2VDNA

Re-refinement of integrin alphaiibbeta3 headpiece bound to antagonist eptifibatide
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
452
structure length
452
Chain Sequence
LNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis for Distinctive Recognition of Fibrinogen Gammac Peptide by the Platelet Integrin Alphaiibbeta3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system
molecule keywords INTEGRIN ALPHA-IIB
total genus 106
structure length 452
sequence length 452
ec nomenclature
pdb deposition date 2007-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01839 FG-GAP FG-GAP repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 2vdnA00
3NIGA 2VDQA 4WK2A 4UM8A 2VDLA 1JV2A 5FFGA 3T3PA 3VI4A 3ZDZA 4G1EA 1L5GA 4MMXA 3K6SA 4Z7QA 3T3MA 3ZE0A 2VDMA 1U8CA 3NIFA 3K71A 3NIDA 4G1MA 3ZDXA 2VDRA 3IJEA 1TYEA 1M1XA 4UM9A 4IRZA 3ZDYA 4WK0A 4NENA 4Z7NA 2VDKA 4MMYA 4MMZA 3ZE1A 4WJKA 5E6UA 3ZE2A 5E6RA 2VDNA 2VDPA 5E6SA 4O02A 3VI3A 3V4PA 3V4VA 4Z7OA 3FCUA 3K72A 3FCSA 2VC2A 5FFOA 4WK4A 5HDBA 2VDOA
chains in the Genus database with same CATH superfamily
2VDQA 4E5ZB 3JB9L 5FFGA 2YMUA 1TBGA 4G1EA 4MMXA 4J79A 5IGOA 4J81A 2VDMA 4DNUA 2OVPB 2IUPA 1SQJA 4FWWA 2I0SA 4J0WA 3CFSB 3IJEA 5H14A 3PXWD 2GNQA 2XDWA 4AMYA 2OIZA 5TEFA 4Z7NA 1A0RB 3IURA 3I89A 3C99A 5FLXg 5FKSA 1UTCA 3IULA 1L0QA 4PNKB 1GG2B 4MK0B 5E6SA 2PM6B 3MUNA 4CY1A 2QZPA 3I8EA 3I7LA 3PVWB 1K8KC 3IJCA 2H6NA 5EAMA 2OK4A 2IURA 4JHPC 3SHFA 3PE7A 1VZ3A 2VDLA 2VZ3A 3T3MA 5FKTA 3EQ7A 2XL3A 3K26A 3SCYA 3C9CA 4BCCA 4AX4A 1QFMA 4JSVC 2IWFA 2B5NA 5EMKB 2HU8A 3O4JA 3OW8A 1VYHC 3I8CA 5IJ8E 2AH0A 4G55A 3VH0A 3FCSA 2J57G 3EI4A 4NBMA 3UVLA 1NR0A 1MG2A 2J55H 4JT5C 5IT9g 2H3XA 3EI2B 5TDHB 4J84A 5EARA 2B5LA 4A08B 4BP9A 3J81g 4A2LA 4J82A 4XEIC 3SFZA 2J56H 1O6FA 5C9ZB 3OKYB 2HKRA 5A2Qg 2Z2PA 5H17A 4MMZA 3ZE1A 3RFGA 3EU7A 3F3PA 4BL0A 5E6UA 5SXMA 4GZ8A 1R5MA 1JMZB 1SQ9A 3JZGA 4BCDA 3CFVA 3AL8B 3MUOA 3W15A 1N6DA 1UOQA 3O4HA 3SBQA 3RMZD 3UKRC 3KCIA 3NVQA 3P4FA 5CXBB 3VI4A 3N0DA 2HU7A 4O3UB 1K32A 1U8CA 3MZKA 3PSLA 5EMJB 4L3GD 4QAMA 3UVNA 4FA1D 4NAAA 5KDOB 4CY5A 3RSEC 1N6FA 3MMYA 3IKOA 3ZWLB 4D6VA 5I5MA 2G9AA 4O45A 4A0BB 4U7AA 5IC7A 3RFHA 3QI0A 4Y5RD 4FAVD 4CZYA 2OVRB 4D0KA 5C92A 5GMKn 2EIDA 3DWLC 3V7DB 3BG1A 2OJYA 4JT6C 3I7HA 3VGZA 5M5VA 3RN0D 2O9KA 1XIPA 2P9UC 4L1QD 3OF7A 2IAAA 2G99A 3UR4A 4DNVA 3FM0A 5GXHA 2TRCB 5HE2B 4BP8A 3EI3A 1BPOA 4O02A 3V5WB 4J78A 2H6KA 4O1QD 3NVNA 4ERZA 2VDOA 3EQ8A 5EM2A 4A0AB 3OKTA 3T3PA 2MTAH 4JSXC 5M61A 4BUJC 5EMMB 1OLZA 2H9PA 3ZE0A 4GM8A 2YNPA 1B9XA 5C2VB 4LG9A 2CE8A 4H5IA 3MXXA 5TF2A 5M5SA 3HFQA 3CIKB 3BG0A 3KRWB 1PI6A 2GC4A 5FKQA 4U1EI 3N0EA 3L4OD 2BBKH 5TEEA 5FKRA 1C9LA 3O4IA 3MKQA 4ERQA 3PVUB 3VI3A 2CO0C 1ERJA 5CYKB 3SBPA 2WQ8A 3IIYA 3ZDZA 4FHLA 1NEXB 5JWZA 3IJ1A 1GOTB 2BKLA 4RE5A 4UM9A 2HESX 1QNIA 4GGDA 4CZXA 3MKSB 3C75H 3F3FA 4LG8A 2QC5A 4A09B 3JZNA 2XU7A 3ODTA 1H2XA 1UOPA 4K3ID 2CO0A 3OKWA 4L9OA 2HKMA 4WK4A 4H5JA 3GFCA 4UM8A 5CYKA 1XKSA 1GOGA 4GM3A 2YNOA 5M5TA 1I2MB 1E8NA 3K6SA 3PXTD 1T2XA 5FA5B 3OTTA 4ZOYA 3RN1D 1P22A 3K71A 3IVMA 4G1MA 4AEZA 3QHYB 1PBYB 2AH1A 3ZDXA 2VDRA 4DNWA 4A08A 2BCJB 2EBSA 3DM0A 5AJAA 4CY3A 4EWRA 2VDNA 2I3TA 1E5TA 3SBRA 3UVKA 2VDPA 4CI8A 2GC7A 2YBAA 4O2WA 1MDAH 4HDJA 1O6GA 2VC2A 3DDUA 1MG3A 3FGBA 2EICA 2Q7QA 4J73A 2CE9A 3NIGA 4FA4D 3JPXA 4NSXA 1JV2A 4JHNA 4FB1D 2I3SA 5EALA 2CN2A 3ORVD 4O3TB 3GREA 3NIDA 1JTDB 3EMHA 2QXVA 2XZGA 4A2MA 2H9NA 3BWSA 4WK0A 1H2WA 5HQGA 3SLED 2P9PC 5HE1B 1A12A 3EI1B 5AFU3 1XHMA 4J8GA 4GGAA 5K1CC 2Z2OA 3E0CA 2CN3A 1FWXA 3EI2A 4KFMB 4XYHA 3EQ9A 1B9YA 1H2YA 3U4YA 4Z8LA 4TZ4A 4BCBA 5GXIA 1GOFA 3DXMC 3I7NA 4O9DA 4IRZA 2AGYA 4ZOVA 3SMRA 4R7AB 3SWSD 2UZYB 3KRXB 2PM9B 4AN1A 1VE6A 1YFQA 4NC4A 5GSAA 3K27A 3FCUA 3EI1A 1JOFA 2P9KC 2XL2A 3IUNA 5HE3B 2B5MA 4X63B 4AMZA 5I5IA 4E54A 5CXCB 4QT8A 4GQ2P 1Q47A 4GQ1A 4A0AA 5H1MA 3RRMC 4LGNA 2HJ4A 2IWKA 2QR5A 2H6QA 5C2WB 4GQBB 3AL9A 4A11A 4D9SA 5I5JA 2H14A 4ZOZA 2EIBA 2AGZA 4GMBA 5AMSA 3UVOA 4IMMA 2PM9A 2AGLA 1QFSA 3I2NA 3I7PA 4E5ZA 2H47A 3IUMA 5EAPA 3RLMD 5FFOA 3IJ0A 2JKXA 2W18A 3C5MA 4PBYA 2H13A 4JXMA 1N6EA 3EWEA 5K19A 1VZ2A 2P9NC 4I79A 5HE0B 3SN6B 5M5RA 4BH6A 3DSMA 1TYEA 2YNNA 3L4MD 3MZLA 4MMYA 2I0RA 4WJKA 2AGWA 5E6RA 3AL8A 3PXSD 3PSCB 1TYQC 5HYNB 3I7KA 4CI3A 2OK6A 3V4PA 5EMLB 5IGQA 1JMXB 4OWRA 4PBZA 3SXTD 4WK2A 1GP2B 4AOWA 5FQDA 3IUJA 2UZXB 1VE7A 4N14A 4X61B 2H9LA 4GGCA 2AQ5A 4PXWA 4CZVA 3O4GA 4FA5D 4NENA 2B4EA 2IUVA 3JAMg 1PGUA 3A0FA 2HJBA 2AGXA 4JSPC 2YB8B 2XYIA 4L3HD 2HU5A 2P9IC 2VZ1A 3JRPA 3MVDK 3EI4B 2OVQB 3NIFA 1OMWB 1UOOA 4K3JB 3UKUC 3SJLD 4X60B 4ES0A 5THAA 4A7JA 3B7FA 3FRXA 4J8BA 3ZE2A 3OKYA 1SHYB 1U2VC 3V4VA 5EM2B 3F3GA 3SVWD 3J80g 2Z2NA 4PSXB 5CXBA 4J86A 2CNXA 4J77A 5FXYA 2PBIB 4IA9A 4JSNC 3JZHA 3AFCA 3I7OA 4GM9A 4CI2A 4OZUA 3VA6A 4CC9A 4Z7QA 2H9MA 4ESGA 3OL2B 4FAND 1GOHA 5IJ7E 4QQEA 5M5UA 4FA9D 2P9SC 4ERYA 2HYEA 2EIEA 1C9IA 4Y7RA 1JJUB 4ZN4A 1YR2A 4ZOXA 2HXCA 4X3EA 5B4WA 3DXKC 4A0BA 1H2ZA 3IUQA 4PC0A 1E8MA 3EG6A 4G56B 4RE6A 4E54B 2PM7B 1K3IA 4Z7OA 4J87A 4AN0A 3IIWA 4QRJA 1L5GA 4J0XA 4L1MA 2H68A 2I0TA 1S4UX 2XE4A 1GXRA 5C86A 3AH8B 3NVXA 4QL1A 5CXCA 3UVMA 4A11B 3V9FA 1U4CA 2IUQA 4A09A 3OL2A 1M1XA 4UI9R 3ZDYA 4CY2A 4PSWB 2VDKA 3JROA 4JD2C 4YVDA 4XYIA 3GC3B 3GD1I 2P9LC 1PEVA 4CI1A 3ULEC 1RI6A 3K72A 3EI3B 5HDBA
chains in the Genus database with same CATH topology
3NIGA 2VDQA 4WK2A 4UM8A 2VDLA 1JV2A 5FFGA 3T3PA 3VI4A 3ZDZA 4G1EA 1L5GA 4MMXA 3K6SA 4Z7QA 3T3MA 3ZE0A 2VDMA 1U8CA 3NIFA 3K71A 3NIDA 4G1MA 3ZDXA 2VDRA 3IJEA 1TYEA 1M1XA 4UM9A 4IRZA 3ZDYA 4WK0A 4NENA 4Z7NA 2VDKA 4MMYA 4MMZA 3ZE1A 4WJKA 5E6UA 3ZE2A 5E6RA 2VDNA 2VDPA 5E6SA 4O02A 3VI3A 3V4PA 3V4VA 4Z7OA 3FCUA 3K72A 3FCSA 2VC2A 5FFOA 4WK4A 5HDBA 2VDOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NIG A;  2VDQ A;  4WK2 A;  4UM8 A;  2VDL A;  1JV2 A;  5FFG A;  3T3P A;  3VI4 A;  3ZDZ A;  4G1E A;  1L5G A;  4MMX A;  3K6S A;  4Z7Q A;  3T3M A;  3ZE0 A;  2VDM A;  1U8C A;  3NIF A;  3K71 A;  3NID A;  4G1M A;  3ZDX A;  2VDR A;  3IJE A;  1TYE A;  1M1X A;  4UM9 A;  4IRZ A;  3ZDY A;  4WK0 A;  4NEN A;  4Z7N A;  2VDK A;  4MMY A;  4MMZ A;  3ZE1 A;  4WJK A;  5E6U A;  3ZE2 A;  5E6R A;  2VDN A;  2VDP A;  5E6S A;  4O02 A;  3VI3 A;  3V4P A;  3V4V A;  4Z7O A;  3FCU A;  3K72 A;  3FCS A;  2VC2 A;  5FFO A;  4WK4 A;  5HDB A;  2VDO A; 
#chains in the Genus database with same CATH topology
 2VDQ A;  4E5Z B;  3JB9 L;  5FFG A;  2YMU A;  1TBG A;  4G1E A;  4MMX A;  4J79 A;  5IGO A;  4J81 A;  2VDM A;  4DNU A;  2OVP B;  2IUP A;  1SQJ A;  4FWW A;  2I0S A;  4J0W A;  3CFS B;  3IJE A;  5H14 A;  3PXW D;  2GNQ A;  2XDW A;  4AMY A;  2OIZ A;  5TEF A;  4Z7N A;  1A0R B;  3IUR A;  3I89 A;  3C99 A;  5FLX g;  5FKS A;  1UTC A;  3IUL A;  1L0Q A;  4PNK B;  1GG2 B;  4MK0 B;  5E6S A;  2PM6 B;  3MUN A;  4CY1 A;  2QZP A;  3I8E A;  3I7L A;  3PVW B;  1K8K C;  3IJC A;  2H6N A;  5EAM A;  2OK4 A;  2IUR A;  4JHP C;  3SHF A;  3PE7 A;  1VZ3 A;  2VDL A;  2VZ3 A;  3T3M A;  5FKT A;  3EQ7 A;  2XL3 A;  3K26 A;  3SCY A;  3C9C A;  4BCC A;  4AX4 A;  1QFM A;  4JSV C;  2IWF A;  2B5N A;  5EMK B;  2HU8 A;  3O4J A;  3OW8 A;  1VYH C;  3I8C A;  5IJ8 E;  2AH0 A;  4G55 A;  3VH0 A;  3FCS A;  2J57 G;  3EI4 A;  4NBM A;  3UVL A;  1NR0 A;  1MG2 A;  2J55 H;  4JT5 C;  5IT9 g;  2H3X A;  3EI2 B;  5TDH B;  4J84 A;  5EAR A;  2B5L A;  4A08 B;  4BP9 A;  3J81 g;  4A2L A;  4J82 A;  4XEI C;  3SFZ A;  2J56 H;  1O6F A;  5C9Z B;  3OKY B;  2HKR A;  5A2Q g;  2Z2P A;  5H17 A;  4MMZ A;  3ZE1 A;  3RFG A;  3EU7 A;  3F3P A;  4BL0 A;  5E6U A;  5SXM A;  4GZ8 A;  1R5M A;  1JMZ B;  1SQ9 A;  3JZG A;  4BCD A;  3CFV A;  3AL8 B;  3MUO A;  3W15 A;  1N6D A;  1UOQ A;  3O4H A;  3SBQ A;  3RMZ D;  3UKR C;  3KCI A;  3NVQ A;  3P4F A;  5CXB B;  3VI4 A;  3N0D A;  2HU7 A;  4O3U B;  1K32 A;  1U8C A;  3MZK A;  3PSL A;  5EMJ B;  4L3G D;  4QAM A;  3UVN A;  4FA1 D;  4NAA A;  5KDO B;  4CY5 A;  3RSE C;  1N6F A;  3MMY A;  3IKO A;  3ZWL B;  4D6V A;  5I5M A;  2G9A A;  4O45 A;  4A0B B;  4U7A A;  5IC7 A;  3RFH A;  3QI0 A;  4Y5R D;  4FAV D;  4CZY A;  2OVR B;  4D0K A;  5C92 A;  5GMK n;  2EID A;  3DWL C;  3V7D B;  3BG1 A;  2OJY A;  4JT6 C;  3I7H A;  3VGZ A;  5M5V A;  3RN0 D;  2O9K A;  1XIP A;  2P9U C;  4L1Q D;  3OF7 A;  2IAA A;  2G99 A;  3UR4 A;  4DNV A;  3FM0 A;  5GXH A;  2TRC B;  5HE2 B;  4BP8 A;  3EI3 A;  1BPO A;  4O02 A;  3V5W B;  4J78 A;  2H6K A;  4O1Q D;  3NVN A;  4ERZ A;  2VDO A;  3EQ8 A;  5EM2 A;  4A0A B;  3OKT A;  3T3P A;  2MTA H;  4JSX C;  5M61 A;  4BUJ C;  5EMM B;  1OLZ A;  2H9P A;  3ZE0 A;  4GM8 A;  2YNP A;  1B9X A;  5C2V B;  4LG9 A;  2CE8 A;  4H5I A;  3MXX A;  5TF2 A;  5M5S A;  3HFQ A;  3CIK B;  3BG0 A;  3KRW B;  1PI6 A;  2GC4 A;  5FKQ A;  4U1E I;  3N0E A;  3L4O D;  2BBK H;  5TEE A;  5FKR A;  1C9L A;  3O4I A;  3MKQ A;  4ERQ A;  3PVU B;  3VI3 A;  2CO0 C;  1ERJ A;  5CYK B;  3SBP A;  2WQ8 A;  3IIY A;  3ZDZ A;  4FHL A;  1NEX B;  5JWZ A;  3IJ1 A;  1GOT B;  2BKL A;  4RE5 A;  4UM9 A;  2HES X;  1QNI A;  4GGD A;  4CZX A;  3MKS B;  3C75 H;  3F3F A;  4LG8 A;  2QC5 A;  4A09 B;  3JZN A;  2XU7 A;  3ODT A;  1H2X A;  1UOP A;  4K3I D;  2CO0 A;  3OKW A;  4L9O A;  2HKM A;  4WK4 A;  4H5J A;  3GFC A;  4UM8 A;  5CYK A;  1XKS A;  1GOG A;  4GM3 A;  2YNO A;  5M5T A;  1I2M B;  1E8N A;  3K6S A;  3PXT D;  1T2X A;  5FA5 B;  3OTT A;  4ZOY A;  3RN1 D;  1P22 A;  3K71 A;  3IVM A;  4G1M A;  4AEZ A;  3QHY B;  1PBY B;  2AH1 A;  3ZDX A;  2VDR A;  4DNW A;  4A08 A;  2BCJ B;  2EBS A;  3DM0 A;  5AJA A;  4CY3 A;  4EWR A;  2VDN A;  2I3T A;  1E5T A;  3SBR A;  3UVK A;  2VDP A;  4CI8 A;  2GC7 A;  2YBA A;  4O2W A;  1MDA H;  4HDJ A;  1O6G A;  2VC2 A;  3DDU A;  1MG3 A;  3FGB A;  2EIC A;  2Q7Q A;  4J73 A;  2CE9 A;  3NIG A;  4FA4 D;  3JPX A;  4NSX A;  1JV2 A;  4JHN A;  4FB1 D;  2I3S A;  5EAL A;  2CN2 A;  3ORV D;  4O3T B;  3GRE A;  3NID A;  1JTD B;  3EMH A;  2QXV A;  2XZG A;  4A2M A;  2H9N A;  3BWS A;  4WK0 A;  1H2W A;  5HQG A;  3SLE D;  2P9P C;  5HE1 B;  1A12 A;  3EI1 B;  5AFU 3;  1XHM A;  4J8G A;  4GGA A;  5K1C C;  2Z2O A;  3E0C A;  2CN3 A;  1FWX A;  3EI2 A;  4KFM B;  4XYH A;  3EQ9 A;  1B9Y A;  1H2Y A;  3U4Y A;  4Z8L A;  4TZ4 A;  4BCB A;  5GXI A;  1GOF A;  3DXM C;  3I7N A;  4O9D A;  4IRZ A;  2AGY A;  4ZOV A;  3SMR A;  4R7A B;  3SWS D;  2UZY B;  3KRX B;  2PM9 B;  4AN1 A;  1VE6 A;  1YFQ A;  4NC4 A;  5GSA A;  3K27 A;  3FCU A;  3EI1 A;  1JOF A;  2P9K C;  2XL2 A;  3IUN A;  5HE3 B;  2B5M A;  4X63 B;  4AMZ A;  5I5I A;  4E54 A;  5CXC B;  4QT8 A;  4GQ2 P;  1Q47 A;  4GQ1 A;  4A0A A;  5H1M A;  3RRM C;  4LGN A;  2HJ4 A;  2IWK A;  2QR5 A;  2H6Q A;  5C2W B;  4GQB B;  3AL9 A;  4A11 A;  4D9S A;  5I5J A;  2H14 A;  4ZOZ A;  2EIB A;  2AGZ A;  4GMB A;  5AMS A;  3UVO A;  4IMM A;  2PM9 A;  2AGL A;  1QFS A;  3I2N A;  3I7P A;  4E5Z A;  2H47 A;  3IUM A;  5EAP A;  3RLM D;  5FFO A;  3IJ0 A;  2JKX A;  2W18 A;  3C5M A;  4PBY A;  2H13 A;  4JXM A;  1N6E A;  3EWE A;  5K19 A;  1VZ2 A;  2P9N C;  4I79 A;  5HE0 B;  3SN6 B;  5M5R A;  4BH6 A;  3DSM A;  1TYE A;  2YNN A;  3L4M D;  3MZL A;  4MMY A;  2I0R A;  4WJK A;  2AGW A;  5E6R A;  3AL8 A;  3PXS D;  3PSC B;  1TYQ C;  5HYN B;  3I7K A;  4CI3 A;  2OK6 A;  3V4P A;  5EML B;  5IGQ A;  1JMX B;  4OWR A;  4PBZ A;  3SXT D;  4WK2 A;  1GP2 B;  4AOW A;  5FQD A;  3IUJ A;  2UZX B;  1VE7 A;  4N14 A;  4X61 B;  2H9L A;  4GGC A;  2AQ5 A;  4PXW A;  4CZV A;  3O4G A;  4FA5 D;  4NEN A;  2B4E A;  2IUV A;  3JAM g;  1PGU A;  3A0F A;  2HJB A;  2AGX A;  4JSP C;  2YB8 B;  2XYI A;  4L3H D;  2HU5 A;  2P9I C;  2VZ1 A;  3JRP A;  3MVD K;  3EI4 B;  2OVQ B;  3NIF A;  1OMW B;  1UOO A;  4K3J B;  3UKU C;  3SJL D;  4X60 B;  4ES0 A;  5THA A;  4A7J A;  3B7F A;  3FRX A;  4J8B A;  3ZE2 A;  3OKY A;  1SHY B;  1U2V C;  3V4V A;  5EM2 B;  3F3G A;  3SVW D;  3J80 g;  2Z2N A;  4PSX B;  5CXB A;  4J86 A;  2CNX A;  4J77 A;  5FXY A;  2PBI B;  4IA9 A;  4JSN C;  3JZH A;  3AFC A;  3I7O A;  4GM9 A;  4CI2 A;  4OZU A;  3VA6 A;  4CC9 A;  4Z7Q A;  2H9M A;  4ESG A;  3OL2 B;  4FAN D;  1GOH A;  5IJ7 E;  4QQE A;  5M5U A;  4FA9 D;  2P9S C;  4ERY A;  2HYE A;  2EIE A;  1C9I A;  4Y7R A;  1JJU B;  4ZN4 A;  1YR2 A;  4ZOX A;  2HXC A;  4X3E A;  5B4W A;  3DXK C;  4A0B A;  1H2Z A;  3IUQ A;  4PC0 A;  1E8M A;  3EG6 A;  4G56 B;  4RE6 A;  4E54 B;  2PM7 B;  1K3I A;  4Z7O A;  4J87 A;  4AN0 A;  3IIW A;  4QRJ A;  1L5G A;  4J0X A;  4L1M A;  2H68 A;  2I0T A;  1S4U X;  2XE4 A;  1GXR A;  5C86 A;  3AH8 B;  3NVX A;  4QL1 A;  5CXC A;  3UVM A;  4A11 B;  3V9F A;  1U4C A;  2IUQ A;  4A09 A;  3OL2 A;  1M1X A;  4UI9 R;  3ZDY A;  4CY2 A;  4PSW B;  2VDK A;  3JRO A;  4JD2 C;  4YVD A;  4XYI A;  3GC3 B;  3GD1 I;  2P9L C;  1PEV A;  4CI1 A;  3ULE C;  1RI6 A;  3K72 A;  3EI3 B;  5HDB A; 
#chains in the Genus database with same CATH homology
 3NIG A;  2VDQ A;  4WK2 A;  4UM8 A;  2VDL A;  1JV2 A;  5FFG A;  3T3P A;  3VI4 A;  3ZDZ A;  4G1E A;  1L5G A;  4MMX A;  3K6S A;  4Z7Q A;  3T3M A;  3ZE0 A;  2VDM A;  1U8C A;  3NIF A;  3K71 A;  3NID A;  4G1M A;  3ZDX A;  2VDR A;  3IJE A;  1TYE A;  1M1X A;  4UM9 A;  4IRZ A;  3ZDY A;  4WK0 A;  4NEN A;  4Z7N A;  2VDK A;  4MMY A;  4MMZ A;  3ZE1 A;  4WJK A;  5E6U A;  3ZE2 A;  5E6R A;  2VDN A;  2VDP A;  5E6S A;  4O02 A;  3VI3 A;  3V4P A;  3V4V A;  4Z7O A;  3FCU A;  3K72 A;  3FCS A;  2VC2 A;  5FFO A;  4WK4 A;  5HDB A;  2VDO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...