DXK C;  2OK4 A;  1GP2 B;  2Z2P A;  3K6S A;  5HDB A;  3MZL A;  3HFQ A;  3UVL A;  4WK0 A;  3EQ8 A;  4WK4 A;  2BKL A;  3GRE A;  5FA5 B;  3IUQ A;  2EBS A;  3V4P A;  1VE7 A;  4BCB A;  4J0W A;  4GGC A;  3JRP A;  4E54 B;  4HDJ A;  3IUM A;  3UKU C;  4CI2 A;  3B7F A;  4FB1 D;  3T3P A;  4AEZ A;  4NSX A;  4OZU A;  4J82 A;  5C9Z B;  4J87 A;  4NBM A;  4E5Z A;  5FKR A;  1L5G A;  5K1C C;  2IWF A;  3RFG A;  2AGW A;  4Z7Q A;  4QT8 A;  4OWR A;  4ZOX A;  1FWX A;  4A2L A;  2HU5 A;  4GQ2 P;  5EM2 A;  4E5Z B;  3O4J A;  5KDO B;  3C75 H;  2I0S A;  3I2N A;  3BWS A;  3I7N A;  4G1M A;  2TRC B;  1N6E A;  4CI1 A;  5K19 A;  4PSW B;  3IJ0 A;  3K72 A;  3EG6 A;  5EM2 B;  2IUP A;  4A09 A;  4WK2 A;  1L0Q A;  3MKQ A;  3PSC B;  5H17 A;  4CZY A;  2VDR A; 
#chains in the Genus database with same CATH homology
 3ZDZ A;  2VDP A;  2VDM A;  4MMY A;  4WK0 A;  4WK4 A;  4MMZ A;  5FFO A;  3ZE0 A;  3V4P A;  5FFG A;  3ZE1 A;  3T3M A;  3ZDY A;  2VDL A;  3NIF A;  4WJK A;  2VDO A;  5E6S A;  3VI4 A;  4Z7N A;  4NEN A;  3ZE2 A;  4MMX A;  3FCU A;  3FCS A;  4G1M A;  3V4V A;  4UM9 A;  2VDQ A;  1JV2 A;  4G1E A;  3IJE A;  3K72 A;  3T3P A;  3NIG A;  4O02 A;  2VDN A;  4IRZ A;  4WK2 A;  1M1X A;  3NID A;  3K6S A;  4Z7O A;  1L5G A;  2VC2 A;  4UM8 A;  3ZDX A;  5HDB A;  3VI3 A;  2VDK A;  4Z7Q A;  1TYE A;  1U8C A;  5E6U A;  3K71 A;  2VDR A;  5E6R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...