2VDNA

Re-refinement of integrin alphaiibbeta3 headpiece bound to antagonist eptifibatide
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
452
structure length
452
Chain Sequence
LNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords INTEGRIN ALPHA-IIB
publication title Structural Basis for Distinctive Recognition of Fibrinogen Gammac Peptide by the Platelet Integrin Alphaiibbeta3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system
total genus 106
structure length 452
sequence length 452
ec nomenclature
pdb deposition date 2007-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01839 FG-GAP FG-GAP repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 2vdnA00
1JV2A 4O02A 2VDNA 3IJEA 5HDBA 4WJKA 1L5GA 5E6UA 3ZDYA 4Z7OA 3NIDA 3ZDXA 3K71A 4UM9A 5FFGA 4MMXA 3VI4A 4Z7NA 2VDMA 2VC2A 1TYEA 2VDKA 1U8CA 4MMZA 3ZE1A 3V4PA 2VDLA 4IRZA 3VI3A 3T3MA 4G1EA 3T3PA 3ZDZA 4G1MA 3K6SA 2VDRA 4WK2A 3V4VA 3ZE2A 4Z7QA 5FFOA 5E6SA 4WK0A 2VDPA 3NIFA 3K72A 2VDQA 4WK4A 1M1XA 3ZE0A 4UM8A 4NENA 3NIGA 4MMYA 5E6RA 3FCUA 2VDOA 3FCSA
chains in the Genus database with same CATH superfamily
1OLZA 2MTAH 4FAVD 3PE7A 5HE1B 5AJAA 4CI1A 3PVWB 4GGCA 4O3TB 5E6UA 1K8KC 5H1MA 4E5ZA 1I2MB 5CXBB 4PBZA 4ZOVA 2YNPA 4D9SA 3DWLC 3ODTA 2I3TA 2IWKA 1GG2B 2XL2A 3DDUA 2YNNA 3I7HA 3V4PA 5H14A 4GM8A 3J81g 1VZ3A 4RE6A 4BUJC 5EALA 3JAMg 3C5MA 3SMRA 4Z7QA 2AH0A 2G9AA 1UOPA 2OVRB 2VDOA 3FRXA 4A09B 4XYHA 3GC3B 5HDBA 1H2XA 3FGBA 4PSWB 3OTTA 3KRXB 4JT6C 2H9MA 3OKYB 3UVNA 4AMYA 2H9LA 1C9IA 5TF2A 4BP8A 3C75H 4J87A 5KDOB 2H68A 4ZOZA 3SXTD 2HKMA 3W15A 4GQ2P 4I79A 3EI4B 5AMSA 4WK0A 2VDPA 2P9NC 3FCSA 2H9PA 3SBPA 3CIKB 4GMBA 4PXWA 3OKTA 4U1EI 4Z7OA 3EI2A 5FKTA 3MKQA 2XU7A 3MVDK 2H14A 5THAA 1QFSA 2J57G 1PI6A 1U8CA 4FB1D 4QRJA 2HU5A 5EMKB 3AL9A 2GC4A 3EQ9A 4CI3A 5CXCA 3SFZA 3DSMA 1TBGA 2P9SC 5FFOA 3IIWA 2B5NA 2B4EA 4ESGA 1H2ZA 4A08B 3KRWB 1Q47A 4J77A 4PBYA 4ZOYA 4A0AA 5B4WA 4GGAA 3CFSB 5I5IA 4A2MA 2OJYA 4WJKA 4L1QD 4U7AA 5FKQA 2PBIB 2YMUA 2P9PC 3K26A 3QI0A 4JXMA 3RRMC 3CFVA 3MKSB 3C99A 5JWZA 2BBKH 3EI1A 2BCJB 5EAMA 4A2LA 2HU8A 2CN3A 2GNQA 3V5WB 3I7KA 5K1CC 4KFMB 2CO0A 2H3XA 5EMJB 4FA9D 1M1XA 4L3GD 3MMYA 4AX4A 4E54A 1A12A 3IJEA 4X63B 2I0RA 1GOHA 4FHLA 3K71A 3IJCA 1A0RB 4UM9A 3IIYA 3EQ8A 3EI3A 4D6VA 4NAAA 3ORVD 2AGZA 1N6FA 3F3GA 4Y5RD 4ERZA 4ERYA 2WQ8A 2CNXA 5CXBA 3DM0A 1PEVA 2I0SA 2HU7A 3O4GA 5EM2B 2PM7B 5FXYA 2J55H 2AH1A 3IKOA 4R7AB 2IUPA 5C2WB 3RLMD 4JSVC 4J84A 5EAPA 4J82A 2I3SA 1VE7A 3I8EA 4FA1D 1E8MA 3I7LA 4A09A 1JMZB 5HYNB 2TRCB 1OMWB 4ERQA 2H9NA 2OIZA 3VI3A 4CZVA 3ZDZA 3IULA 3RFGA 4J0XA 3SBRA 3OKYA 4ZOXA 5C9ZB 2W18A 1XHMA 2QR5A 3L4MD 4H5JA 2PM9B 4JSNC 3BWSA 3U4YA 2QZPA 3MUOA 3GFCA 3SHFA 4BH6A 3EI4A 3AL8B 2EICA 3ZDXA 1E5TA 1N6DA 5FFGA 4QQEA 2VC2A 5FKSA 3B7FA 3EWEA 1U4CA 4MMZA 4IMMA 2CN2A 4Y7RA 3UKUC 2HESX 3UKRC 3N0DA 5I5MA 1O6FA 2P9KC 5FA5B 1B9YA 5IT9g 4E5ZB 3VA6A 4OZUA 4Z8LA 5M5SA 2YBAA 2VDQA 3NVNA 4LG8A 3ZE0A 3FM0A 3MZLA 5E6RA 5M5VA 1JV2A 2VDNA 4DNWA 4YVDA 3UVMA 4X3EA 4FA4D 4LG9A 3SN6B 3NIDA 3I7OA 3JPXA 4A08A 5EMLB 5IJ8E 5TEFA 4N14A 2HJ4A 3RN0D 5GXIA 3T3PA 3K6SA 4CY2A 1R5MA 2VDRA 5M61A 2XYIA 2J56H 1XKSA 2XDWA 2YNOA 3RSEC 1VZ2A 3NVXA 4AOWA 4GQBB 4NBMA 2H6NA 3PXSD 3AFCA 3OF7A 2HXCA 4G56B 1U2VC 2VZ1A 1UOQA 3IUNA 2P9UC 2P9IC 4J8GA 3I89A 2H13A 1GOFA 2AQ5A 3MZKA 5HE0B 5HQGA 4BCDA 4GQ1A 4J79A 4BCCA 2VDLA 4O9DA 1VE6A 2B5MA 4GM3A 2PM6B 3HFQA 3ZE2A 4ES0A 4JSXC 3RMZD 4QAMA 5EARA 4BP9A 3O4IA 1K3IA 3E0CA 3SCYA 3JB9L 3NIGA 3F3FA 3FCUA 4XEIC 3J80g 3V9FA 3ULEC 5EM2A 2GC7A 1FWXA 3SJLD 1BPOA 4O1QD 1GOTB 5CXCB 2O9KA 3IUQA 3VI4A 4PC0A 2BKLA 1JJUB 1TYEA 3OL2A 3IJ1A 1K32A 3OW8A 4D0KA 4AN0A 1GP2B 4RE5A 2CO0C 4G1EA 4GGDA 4WK2A 5CYKB 4AMZA 5E6SA 4NC4A 4L9OA 4MK0B 4NENA 4A11B 3EI1B 4PSXB 4G55A 4L3HD 2PM9A 2EBSA 3EG6A 3I7PA 4CZYA 2UZYB 4DNVA 2VZ3A 5FLXg 2Q7QA 3UVLA 3UVKA 3ZE1A 4J73A 4TZ4A 4IRZA 3AL8A 1JMXB 3EQ7A 4CI2A 3JROA 5C92A 1JTDB 4ZN4A 3VGZA 1XIPA 2HKRA 4L1MA 2G99A 4JD2C 4XYIA 1H2YA 2OK4A 3NIFA 2EIDA 3JZHA 4UM8A 4IA9A 2CE9A 4O02A 3A0FA 4O3UB 2Z2OA 3JZNA 3PSCB 3PVUB 5TDHB 3GREA 3ZDYA 3I2NA 2IUQA 5GSAA 4CY3A 4J86A 4CY1A 4JT5C 3N0EA 2H6KA 1L0QA 2EIEA 1PBYB 1YFQA 3BG1A 3SWSD 3PXTD 3F3PA 4O45A 4FAND 1O6GA 3O4JA 4CI8A 4A0BB 4NSXA 4BCBA 3OKWA 4A0BA 2AGXA 3K72A 4FWWA 4J81A 5IC7A 2XE4A 2P9LC 3GD1I 1L5GA 1JOFA 2AGYA 2QXVA 2IURA 2Z2NA 2UZXB 4O2WA 3UR4A 2IUVA 5GXHA 2VDKA 3IJ0A 1MG2A 1C9LA 1RI6A 4X61B 2HYEA 2I0TA 3T3MA 3RFHA 2H6QA 2QC5A 3DXKC 3SVWD 4JHPC 4QL1A 5FKRA 3C9CA 4A7JA 3EMHA 3PXWD 5H17A 5M5RA 2H47A 4MMYA 3EU7A 4QT8A 5HE3B 3JRPA 2JKXA 3UVOA 4K3JB 2CE8A 5I5JA 2Z2PA 3KCIA 5IJ7E 1MG3A 3IUJA 5TEEA 4LGNA 3I8CA 5A2Qg 1UOOA 3BG0A 4DNUA 1GXRA 4HDJA 1E8NA 4CY5A 1SQ9A 3ZWLB 4G1MA 4X60B 2IAAA 5IGQA 1PGUA 2EIBA 4CC9A 3RN1D 3EI2B 3MUNA 1MDAH 3V7DB 4BL0A 5AFU3 1YR2A 1T2XA 5GMKn 3I7NA 3MXXA 1VYHC 4GM9A 5CYKA 4AEZA 3SLED 5M5UA 5K19A 5C86A 3QHYB 5HE2B 3PSLA 3VH0A 2VDMA 1SHYB 3NVQA 4JHNA 4H5IA 4A11A 4FA5D 4J8BA 1QFMA 1GOGA 1NR0A 4CZXA 2HJBA 3IUMA 3IURA 2XL3A 1B9XA 1ERJA 1NEXB 2OVPB 5EMMB 4A0AB 2XZGA 4J78A 4OWRA 3V4VA 1QNIA 2IWFA 3AH8B 3P4FA 1H2WA 3K27A 5SXMA 4K3ID 4EWRA 3L4OD 2AGWA 1SQJA 4GZ8A 3DXMC 5C2VB 5M5TA 1P22A 1S4UX 3IVMA 3O4HA 3SBQA 2OK6A 4MMXA 4Z7NA 5IGOA 4JSPC 4UI9R 2AGLA 1UTCA 2YB8B 1TYQC 4E54B 1N6EA 4AN1A 3JZGA 4J0WA 5FQDA 4PNKB 2B5LA 4WK4A 2OVQB 3OL2B 3EI3B
chains in the Genus database with same CATH topology
1JV2A 4O02A 2VDNA 3IJEA 5HDBA 4WJKA 1L5GA 5E6UA 3ZDYA 4Z7OA 3NIDA 3ZDXA 3K71A 4UM9A 5FFGA 4MMXA 3VI4A 4Z7NA 2VDMA 2VC2A 1TYEA 2VDKA 1U8CA 4MMZA 3ZE1A 3V4PA 2VDLA 4IRZA 3VI3A 3T3MA 4G1EA 3T3PA 3ZDZA 4G1MA 3K6SA 2VDRA 4WK2A 3V4VA 3ZE2A 4Z7QA 5FFOA 5E6SA 4WK0A 2VDPA 3NIFA 3K72A 2VDQA 4WK4A 1M1XA 3ZE0A 4UM8A 4NENA 3NIGA 4MMYA 5E6RA 3FCUA 2VDOA 3FCSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JV2 A;  4O02 A;  2VDN A;  3IJE A;  5HDB A;  4WJK A;  1L5G A;  5E6U A;  3ZDY A;  4Z7O A;  3NID A;  3ZDX A;  3K71 A;  4UM9 A;  5FFG A;  4MMX A;  3VI4 A;  4Z7N A;  2VDM A;  2VC2 A;  1TYE A;  2VDK A;  1U8C A;  4MMZ A;  3ZE1 A;  3V4P A;  2VDL A;  4IRZ A;  3VI3 A;  3T3M A;  4G1E A;  3T3P A;  3ZDZ A;  4G1M A;  3K6S A;  2VDR A;  4WK2 A;  3V4V A;  3ZE2 A;  4Z7Q A;  5FFO A;  5E6S A;  4WK0 A;  2VDP A;  3NIF A;  3K72 A;  2VDQ A;  4WK4 A;  1M1X A;  3ZE0 A;  4UM8 A;  4NEN A;  3NIG A;  4MMY A;  5E6R A;  3FCU A;  2VDO A;  3FCS A; 
#chains in the Genus database with same CATH topology
 1OLZ A;  2MTA H;  4FAV D;  3PE7 A;  5HE1 B;  5AJA A;  4CI1 A;  3PVW B;  4GGC A;  4O3T B;  5E6U A;  1K8K C;  5H1M A;  4E5Z A;  1I2M B;  5CXB B;  4PBZ A;  4ZOV A;  2YNP A;  4D9S A;  3DWL C;  3ODT A;  2I3T A;  2IWK A;  1GG2 B;  2XL2 A;  3DDU A;  2YNN A;  3I7H A;  3V4P A;  5H14 A;  4GM8 A;  3J81 g;  1VZ3 A;  4RE6 A;  4BUJ C;  5EAL A;  3JAM g;  3C5M A;  3SMR A;  4Z7Q A;  2AH0 A;  2G9A A;  1UOP A;  2OVR B;  2VDO A;  3FRX A;  4A09 B;  4XYH A;  3GC3 B;  5HDB A;  1H2X A;  3FGB A;  4PSW B;  3OTT A;  3KRX B;  4JT6 C;  2H9M A;  3OKY B;  3UVN A;  4AMY A;  2H9L A;  1C9I A;  5TF2 A;  4BP8 A;  3C75 H;  4J87 A;  5KDO B;  2H68 A;  4ZOZ A;  3SXT D;  2HKM A;  3W15 A;  4GQ2 P;  4I79 A;  3EI4 B;  5AMS A;  4WK0 A;  2VDP A;  2P9N C;  3FCS A;  2H9P A;  3SBP A;  3CIK B;  4GMB A;  4PXW A;  3OKT A;  4U1E I;  4Z7O A;  3EI2 A;  5FKT A;  3MKQ A;  2XU7 A;  3MVD K;  2H14 A;  5THA A;  1QFS A;  2J57 G;  1PI6 A;  1U8C A;  4FB1 D;  4QRJ A;  2HU5 A;  5EMK B;  3AL9 A;  2GC4 A;  3EQ9 A;  4CI3 A;  5CXC A;  3SFZ A;  3DSM A;  1TBG A;  2P9S C;  5FFO A;  3IIW A;  2B5N A;  2B4E A;  4ESG A;  1H2Z A;  4A08 B;  3KRW B;  1Q47 A;  4J77 A;  4PBY A;  4ZOY A;  4A0A A;  5B4W A;  4GGA A;  3CFS B;  5I5I A;  4A2M A;  2OJY A;  4WJK A;  4L1Q D;  4U7A A;  5FKQ A;  2PBI B;  2YMU A;  2P9P C;  3K26 A;  3QI0 A;  4JXM A;  3RRM C;  3CFV A;  3MKS B;  3C99 A;  5JWZ A;  2BBK H;  3EI1 A;  2BCJ B;  5EAM A;  4A2L A;  2HU8 A;  2CN3 A;  2GNQ A;  3V5W B;  3I7K A;  5K1C C;  4KFM B;  2CO0 A;  2H3X A;  5EMJ B;  4FA9 D;  1M1X A;  4L3G D;  3MMY A;  4AX4 A;  4E54 A;  1A12 A;  3IJE A;  4X63 B;  2I0R A;  1GOH A;  4FHL A;  3K71 A;  3IJC A;  1A0R B;  4UM9 A;  3IIY A;  3EQ8 A;  3EI3 A;  4D6V A;  4NAA A;  3ORV D;  2AGZ A;  1N6F A;  3F3G A;  4Y5R D;  4ERZ A;  4ERY A;  2WQ8 A;  2CNX A;  5CXB A;  3DM0 A;  1PEV A;  2I0S A;  2HU7 A;  3O4G A;  5EM2 B;  2PM7 B;  5FXY A;  2J55 H;  2AH1 A;  3IKO A;  4R7A B;  2IUP A;  5C2W B;  3RLM D;  4JSV C;  4J84 A;  5EAP A;  4J82 A;  2I3S A;  1VE7 A;  3I8E A;  4FA1 D;  1E8M A;  3I7L A;  4A09 A;  1JMZ B;  5HYN B;  2TRC B;  1OMW B;  4ERQ A;  2H9N A;  2OIZ A;  3VI3 A;  4CZV A;  3ZDZ A;  3IUL A;  3RFG A;  4J0X A;  3SBR A;  3OKY A;  4ZOX A;  5C9Z B;  2W18 A;  1XHM A;  2QR5 A;  3L4M D;  4H5J A;  2PM9 B;  4JSN C;  3BWS A;  3U4Y A;  2QZP A;  3MUO A;  3GFC A;  3SHF A;  4BH6 A;  3EI4 A;  3AL8 B;  2EIC A;  3ZDX A;  1E5T A;  1N6D A;  5FFG A;  4QQE A;  2VC2 A;  5FKS A;  3B7F A;  3EWE A;  1U4C A;  4MMZ A;  4IMM A;  2CN2 A;  4Y7R A;  3UKU C;  2HES X;  3UKR C;  3N0D A;  5I5M A;  1O6F A;  2P9K C;  5FA5 B;  1B9Y A;  5IT9 g;  4E5Z B;  3VA6 A;  4OZU A;  4Z8L A;  5M5S A;  2YBA A;  2VDQ A;  3NVN A;  4LG8 A;  3ZE0 A;  3FM0 A;  3MZL A;  5E6R A;  5M5V A;  1JV2 A;  2VDN A;  4DNW A;  4YVD A;  3UVM A;  4X3E A;  4FA4 D;  4LG9 A;  3SN6 B;  3NID A;  3I7O A;  3JPX A;  4A08 A;  5EML B;  5IJ8 E;  5TEF A;  4N14 A;  2HJ4 A;  3RN0 D;  5GXI A;  3T3P A;  3K6S A;  4CY2 A;  1R5M A;  2VDR A;  5M61 A;  2XYI A;  2J56 H;  1XKS A;  2XDW A;  2YNO A;  3RSE C;  1VZ2 A;  3NVX A;  4AOW A;  4GQB B;  4NBM A;  2H6N A;  3PXS D;  3AFC A;  3OF7 A;  2HXC A;  4G56 B;  1U2V C;  2VZ1 A;  1UOQ A;  3IUN A;  2P9U C;  2P9I C;  4J8G A;  3I89 A;  2H13 A;  1GOF A;  2AQ5 A;  3MZK A;  5HE0 B;  5HQG A;  4BCD A;  4GQ1 A;  4J79 A;  4BCC A;  2VDL A;  4O9D A;  1VE6 A;  2B5M A;  4GM3 A;  2PM6 B;  3HFQ A;  3ZE2 A;  4ES0 A;  4JSX C;  3RMZ D;  4QAM A;  5EAR A;  4BP9 A;  3O4I A;  1K3I A;  3E0C A;  3SCY A;  3JB9 L;  3NIG A;  3F3F A;  3FCU A;  4XEI C;  3J80 g;  3V9F A;  3ULE C;  5EM2 A;  2GC7 A;  1FWX A;  3SJL D;  1BPO A;  4O1Q D;  1GOT B;  5CXC B;  2O9K A;  3IUQ A;  3VI4 A;  4PC0 A;  2BKL A;  1JJU B;  1TYE A;  3OL2 A;  3IJ1 A;  1K32 A;  3OW8 A;  4D0K A;  4AN0 A;  1GP2 B;  4RE5 A;  2CO0 C;  4G1E A;  4GGD A;  4WK2 A;  5CYK B;  4AMZ A;  5E6S A;  4NC4 A;  4L9O A;  4MK0 B;  4NEN A;  4A11 B;  3EI1 B;  4PSX B;  4G55 A;  4L3H D;  2PM9 A;  2EBS A;  3EG6 A;  3I7P A;  4CZY A;  2UZY B;  4DNV A;  2VZ3 A;  5FLX g;  2Q7Q A;  3UVL A;  3UVK A;  3ZE1 A;  4J73 A;  4TZ4 A;  4IRZ A;  3AL8 A;  1JMX B;  3EQ7 A;  4CI2 A;  3JRO A;  5C92 A;  1JTD B;  4ZN4 A;  3VGZ A;  1XIP A;  2HKR A;  4L1M A;  2G99 A;  4JD2 C;  4XYI A;  1H2Y A;  2OK4 A;  3NIF A;  2EID A;  3JZH A;  4UM8 A;  4IA9 A;  2CE9 A;  4O02 A;  3A0F A;  4O3U B;  2Z2O A;  3JZN A;  3PSC B;  3PVU B;  5TDH B;  3GRE A;  3ZDY A;  3I2N A;  2IUQ A;  5GSA A;  4CY3 A;  4J86 A;  4CY1 A;  4JT5 C;  3N0E A;  2H6K A;  1L0Q A;  2EIE A;  1PBY B;  1YFQ A;  3BG1 A;  3SWS D;  3PXT D;  3F3P A;  4O45 A;  4FAN D;  1O6G A;  3O4J A;  4CI8 A;  4A0B B;  4NSX A;  4BCB A;  3OKW A;  4A0B A;  2AGX A;  3K72 A;  4FWW A;  4J81 A;  5IC7 A;  2XE4 A;  2P9L C;  3GD1 I;  1L5G A;  1JOF A;  2AGY A;  2QXV A;  2IUR A;  2Z2N A;  2UZX B;  4O2W A;  3UR4 A;  2IUV A;  5GXH A;  2VDK A;  3IJ0 A;  1MG2 A;  1C9L A;  1RI6 A;  4X61 B;  2HYE A;  2I0T A;  3T3M A;  3RFH A;  2H6Q A;  2QC5 A;  3DXK C;  3SVW D;  4JHP C;  4QL1 A;  5FKR A;  3C9C A;  4A7J A;  3EMH A;  3PXW D;  5H17 A;  5M5R A;  2H47 A;  4MMY A;  3EU7 A;  4QT8 A;  5HE3 B;  3JRP A;  2JKX A;  3UVO A;  4K3J B;  2CE8 A;  5I5J A;  2Z2P A;  3KCI A;  5IJ7 E;  1MG3 A;  3IUJ A;  5TEE A;  4LGN A;  3I8C A;  5A2Q g;  1UOO A;  3BG0 A;  4DNU A;  1GXR A;  4HDJ A;  1E8N A;  4CY5 A;  1SQ9 A;  3ZWL B;  4G1M A;  4X60 B;  2IAA A;  5IGQ A;  1PGU A;  2EIB A;  4CC9 A;  3RN1 D;  3EI2 B;  3MUN A;  1MDA H;  3V7D B;  4BL0 A;  5AFU 3;  1YR2 A;  1T2X A;  5GMK n;  3I7N A;  3MXX A;  1VYH C;  4GM9 A;  5CYK A;  4AEZ A;  3SLE D;  5M5U A;  5K19 A;  5C86 A;  3QHY B;  5HE2 B;  3PSL A;  3VH0 A;  2VDM A;  1SHY B;  3NVQ A;  4JHN A;  4H5I A;  4A11 A;  4FA5 D;  4J8B A;  1QFM A;  1GOG A;  1NR0 A;  4CZX A;  2HJB A;  3IUM A;  3IUR A;  2XL3 A;  1B9X A;  1ERJ A;  1NEX B;  2OVP B;  5EMM B;  4A0A B;  2XZG A;  4J78 A;  4OWR A;  3V4V A;  1QNI A;  2IWF A;  3AH8 B;  3P4F A;  1H2W A;  3K27 A;  5SXM A;  4K3I D;  4EWR A;  3L4O D;  2AGW A;  1SQJ A;  4GZ8 A;  3DXM C;  5C2V B;  5M5T A;  1P22 A;  1S4U X;  3IVM A;  3O4H A;  3SBQ A;  2OK6 A;  4MMX A;  4Z7N A;  5IGO A;  4JSP C;  4UI9 R;  2AGL A;  1UTC A;  2YB8 B;  1TYQ C;  4E54 B;  1N6E A;  4AN1 A;  3JZG A;  4J0W A;  5FQD A;  4PNK B;  2B5L A;  4WK4 A;  2OVQ B;  3OL2 B;  3EI3 B; 
#chains in the Genus database with same CATH homology
 1JV2 A;  4O02 A;  2VDN A;  3IJE A;  5HDB A;  4WJK A;  1L5G A;  5E6U A;  3ZDY A;  4Z7O A;  3NID A;  3ZDX A;  3K71 A;  4UM9 A;  5FFG A;  4MMX A;  3VI4 A;  4Z7N A;  2VDM A;  2VC2 A;  1TYE A;  2VDK A;  1U8C A;  4MMZ A;  3ZE1 A;  3V4P A;  2VDL A;  4IRZ A;  3VI3 A;  3T3M A;  4G1E A;  3T3P A;  3ZDZ A;  4G1M A;  3K6S A;  2VDR A;  4WK2 A;  3V4V A;  3ZE2 A;  4Z7Q A;  5FFO A;  5E6S A;  4WK0 A;  2VDP A;  3NIF A;  3K72 A;  2VDQ A;  4WK4 A;  1M1X A;  3ZE0 A;  4UM8 A;  4NEN A;  3NIG A;  4MMY A;  5E6R A;  3FCU A;  2VDO A;  3FCS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...