2VDNA

Re-refinement of integrin alphaiibbeta3 headpiece bound to antagonist eptifibatide
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
452
structure length
452
Chain Sequence
b'LNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords INTEGRIN ALPHA-IIB
publication title Structural Basis for Distinctive Recognition of Fibrinogen Gammac Peptide by the Platelet Integrin Alphaiibbeta3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system
total genus 106
structure length 452
sequence length 452
ec nomenclature
pdb deposition date 2007-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01839 FG-GAP FG-GAP repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 2vdnA00
4NENA 4Z7NA 4G1EA 1U8CA 2VDOA 4MMXA 3T3PA 3K6SA 4Z7OA 1JV2A 2VDRA 5FFOA 3V4PA 1L5GA 4O02A 5E6RA 5FFGA 4Z7QA 3K72A 4WK0A 3FCSA 2VC2A 3IJEA 4G1MA 3T3MA 3FCUA 4WJKA 5E6SA 2VDLA 5E6UA 3ZDZA 4UM8A 3VI4A 3ZDYA 1TYEA 3NIFA 4MMZA 5HDBA 3V4VA 3ZE1A 3K71A 2VDKA 2VDQA 2VDNA 2VDMA 3ZE2A 4WK4A 3NIGA 4MMYA 1M1XA 2VDPA 4WK2A 3NIDA 4IRZA 3VI3A 3ZE0A 4UM9A 3ZDXA
chains in the Genus database with same CATH superfamily
3I89A 3C99A 1RI6A 4G1EA 2CO0C 5K19A 4PNKB 2VDRA 4E54B 1NR0A 3EI4B 1TBGA 2OJYA 2PM9A 5C86A 3RMZD 5GXHA 5H14A 4CZVA 2H3XA 4J0WA 2JKXA 2I3TA 2IUPA 3SCYA 3OKYA 2VDQA 5M5UA 4CY3A 3AL8A 1PI6A 1BPOA 1M1XA 4WK2A 3IVMA 1JMXB 3CIKB 3JPXA 4ES0A 4MMXA 3C9CA 4CI8A 4ESGA 4Z7OA 3I7LA 5HE1B 3MKQA 3DWLC 4J86A 4L3GD 4LG9A 5FQDA 5B4WA 3RFGA 1SQ9A 2AGZA 4O3TB 2Q7QA 1E8NA 3QHYB 2P9IC 4JSNC 3OW8A 3K27A 2GC4A 3SJLD 5E6UA 3ZWLB 4QAMA 3RRMC 4ERZA 5JWZA 4GM3A 3NIFA 1VYHC 1PBYB 2P9SC 3ZE2A 5I5MA 3NVXA 1QFSA 3FRXA 5FLXg 3VI3A 3JZGA 4IA9A 4A08A 4JD2C 3MZLA 2CN3A 1UOPA 3I8EA 4JSPC 2I3SA 1YR2A 1R5MA 4JXMA 1PGUA 3I7NA 3JRPA 1O6FA 3T3MA 5SXMA 4A11A 3FM0A 3DSMA 2Z2PA 4CZXA 2B5MA 3CFVA 4WK4A 3UVKA 3SFZA 4A0AB 1N6FA 4X63B 2XL3A 3IULA 2VDOA 3ODTA 4DNVA 1C9IA 5K1CC 5E6RA 3EQ8A 2EBSA 4RE6A 3GFCA 5FKQA 3IJEA 5C2VB 4G56B 5A2Qg 3FCUA 4J8BA 3MXXA 3V7DB 5EM2B 1GOFA 4BL0A 3I7KA 4J0XA 3IJ0A 4DNWA 5FKRA 1VE6A 2GC7A 2WQ8A 2H6QA 1NEXB 4E5ZA 4J82A 5FXYA 4BP8A 5IJ7E 4PBZA 3L4OD 3SBRA 4AN0A 3NVQA 3A0FA 1O6GA 2VC2A 2AGXA 3UKRC 1T2XA 3V9FA 2XU7A 3JAMg 5E6SA 4ERYA 1GOHA 3IUMA 3SN6B 1XKSA 2HXCA 4XEIC 1XIPA 4BP9A 3ZE1A 4PC0A 3PSLA 4GMBA 3O4IA 2VDNA 5H17A 3FGBA 3OL2B 4PSWB 4MMYA 4DNUA 2PM9B 4PBYA 4O45A 4IMMA 1QNIA 4X3EA 4UM9A 4J81A 3DDUA 4L1QD 1TYQC 3MVDK 3QI0A 3JB9L 5HQGA 4FA9D 1E5TA 4J73A 3I7PA 4OWRA 3EI2B 2HU5A 4WK0A 4CZYA 2PM7B 1ERJA 3MUOA 2I0SA 4FA1D 2H6NA 2B5NA 2Z2OA 1L0QA 2IUVA 1TYEA 3EI3B 5CYKB 2CO0A 1E8MA 4GGCA 4CC9A 4ZOVA 3P4FA 2H68A 1VZ3A 5HE0B 3J80g 4Y5RD 2OVPB 1OLZA 4TZ4A 1QFMA 3KRXB 4BCBA 1FWXA 2YMUA 4A0BA 4CI1A 3T3PA 3I7OA 1A0RB 5H1MA 4RE5A 3V4PA 4BCDA 1P22A 2XZGA 2EICA 3O4HA 2EIEA 4A2MA 4J78A 2AH1A 5HE3B 3GC3B 2I0RA 1GOGA 5EARA 2YB8B 2BBKH 2XE4A 4PSXB 4QQEA 4ZOYA 3K71A 4E54A 4QT8A 3EI4A 1B9XA 3KRWB 4CY2A 1MG2A 3RSEC 2AQ5A 5M5TA 2YBAA 4NSXA 5IGQA 5FKTA 5FFOA 3PVWB 2OIZA 2OK6A 4D0KA 2J57G 3SBQA 4O1QD 4JHNA 1B9YA 5M61A 5EMMB 2P9LC 2OVQB 3I2NA 1H2ZA 2IWFA 3UVOA 4FA5D 1MG3A 3ZDZA 4FB1D 1I2MB 5HDBA 2B4EA 5EAMA 1UOOA 2OVRB 3C5MA 3EMHA 2H13A 3IUJA 1K3IA 4JT6C 3ORVD 5TEFA 4Z7NA 3N0EA 5CXBB 5GXIA 4O2WA 1Q47A 4U1EI 3UR4A 4FA4D 1N6DA 4UI9R 5I5JA 4X61B 4I79A 4CY5A 3VGZA 2I0TA 5IJ8E 3SWSD 5M5SA 3RLMD 2HYEA 1A12A 2AH0A 2P9UC 5CXCB 4A09B 1U2VC 5HYNB 3EI1B 1YFQA 3AL9A 3GD1I 3ZDXA 4NENA 1JOFA 2G9AA 2QC5A 1U8CA 3K6SA 1JMZB 2H6KA 2CE9A 2XYIA 4ZOXA 1L5GA 2EIDA 4D6VA 3SXTD 5FA5B 4FWWA 2P9PC 2IUQA 3BG1A 4AN1A 4AX4A 4A0AA 4GGAA 4K3ID 3PXTD 1H2YA 2W18A 2YNPA 2VDLA 5AFU3 3MZKA 3MKSB 2P9KC 4KFMB 3E0CA 2HKRA 2BCJB 4X60B 3EQ7A 3MUNA 3BWSA 3IJ1A 2AGWA 3EQ9A 2AGLA 5EM2A 3DM0A 3KCIA 2QXVA 3EG6A 4PXWA 2J56H 3EU7A 3OKYB 3RN0D 3UKUC 3IJCA 3AL8B 4ZN4A 1VE7A 4J77A 3PXSD 3SMRA 4O9DA 4UM8A 5GSAA 2MTAH 3DXKC 4J8GA 4MMZA 3JROA 3BG0A 1PEVA 4AEZA 1UOQA 4JSVC 4QRJA 4NBMA 2UZYB 5EMLB 3OTTA 4XYIA 3PSCB 3W15A 2H47A 1OMWB 2HU8A 5IGOA 3UVNA 3RFHA 2G99A 2O9KA 4AOWA 3IKOA 4LGNA 3PE7A 4NAAA 3JZNA 1K32A 3OL2A 4FAND 2UZXB 4QL1A 1VZ2A 3AFCA 2PBIB 3F3GA 3RN1D 2QZPA 4JSXC 3V5WB 3F3FA 3DXMC 1N6EA 1GXRA 4A08B 2YNNA 4CI2A 2OK4A 4R7AB 2QR5A 4FHLA 4GGDA 3EI2A 3IIYA 4U7AA 1JTDB 2HU7A 5TEEA 4AMYA 4A11B 3SVWD 3O4GA 3VH0A 1MDAH 5I5IA 4Z8LA 3EI3A 1JJUB 5CYKA 4GQBB 3K72A 4CY1A 5C92A 4ERQA 4J79A 2HJ4A 2VZ1A 4K3JB 2AGYA 1SHYB 1UTCA 5GMKn 3I7HA 4BH6A 3OF7A 5HE2B 4ZOZA 4G55A 3N0DA 4BUJC 2VDMA 3SHFA 4A7JA 4GQ1A 3NIGA 2H9PA 4L9OA 4FAVD 4H5JA 2VDPA 3C75H 3NIDA 2BKLA 2HESX 2TRCB 4JHPC 5TF2A 1H2WA 2P9NC 2EIBA 3HFQA 1S4UX 5EAPA 2XL2A 3JZHA 4Z7QA 1GOTB 2H9LA 4N14A 1H2XA 4HDJA 4L1MA 1U4CA 1C9LA 5TDHB 3PXWD 4J84A 4OZUA 4E5ZB 4L3HD 5IC7A 3PVUB 3VA6A 4A2LA 3IUNA 5C9ZB 3IIWA 3I8CA 3IURA 4H5IA 3SLED 4GM8A 4IRZA 3J81g 4D9SA 5M5VA 3ULEC 3F3PA 5AMSA 2H14A 2H9NA 3AH8B 4GZ8A 4MK0B 4O02A 2GNQA 5EMKB 1SQJA 3OKWA 2HJBA 3CFSB 3O4JA 3SBPA 5AJAA 4EWRA 3ZDYA 4CI3A 5CXBA 1K8KC 2VZ3A 4J87A 3V4VA 2VDKA 5KDOB 3MMYA 2CN2A 2IWKA 5EALA 3UVMA 2IAAA 4Y7RA 2H9MA 2XDWA 4JT5C 3L4MD 2CE8A 3UVLA 2B5LA 3OKTA 1JV2A 1XHMA 4AMZA 3B7FA 3IUQA 5FFGA 5EMJB 5CXCA 4NC4A 4A09A 2CNXA 1GG2B 4YVDA 3GREA 5C2WB 3FCSA 4G1MA 2PM6B 4LG8A 3EI1A 2YNOA 4WJKA 4BCCA 2IURA 3U4YA 4A0BB 3NVNA 4GQ2P 3K26A 4O3UB 3VI4A 5THAA 5M5RA 5IT9g 3EWEA 2Z2NA 4XYHA 1GP2B 5FKSA 2J55H 4GM9A 2HKMA 3ZE0A
chains in the Genus database with same CATH topology
4NENA 4Z7NA 4G1EA 1U8CA 2VDOA 4MMXA 3T3PA 3K6SA 4Z7OA 1JV2A 2VDRA 5FFOA 3V4PA 1L5GA 4O02A 5E6RA 5FFGA 4Z7QA 3K72A 4WK0A 3FCSA 2VC2A 3IJEA 4G1MA 3T3MA 3FCUA 4WJKA 5E6SA 2VDLA 5E6UA 3ZDZA 4UM8A 3VI4A 3ZDYA 1TYEA 3NIFA 4MMZA 5HDBA 3V4VA 3ZE1A 3K71A 2VDKA 2VDQA 2VDNA 2VDMA 3ZE2A 4WK4A 3NIGA 4MMYA 1M1XA 2VDPA 4WK2A 3NIDA 4IRZA 3VI3A 3ZE0A 4UM9A 3ZDXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NEN A;  4Z7N A;  4G1E A;  1U8C A;  2VDO A;  4MMX A;  3T3P A;  3K6S A;  4Z7O A;  1JV2 A;  2VDR A;  5FFO A;  3V4P A;  1L5G A;  4O02 A;  5E6R A;  5FFG A;  4Z7Q A;  3K72 A;  4WK0 A;  3FCS A;  2VC2 A;  3IJE A;  4G1M A;  3T3M A;  3FCU A;  4WJK A;  5E6S A;  2VDL A;  5E6U A;  3ZDZ A;  4UM8 A;  3VI4 A;  3ZDY A;  1TYE A;  3NIF A;  4MMZ A;  5HDB A;  3V4V A;  3ZE1 A;  3K71 A;  2VDK A;  2VDQ A;  2VDN A;  2VDM A;  3ZE2 A;  4WK4 A;  3NIG A;  4MMY A;  1M1X A;  2VDP A;  4WK2 A;  3NID A;  4IRZ A;  3VI3 A;  3ZE0 A;  4UM9 A;  3ZDX A; 
#chains in the Genus database with same CATH topology
 3I89 A;  3C99 A;  1RI6 A;  4G1E A;  2CO0 C;  5K19 A;  4PNK B;  2VDR A;  4E54 B;  1NR0 A;  3EI4 B;  1TBG A;  2OJY A;  2PM9 A;  5C86 A;  3RMZ D;  5GXH A;  5H14 A;  4CZV A;  2H3X A;  4J0W A;  2JKX A;  2I3T A;  2IUP A;  3SCY A;  3OKY A;  2VDQ A;  5M5U A;  4CY3 A;  3AL8 A;  1PI6 A;  1BPO A;  1M1X A;  4WK2 A;  3IVM A;  1JMX B;  3CIK B;  3JPX A;  4ES0 A;  4MMX A;  3C9C A;  4CI8 A;  4ESG A;  4Z7O A;  3I7L A;  5HE1 B;  3MKQ A;  3DWL C;  4J86 A;  4L3G D;  4LG9 A;  5FQD A;  5B4W A;  3RFG A;  1SQ9 A;  2AGZ A;  4O3T B;  2Q7Q A;  1E8N A;  3QHY B;  2P9I C;  4JSN C;  3OW8 A;  3K27 A;  2GC4 A;  3SJL D;  5E6U A;  3ZWL B;  4QAM A;  3RRM C;  4ERZ A;  5JWZ A;  4GM3 A;  3NIF A;  1VYH C;  1PBY B;  2P9S C;  3ZE2 A;  5I5M A;  3NVX A;  1QFS A;  3FRX A;  5FLX g;  3VI3 A;  3JZG A;  4IA9 A;  4A08 A;  4JD2 C;  3MZL A;  2CN3 A;  1UOP A;  3I8E A;  4JSP C;  2I3S A;  1YR2 A;  1R5M A;  4JXM A;  1PGU A;  3I7N A;  3JRP A;  1O6F A;  3T3M A;  5SXM A;  4A11 A;  3FM0 A;  3DSM A;  2Z2P A;  4CZX A;  2B5M A;  3CFV A;  4WK4 A;  3UVK A;  3SFZ A;  4A0A B;  1N6F A;  4X63 B;  2XL3 A;  3IUL A;  2VDO A;  3ODT A;  4DNV A;  1C9I A;  5K1C C;  5E6R A;  3EQ8 A;  2EBS A;  4RE6 A;  3GFC A;  5FKQ A;  3IJE A;  5C2V B;  4G56 B;  5A2Q g;  3FCU A;  4J8B A;  3MXX A;  3V7D B;  5EM2 B;  1GOF A;  4BL0 A;  3I7K A;  4J0X A;  3IJ0 A;  4DNW A;  5FKR A;  1VE6 A;  2GC7 A;  2WQ8 A;  2H6Q A;  1NEX B;  4E5Z A;  4J82 A;  5FXY A;  4BP8 A;  5IJ7 E;  4PBZ A;  3L4O D;  3SBR A;  4AN0 A;  3NVQ A;  3A0F A;  1O6G A;  2VC2 A;  2AGX A;  3UKR C;  1T2X A;  3V9F A;  2XU7 A;  3JAM g;  5E6S A;  4ERY A;  1GOH A;  3IUM A;  3SN6 B;  1XKS A;  2HXC A;  4XEI C;  1XIP A;  4BP9 A;  3ZE1 A;  4PC0 A;  3PSL A;  4GMB A;  3O4I A;  2VDN A;  5H17 A;  3FGB A;  3OL2 B;  4PSW B;  4MMY A;  4DNU A;  2PM9 B;  4PBY A;  4O45 A;  4IMM A;  1QNI A;  4X3E A;  4UM9 A;  4J81 A;  3DDU A;  4L1Q D;  1TYQ C;  3MVD K;  3QI0 A;  3JB9 L;  5HQG A;  4FA9 D;  1E5T A;  4J73 A;  3I7P A;  4OWR A;  3EI2 B;  2HU5 A;  4WK0 A;  4CZY A;  2PM7 B;  1ERJ A;  3MUO A;  2I0S A;  4FA1 D;  2H6N A;  2B5N A;  2Z2O A;  1L0Q A;  2IUV A;  1TYE A;  3EI3 B;  5CYK B;  2CO0 A;  1E8M A;  4GGC A;  4CC9 A;  4ZOV A;  3P4F A;  2H68 A;  1VZ3 A;  5HE0 B;  3J80 g;  4Y5R D;  2OVP B;  1OLZ A;  4TZ4 A;  1QFM A;  3KRX B;  4BCB A;  1FWX A;  2YMU A;  4A0B A;  4CI1 A;  3T3P A;  3I7O A;  1A0R B;  5H1M A;  4RE5 A;  3V4P A;  4BCD A;  1P22 A;  2XZG A;  2EIC A;  3O4H A;  2EIE A;  4A2M A;  4J78 A;  2AH1 A;  5HE3 B;  3GC3 B;  2I0R A;  1GOG A;  5EAR A;  2YB8 B;  2BBK H;  2XE4 A;  4PSX B;  4QQE A;  4ZOY A;  3K71 A;  4E54 A;  4QT8 A;  3EI4 A;  1B9X A;  3KRW B;  4CY2 A;  1MG2 A;  3RSE C;  2AQ5 A;  5M5T A;  2YBA A;  4NSX A;  5IGQ A;  5FKT A;  5FFO A;  3PVW B;  2OIZ A;  2OK6 A;  4D0K A;  2J57 G;  3SBQ A;  4O1Q D;  4JHN A;  1B9Y A;  5M61 A;  5EMM B;  2P9L C;  2OVQ B;  3I2N A;  1H2Z A;  2IWF A;  3UVO A;  4FA5 D;  1MG3 A;  3ZDZ A;  4FB1 D;  1I2M B;  5HDB A;  2B4E A;  5EAM A;  1UOO A;  2OVR B;  3C5M A;  3EMH A;  2H13 A;  3IUJ A;  1K3I A;  4JT6 C;  3ORV D;  5TEF A;  4Z7N A;  3N0E A;  5CXB B;  5GXI A;  4O2W A;  1Q47 A;  4U1E I;  3UR4 A;  4FA4 D;  1N6D A;  4UI9 R;  5I5J A;  4X61 B;  4I79 A;  4CY5 A;  3VGZ A;  2I0T A;  5IJ8 E;  3SWS D;  5M5S A;  3RLM D;  2HYE A;  1A12 A;  2AH0 A;  2P9U C;  5CXC B;  4A09 B;  1U2V C;  5HYN B;  3EI1 B;  1YFQ A;  3AL9 A;  3GD1 I;  3ZDX A;  4NEN A;  1JOF A;  2G9A A;  2QC5 A;  1U8C A;  3K6S A;  1JMZ B;  2H6K A;  2CE9 A;  2XYI A;  4ZOX A;  1L5G A;  2EID A;  4D6V A;  3SXT D;  5FA5 B;  4FWW A;  2P9P C;  2IUQ A;  3BG1 A;  4AN1 A;  4AX4 A;  4A0A A;  4GGA A;  4K3I D;  3PXT D;  1H2Y A;  2W18 A;  2YNP A;  2VDL A;  5AFU 3;  3MZK A;  3MKS B;  2P9K C;  4KFM B;  3E0C A;  2HKR A;  2BCJ B;  4X60 B;  3EQ7 A;  3MUN A;  3BWS A;  3IJ1 A;  2AGW A;  3EQ9 A;  2AGL A;  5EM2 A;  3DM0 A;  3KCI A;  2QXV A;  3EG6 A;  4PXW A;  2J56 H;  3EU7 A;  3OKY B;  3RN0 D;  3UKU C;  3IJC A;  3AL8 B;  4ZN4 A;  1VE7 A;  4J77 A;  3PXS D;  3SMR A;  4O9D A;  4UM8 A;  5GSA A;  2MTA H;  3DXK C;  4J8G A;  4MMZ A;  3JRO A;  3BG0 A;  1PEV A;  4AEZ A;  1UOQ A;  4JSV C;  4QRJ A;  4NBM A;  2UZY B;  5EML B;  3OTT A;  4XYI A;  3PSC B;  3W15 A;  2H47 A;  1OMW B;  2HU8 A;  5IGO A;  3UVN A;  3RFH A;  2G99 A;  2O9K A;  4AOW A;  3IKO A;  4LGN A;  3PE7 A;  4NAA A;  3JZN A;  1K32 A;  3OL2 A;  4FAN D;  2UZX B;  4QL1 A;  1VZ2 A;  3AFC A;  2PBI B;  3F3G A;  3RN1 D;  2QZP A;  4JSX C;  3V5W B;  3F3F A;  3DXM C;  1N6E A;  1GXR A;  4A08 B;  2YNN A;  4CI2 A;  2OK4 A;  4R7A B;  2QR5 A;  4FHL A;  4GGD A;  3EI2 A;  3IIY A;  4U7A A;  1JTD B;  2HU7 A;  5TEE A;  4AMY A;  4A11 B;  3SVW D;  3O4G A;  3VH0 A;  1MDA H;  5I5I A;  4Z8L A;  3EI3 A;  1JJU B;  5CYK A;  4GQB B;  3K72 A;  4CY1 A;  5C92 A;  4ERQ A;  4J79 A;  2HJ4 A;  2VZ1 A;  4K3J B;  2AGY A;  1SHY B;  1UTC A;  5GMK n;  3I7H A;  4BH6 A;  3OF7 A;  5HE2 B;  4ZOZ A;  4G55 A;  3N0D A;  4BUJ C;  2VDM A;  3SHF A;  4A7J A;  4GQ1 A;  3NIG A;  2H9P A;  4L9O A;  4FAV D;  4H5J A;  2VDP A;  3C75 H;  3NID A;  2BKL A;  2HES X;  2TRC B;  4JHP C;  5TF2 A;  1H2W A;  2P9N C;  2EIB A;  3HFQ A;  1S4U X;  5EAP A;  2XL2 A;  3JZH A;  4Z7Q A;  1GOT B;  2H9L A;  4N14 A;  1H2X A;  4HDJ A;  4L1M A;  1U4C A;  1C9L A;  5TDH B;  3PXW D;  4J84 A;  4OZU A;  4E5Z B;  4L3H D;  5IC7 A;  3PVU B;  3VA6 A;  4A2L A;  3IUN A;  5C9Z B;  3IIW A;  3I8C A;  3IUR A;  4H5I A;  3SLE D;  4GM8 A;  4IRZ A;  3J81 g;  4D9S A;  5M5V A;  3ULE C;  3F3P A;  5AMS A;  2H14 A;  2H9N A;  3AH8 B;  4GZ8 A;  4MK0 B;  4O02 A;  2GNQ A;  5EMK B;  1SQJ A;  3OKW A;  2HJB A;  3CFS B;  3O4J A;  3SBP A;  5AJA A;  4EWR A;  3ZDY A;  4CI3 A;  5CXB A;  1K8K C;  2VZ3 A;  4J87 A;  3V4V A;  2VDK A;  5KDO B;  3MMY A;  2CN2 A;  2IWK A;  5EAL A;  3UVM A;  2IAA A;  4Y7R A;  2H9M A;  2XDW A;  4JT5 C;  3L4M D;  2CE8 A;  3UVL A;  2B5L A;  3OKT A;  1JV2 A;  1XHM A;  4AMZ A;  3B7F A;  3IUQ A;  5FFG A;  5EMJ B;  5CXC A;  4NC4 A;  4A09 A;  2CNX A;  1GG2 B;  4YVD A;  3GRE A;  5C2W B;  3FCS A;  4G1M A;  2PM6 B;  4LG8 A;  3EI1 A;  2YNO A;  4WJK A;  4BCC A;  2IUR A;  3U4Y A;  4A0B B;  3NVN A;  4GQ2 P;  3K26 A;  4O3U B;  3VI4 A;  5THA A;  5M5R A;  5IT9 g;  3EWE A;  2Z2N A;  4XYH A;  1GP2 B;  5FKS A;  2J55 H;  4GM9 A;  2HKM A;  3ZE0 A; 
#chains in the Genus database with same CATH homology
 4NEN A;  4Z7N A;  4G1E A;  1U8C A;  2VDO A;  4MMX A;  3T3P A;  3K6S A;  4Z7O A;  1JV2 A;  2VDR A;  5FFO A;  3V4P A;  1L5G A;  4O02 A;  5E6R A;  5FFG A;  4Z7Q A;  3K72 A;  4WK0 A;  3FCS A;  2VC2 A;  3IJE A;  4G1M A;  3T3M A;  3FCU A;  4WJK A;  5E6S A;  2VDL A;  5E6U A;  3ZDZ A;  4UM8 A;  3VI4 A;  3ZDY A;  1TYE A;  3NIF A;  4MMZ A;  5HDB A;  3V4V A;  3ZE1 A;  3K71 A;  2VDK A;  2VDQ A;  2VDN A;  2VDM A;  3ZE2 A;  4WK4 A;  3NIG A;  4MMY A;  1M1X A;  2VDP A;  4WK2 A;  3NID A;  4IRZ A;  3VI3 A;  3ZE0 A;  4UM9 A;  3ZDX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...