2VDNA

Re-refinement of integrin alphaiibbeta3 headpiece bound to antagonist eptifibatide
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
452
structure length
452
Chain Sequence
LNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords INTEGRIN ALPHA-IIB
publication title Structural Basis for Distinctive Recognition of Fibrinogen Gammac Peptide by the Platelet Integrin Alphaiibbeta3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system
total genus 106
structure length 452
sequence length 452
ec nomenclature
pdb deposition date 2007-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01839 FG-GAP FG-GAP repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 2vdnA00
2VDOA 4NENA 1M1XA 4Z7QA 2VDQA 3K6SA 3FCSA 3ZDXA 1JV2A 3K72A 4MMZA 3FCUA 5FFGA 2VDRA 4Z7NA 1TYEA 3ZE2A 5HDBA 2VDKA 5E6UA 3V4VA 4G1MA 4MMXA 3T3PA 2VDLA 4MMYA 3ZDZA 4G1EA 4WK2A 5FFOA 4WK4A 4Z7OA 3NIDA 3IJEA 3K71A 2VDPA 1L5GA 2VDMA 4WK0A 3NIFA 4WJKA 4UM9A 3T3MA 3ZE1A 3VI4A 4IRZA 1U8CA 3V4PA 3ZE0A 4UM8A 3ZDYA 3VI3A 5E6SA 2VDNA 3NIGA 4O02A 5E6RA 2VC2A
chains in the Genus database with same CATH superfamily
2W18A 3C99A 4J82A 5GXIA 2IUPA 3NVQA 4X61B 3UVLA 4CY5A 2P9SC 3UKRC 3IUMA 1PBYB 4JSPC 2B5MA 1SQ9A 3PVUB 4O45A 3SHFA 4PXWA 3K27A 3I7KA 3IVMA 2H9PA 3O4GA 4G1EA 1A0RB 5IGOA 3IJ0A 4TZ4A 1VZ2A 5A2Qg 3NIDA 3K71A 2PM9B 2Q7QA 2YNNA 2GC4A 5HE0B 5FKQA 1QFMA 1JOFA 5HQGA 1U2VC 2MTAH 5C2WB 3SFZA 3OKYB 1JJUB 4Z7NA 2H9NA 2PM6B 2GC7A 4ZOYA 5H1MA 1VYHC 2P9KC 3JRPA 4BCBA 3DDUA 3I7LA 3PXSD 3AFCA 5FXYA 3EG6A 4FA1D 2OVPB 5SXMA 3PSLA 4JT6C 4O1QD 4D6VA 1C9LA 4J78A 3ORVD 4AX4A 4CC9A 4FA5D 5M5VA 4IMMA 5M5TA 4X60B 3MMYA 3UR4A 4NENA 2IAAA 3KCIA 3BG0A 3V7DB 4K3JB 5HE3B 4MMXA 5CYKB 2CN3A 3RRMC 2I3TA 4J0WA 4QL1A 3UVMA 2WQ8A 5H14A 3C5MA 3U4YA 4JSXC 4A09A 4A2MA 4OZUA 4Z7OA 3PSCB 3UVNA 2OIZA 1UOPA 4AN0A 3L4MD 1L5GA 4CI3A 4FAND 4FWWA 5IJ7E 5M5SA 5M5RA 1PGUA 3IKOA 2YBAA 4CI1A 5E6RA 3AL8A 1YR2A 4ZN4A 1B9YA 3UVOA 3SVWD 4J77A 5KDOB 4O9DA 5B4WA 2XDWA 4BP9A 2CE9A 1GP2B 3RFHA 4AMYA 1B9XA 5H17A 3OW8A 1XKSA 5IJ8E 3KRXB 4XYHA 2P9PC 3EI3A 4JT5C 2AGLA 4BCDA 4IA9A 1GOHA 2XU7A 5AMSA 2Z2PA 3I7OA 3SJLD 3W15A 4A08A 1YFQA 2VDQA 3RLMD 4D0KA 2BBKH 5C86A 2VDRA 4E54A 2VZ3A 3I7NA 4L3GD 2YNPA 4NSXA 3O4HA 5EMKB 3T3PA 4DNVA 2YMUA 2HXCA 3MKSB 5EM2A 3I8CA 4NAAA 3ZWLB 2OVRB 2OK4A 3NIFA 3T3MA 2G99A 3VI4A 3V4PA 2GNQA 3CIKB 2J56H 4A0BB 3JROA 2H9LA 2O9KA 4Z7QA 3L4OD 2HYEA 4J79A 3ZDXA 3V5WB 3I2NA 3EI4A 3K72A 3I7HA 4E5ZA 1VZ3A 3DWLC 3JPXA 3PXTD 4O3UB 4MK0B 3RN1D 4XYIA 2OVQB 3SBPA 4AN1A 3DSMA 2AGYA 5I5JA 5I5MA 2JKXA 2H6QA 1U4CA 4WJKA 3BG1A 3O4JA 3RFGA 1QFSA 5E6SA 4L1QD 5C9ZB 4GGAA 4O02A 5CXBA 2VC2A 4J0XA 4LGNA 4JHNA 3EQ8A 3QI0A 3EI1B 1MDAH 3JZHA 1OMWB 4H5JA 4N14A 2HJ4A 3RN0D 1VE6A 3VGZA 3OL2B 3JZGA 2VDKA 1C9IA 2J55H 3N0EA 3EQ9A 4LG8A 1XIPA 4MMYA 3GREA 2OJYA 4LG9A 4Y5RD 2H9MA 1H2YA 2BCJB 3ODTA 4A0AA 4A11A 4J87A 4E54B 4O3TB 5EMLB 1H2ZA 1E8MA 2CO0C 3ZE0A 4UM8A 2HKRA 3MZKA 2HKMA 3NIGA 3DXKC 3E0CA 4JSNC 3EI2A 2G9AA 1M1XA 1JMZB 2H3XA 2EICA 2J57G 1JV2A 3SN6B 5EMMB 2AQ5A 1TYEA 2P9LC 1S4UX 1GOFA 3CFSB 4NBMA 5E6UA 3FM0A 3CFVA 4L1MA 1PI6A 5FLXg 2H14A 3PXWD 1K3IA 3EQ7A 4ERZA 4GQ1A 4ZOXA 4WK4A 4G55A 3EI4B 3F3FA 4Z8LA 4WK0A 4D9SA 4AOWA 4PNKB 1VE7A 4XEIC 2EIBA 4RE5A 4I79A 3EWEA 3MUNA 1O6GA 3MKQA 3C75H 4J8GA 4BUJC 2IUQA 2H68A 1H2XA 5CXBB 3GD1I 4EWRA 5FKSA 2QR5A 2XYIA 3J81g 1K32A 2I0RA 3F3PA 3IJEA 3F3GA 4K3ID 1GG2B 1MG3A 3I89A 5HE2B 3IJ1A 1Q47A 4U7AA 1SQJA 2CN2A 4ERQA 4A0AB 3K6SA 5HYNB 2PM9A 3FRXA 2HJBA 3QHYB 1A12A 5FA5B 4DNUA 4FA9D 2YNOA 3V9FA 3I7PA 3SMRA 5IT9g 4UI9R 1FWXA 2AGXA 2EBSA 3PVWB 1GOTB 1N6FA 5EARA 4CZXA 3EMHA 3AL9A 4PBYA 2AH1A 2EIEA 1U8CA 4IRZA 4ERYA 1NEXB 1E5TA 2P9UC 4QT8A 3VA6A 1NR0A 3MXXA 2AGWA 2VZ1A 4GQ2P 3J80g 2VDOA 4A09B 2IWKA 2AGZA 3SCYA 5EMJB 2IUVA 1O6FA 2I3SA 3OKWA 1P22A 5FKTA 3PE7A 3AL8B 1UTCA 5AFU3 3MVDK 2B5NA 1L0QA 1N6EA 5EAMA 2H6NA 2VDMA 2XL3A 5FKRA 1QNIA 4ZOZA 2CE8A 3O4IA 5THAA 2IWFA 2XZGA 1R5MA 4CZVA 1H2WA 1JTDB 3UVKA 3BWSA 3FCSA 2Z2OA 3OKTA 1UOOA 2HU7A 4CZYA 4R7AB 4L3HD 3EI3B 3P4FA 5TF2A 4FB1D 1TYQC 1E8NA 3MUOA 4QAMA 4BCCA 4L9OA 2H47A 4A08B 4J73A 4A2LA 5GSAA 2AH0A 3DM0A 5FQDA 4G56B 3VI3A 4GZ8A 4CY1A 2CO0A 5AJAA 4BP8A 3AH8B 3GC3B 5K19A 3JAMg 4GMBA 5EM2B 4MMZA 4PSWB 3HFQA 4J84A 4FA4D 2IURA 3RSEC 5IGQA 3GFCA 4BL0A 2UZYB 2H13A 4CI2A 3ZDZA 2YB8B 2EIDA 4WK2A 5FFOA 5K1CC 3SWSD 2CNXA 1UOQA 4E5ZB 3KRWB 2HESX 3RMZD 3A0FA 3IJCA 4X3EA 5TEFA 4JHPC 3IULA 3IUNA 3N0DA 5CXCA 4O2WA 1BPOA 4Y7RA 2TRCB 4GM8A 4ESGA 5GMKn 3ZE2A 5HDBA 5JWZA 4FHLA 3SXTD 1SHYB 4YVDA 4J81A 1GXRA 4JD2C 4A0BA 3K26A 4DNWA 2Z2NA 5C2VB 3DXMC 1TBGA 2UZXB 4PSXB 4PBZA 2I0SA 2I0TA 1T2XA 4JXMA 4H5IA 4AEZA 3JB9L 1I2MB 3IURA 4GQBB 3SBQA 4HDJA 4GM3A 4ES0A 3ZDYA 3FGBA 1N6DA 4JSVC 3OF7A 5EALA 2QZPA 4A11B 3FCUA 5TEEA 2P9NC 3JZNA 4BH6A 2BKLA 4G1MA 2QXVA 2B5LA 4CY3A 5EAPA 2PBIB 3EI2B 5M61A 3EU7A 3SBRA 2P9IC 3EI1A 2OK6A 3MZLA 3SLED 3IIWA 5M5UA 3OKYA 1ERJA 2PM7B 3OL2A 1K8KC 5TDHB 2QC5A 4OWRA 2H6KA 4PC0A 3V4VA 1XHMA 4FAVD 1JMXB 4NC4A 3I8EA 4A7JA 4GGDA 2B4EA 5IC7A 1RI6A 3ULEC 5I5IA 1OLZA 5GXHA 1MG2A 4GM9A 5FFGA 1PEVA 4KFMB 3C9CA 4AMZA 4QQEA 1GOGA 2HU8A 3NVNA 4X63B 2XL2A 4ZOVA 3UKUC 2VDLA 4CY2A 4CI8A 4GGCA 4J86A 4J8BA 5CXCB 5HE1B 2HU5A 4U1EI 5C92A 4RE6A 3IUQA 3OTTA 2VDPA 4QRJA 3IIYA 3ZE1A 4UM9A 3B7FA 3NVXA 3IUJA 3VH0A 5CYKA 2XE4A 2VDNA
chains in the Genus database with same CATH topology
2VDOA 4NENA 1M1XA 4Z7QA 2VDQA 3K6SA 3FCSA 3ZDXA 1JV2A 3K72A 4MMZA 3FCUA 5FFGA 2VDRA 4Z7NA 1TYEA 3ZE2A 5HDBA 2VDKA 5E6UA 3V4VA 4G1MA 4MMXA 3T3PA 2VDLA 4MMYA 3ZDZA 4G1EA 4WK2A 5FFOA 4WK4A 4Z7OA 3NIDA 3IJEA 3K71A 2VDPA 1L5GA 2VDMA 4WK0A 3NIFA 4WJKA 4UM9A 3T3MA 3ZE1A 3VI4A 4IRZA 1U8CA 3V4PA 3ZE0A 4UM8A 3ZDYA 3VI3A 5E6SA 2VDNA 3NIGA 4O02A 5E6RA 2VC2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VDO A;  4NEN A;  1M1X A;  4Z7Q A;  2VDQ A;  3K6S A;  3FCS A;  3ZDX A;  1JV2 A;  3K72 A;  4MMZ A;  3FCU A;  5FFG A;  2VDR A;  4Z7N A;  1TYE A;  3ZE2 A;  5HDB A;  2VDK A;  5E6U A;  3V4V A;  4G1M A;  4MMX A;  3T3P A;  2VDL A;  4MMY A;  3ZDZ A;  4G1E A;  4WK2 A;  5FFO A;  4WK4 A;  4Z7O A;  3NID A;  3IJE A;  3K71 A;  2VDP A;  1L5G A;  2VDM A;  4WK0 A;  3NIF A;  4WJK A;  4UM9 A;  3T3M A;  3ZE1 A;  3VI4 A;  4IRZ A;  1U8C A;  3V4P A;  3ZE0 A;  4UM8 A;  3ZDY A;  3VI3 A;  5E6S A;  2VDN A;  3NIG A;  4O02 A;  5E6R A;  2VC2 A; 
#chains in the Genus database with same CATH topology
 2W18 A;  3C99 A;  4J82 A;  5GXI A;  2IUP A;  3NVQ A;  4X61 B;  3UVL A;  4CY5 A;  2P9S C;  3UKR C;  3IUM A;  1PBY B;  4JSP C;  2B5M A;  1SQ9 A;  3PVU B;  4O45 A;  3SHF A;  4PXW A;  3K27 A;  3I7K A;  3IVM A;  2H9P A;  3O4G A;  4G1E A;  1A0R B;  5IGO A;  3IJ0 A;  4TZ4 A;  1VZ2 A;  5A2Q g;  3NID A;  3K71 A;  2PM9 B;  2Q7Q A;  2YNN A;  2GC4 A;  5HE0 B;  5FKQ A;  1QFM A;  1JOF A;  5HQG A;  1U2V C;  2MTA H;  5C2W B;  3SFZ A;  3OKY B;  1JJU B;  4Z7N A;  2H9N A;  2PM6 B;  2GC7 A;  4ZOY A;  5H1M A;  1VYH C;  2P9K C;  3JRP A;  4BCB A;  3DDU A;  3I7L A;  3PXS D;  3AFC A;  5FXY A;  3EG6 A;  4FA1 D;  2OVP B;  5SXM A;  3PSL A;  4JT6 C;  4O1Q D;  4D6V A;  1C9L A;  4J78 A;  3ORV D;  4AX4 A;  4CC9 A;  4FA5 D;  5M5V A;  4IMM A;  5M5T A;  4X60 B;  3MMY A;  3UR4 A;  4NEN A;  2IAA A;  3KCI A;  3BG0 A;  3V7D B;  4K3J B;  5HE3 B;  4MMX A;  5CYK B;  2CN3 A;  3RRM C;  2I3T A;  4J0W A;  4QL1 A;  3UVM A;  2WQ8 A;  5H14 A;  3C5M A;  3U4Y A;  4JSX C;  4A09 A;  4A2M A;  4OZU A;  4Z7O A;  3PSC B;  3UVN A;  2OIZ A;  1UOP A;  4AN0 A;  3L4M D;  1L5G A;  4CI3 A;  4FAN D;  4FWW A;  5IJ7 E;  5M5S A;  5M5R A;  1PGU A;  3IKO A;  2YBA A;  4CI1 A;  5E6R A;  3AL8 A;  1YR2 A;  4ZN4 A;  1B9Y A;  3UVO A;  3SVW D;  4J77 A;  5KDO B;  4O9D A;  5B4W A;  2XDW A;  4BP9 A;  2CE9 A;  1GP2 B;  3RFH A;  4AMY A;  1B9X A;  5H17 A;  3OW8 A;  1XKS A;  5IJ8 E;  3KRX B;  4XYH A;  2P9P C;  3EI3 A;  4JT5 C;  2AGL A;  4BCD A;  4IA9 A;  1GOH A;  2XU7 A;  5AMS A;  2Z2P A;  3I7O A;  3SJL D;  3W15 A;  4A08 A;  1YFQ A;  2VDQ A;  3RLM D;  4D0K A;  2BBK H;  5C86 A;  2VDR A;  4E54 A;  2VZ3 A;  3I7N A;  4L3G D;  2YNP A;  4NSX A;  3O4H A;  5EMK B;  3T3P A;  4DNV A;  2YMU A;  2HXC A;  3MKS B;  5EM2 A;  3I8C A;  4NAA A;  3ZWL B;  2OVR B;  2OK4 A;  3NIF A;  3T3M A;  2G99 A;  3VI4 A;  3V4P A;  2GNQ A;  3CIK B;  2J56 H;  4A0B B;  3JRO A;  2H9L A;  2O9K A;  4Z7Q A;  3L4O D;  2HYE A;  4J79 A;  3ZDX A;  3V5W B;  3I2N A;  3EI4 A;  3K72 A;  3I7H A;  4E5Z A;  1VZ3 A;  3DWL C;  3JPX A;  3PXT D;  4O3U B;  4MK0 B;  3RN1 D;  4XYI A;  2OVQ B;  3SBP A;  4AN1 A;  3DSM A;  2AGY A;  5I5J A;  5I5M A;  2JKX A;  2H6Q A;  1U4C A;  4WJK A;  3BG1 A;  3O4J A;  3RFG A;  1QFS A;  5E6S A;  4L1Q D;  5C9Z B;  4GGA A;  4O02 A;  5CXB A;  2VC2 A;  4J0X A;  4LGN A;  4JHN A;  3EQ8 A;  3QI0 A;  3EI1 B;  1MDA H;  3JZH A;  1OMW B;  4H5J A;  4N14 A;  2HJ4 A;  3RN0 D;  1VE6 A;  3VGZ A;  3OL2 B;  3JZG A;  2VDK A;  1C9I A;  2J55 H;  3N0E A;  3EQ9 A;  4LG8 A;  1XIP A;  4MMY A;  3GRE A;  2OJY A;  4LG9 A;  4Y5R D;  2H9M A;  1H2Y A;  2BCJ B;  3ODT A;  4A0A A;  4A11 A;  4J87 A;  4E54 B;  4O3T B;  5EML B;  1H2Z A;  1E8M A;  2CO0 C;  3ZE0 A;  4UM8 A;  2HKR A;  3MZK A;  2HKM A;  3NIG A;  3DXK C;  3E0C A;  4JSN C;  3EI2 A;  2G9A A;  1M1X A;  1JMZ B;  2H3X A;  2EIC A;  2J57 G;  1JV2 A;  3SN6 B;  5EMM B;  2AQ5 A;  1TYE A;  2P9L C;  1S4U X;  1GOF A;  3CFS B;  4NBM A;  5E6U A;  3FM0 A;  3CFV A;  4L1M A;  1PI6 A;  5FLX g;  2H14 A;  3PXW D;  1K3I A;  3EQ7 A;  4ERZ A;  4GQ1 A;  4ZOX A;  4WK4 A;  4G55 A;  3EI4 B;  3F3F A;  4Z8L A;  4WK0 A;  4D9S A;  4AOW A;  4PNK B;  1VE7 A;  4XEI C;  2EIB A;  4RE5 A;  4I79 A;  3EWE A;  3MUN A;  1O6G A;  3MKQ A;  3C75 H;  4J8G A;  4BUJ C;  2IUQ A;  2H68 A;  1H2X A;  5CXB B;  3GD1 I;  4EWR A;  5FKS A;  2QR5 A;  2XYI A;  3J81 g;  1K32 A;  2I0R A;  3F3P A;  3IJE A;  3F3G A;  4K3I D;  1GG2 B;  1MG3 A;  3I89 A;  5HE2 B;  3IJ1 A;  1Q47 A;  4U7A A;  1SQJ A;  2CN2 A;  4ERQ A;  4A0A B;  3K6S A;  5HYN B;  2PM9 A;  3FRX A;  2HJB A;  3QHY B;  1A12 A;  5FA5 B;  4DNU A;  4FA9 D;  2YNO A;  3V9F A;  3I7P A;  3SMR A;  5IT9 g;  4UI9 R;  1FWX A;  2AGX A;  2EBS A;  3PVW B;  1GOT B;  1N6F A;  5EAR A;  4CZX A;  3EMH A;  3AL9 A;  4PBY A;  2AH1 A;  2EIE A;  1U8C A;  4IRZ A;  4ERY A;  1NEX B;  1E5T A;  2P9U C;  4QT8 A;  3VA6 A;  1NR0 A;  3MXX A;  2AGW A;  2VZ1 A;  4GQ2 P;  3J80 g;  2VDO A;  4A09 B;  2IWK A;  2AGZ A;  3SCY A;  5EMJ B;  2IUV A;  1O6F A;  2I3S A;  3OKW A;  1P22 A;  5FKT A;  3PE7 A;  3AL8 B;  1UTC A;  5AFU 3;  3MVD K;  2B5N A;  1L0Q A;  1N6E A;  5EAM A;  2H6N A;  2VDM A;  2XL3 A;  5FKR A;  1QNI A;  4ZOZ A;  2CE8 A;  3O4I A;  5THA A;  2IWF A;  2XZG A;  1R5M A;  4CZV A;  1H2W A;  1JTD B;  3UVK A;  3BWS A;  3FCS A;  2Z2O A;  3OKT A;  1UOO A;  2HU7 A;  4CZY A;  4R7A B;  4L3H D;  3EI3 B;  3P4F A;  5TF2 A;  4FB1 D;  1TYQ C;  1E8N A;  3MUO A;  4QAM A;  4BCC A;  4L9O A;  2H47 A;  4A08 B;  4J73 A;  4A2L A;  5GSA A;  2AH0 A;  3DM0 A;  5FQD A;  4G56 B;  3VI3 A;  4GZ8 A;  4CY1 A;  2CO0 A;  5AJA A;  4BP8 A;  3AH8 B;  3GC3 B;  5K19 A;  3JAM g;  4GMB A;  5EM2 B;  4MMZ A;  4PSW B;  3HFQ A;  4J84 A;  4FA4 D;  2IUR A;  3RSE C;  5IGQ A;  3GFC A;  4BL0 A;  2UZY B;  2H13 A;  4CI2 A;  3ZDZ A;  2YB8 B;  2EID A;  4WK2 A;  5FFO A;  5K1C C;  3SWS D;  2CNX A;  1UOQ A;  4E5Z B;  3KRW B;  2HES X;  3RMZ D;  3A0F A;  3IJC A;  4X3E A;  5TEF A;  4JHP C;  3IUL A;  3IUN A;  3N0D A;  5CXC A;  4O2W A;  1BPO A;  4Y7R A;  2TRC B;  4GM8 A;  4ESG A;  5GMK n;  3ZE2 A;  5HDB A;  5JWZ A;  4FHL A;  3SXT D;  1SHY B;  4YVD A;  4J81 A;  1GXR A;  4JD2 C;  4A0B A;  3K26 A;  4DNW A;  2Z2N A;  5C2V B;  3DXM C;  1TBG A;  2UZX B;  4PSX B;  4PBZ A;  2I0S A;  2I0T A;  1T2X A;  4JXM A;  4H5I A;  4AEZ A;  3JB9 L;  1I2M B;  3IUR A;  4GQB B;  3SBQ A;  4HDJ A;  4GM3 A;  4ES0 A;  3ZDY A;  3FGB A;  1N6D A;  4JSV C;  3OF7 A;  5EAL A;  2QZP A;  4A11 B;  3FCU A;  5TEE A;  2P9N C;  3JZN A;  4BH6 A;  2BKL A;  4G1M A;  2QXV A;  2B5L A;  4CY3 A;  5EAP A;  2PBI B;  3EI2 B;  5M61 A;  3EU7 A;  3SBR A;  2P9I C;  3EI1 A;  2OK6 A;  3MZL A;  3SLE D;  3IIW A;  5M5U A;  3OKY A;  1ERJ A;  2PM7 B;  3OL2 A;  1K8K C;  5TDH B;  2QC5 A;  4OWR A;  2H6K A;  4PC0 A;  3V4V A;  1XHM A;  4FAV D;  1JMX B;  4NC4 A;  3I8E A;  4A7J A;  4GGD A;  2B4E A;  5IC7 A;  1RI6 A;  3ULE C;  5I5I A;  1OLZ A;  5GXH A;  1MG2 A;  4GM9 A;  5FFG A;  1PEV A;  4KFM B;  3C9C A;  4AMZ A;  4QQE A;  1GOG A;  2HU8 A;  3NVN A;  4X63 B;  2XL2 A;  4ZOV A;  3UKU C;  2VDL A;  4CY2 A;  4CI8 A;  4GGC A;  4J86 A;  4J8B A;  5CXC B;  5HE1 B;  2HU5 A;  4U1E I;  5C92 A;  4RE6 A;  3IUQ A;  3OTT A;  2VDP A;  4QRJ A;  3IIY A;  3ZE1 A;  4UM9 A;  3B7F A;  3NVX A;  3IUJ A;  3VH0 A;  5CYK A;  2XE4 A;  2VDN A; 
#chains in the Genus database with same CATH homology
 2VDO A;  4NEN A;  1M1X A;  4Z7Q A;  2VDQ A;  3K6S A;  3FCS A;  3ZDX A;  1JV2 A;  3K72 A;  4MMZ A;  3FCU A;  5FFG A;  2VDR A;  4Z7N A;  1TYE A;  3ZE2 A;  5HDB A;  2VDK A;  5E6U A;  3V4V A;  4G1M A;  4MMX A;  3T3P A;  2VDL A;  4MMY A;  3ZDZ A;  4G1E A;  4WK2 A;  5FFO A;  4WK4 A;  4Z7O A;  3NID A;  3IJE A;  3K71 A;  2VDP A;  1L5G A;  2VDM A;  4WK0 A;  3NIF A;  4WJK A;  4UM9 A;  3T3M A;  3ZE1 A;  3VI4 A;  4IRZ A;  1U8C A;  3V4P A;  3ZE0 A;  4UM8 A;  3ZDY A;  3VI3 A;  5E6S A;  2VDN A;  3NIG A;  4O02 A;  5E6R A;  2VC2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...