2VDNA

Re-refinement of integrin alphaiibbeta3 headpiece bound to antagonist eptifibatide
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
452
structure length
452
Chain Sequence
LNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis for Distinctive Recognition of Fibrinogen Gammac Peptide by the Platelet Integrin Alphaiibbeta3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system
molecule keywords INTEGRIN ALPHA-IIB
total genus 106
structure length 452
sequence length 452
ec nomenclature
pdb deposition date 2007-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01839 FG-GAP FG-GAP repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 2vdnA00
5E6UA 3VI3A 5HDBA 5FFOA 2VC2A 5E6SA 3K6SA 2VDOA 5FFGA 2VDQA 3T3MA 4Z7QA 4MMZA 1JV2A 3K71A 4G1EA 3ZDXA 1U8CA 1L5GA 3IJEA 3ZE1A 1M1XA 4WK0A 2VDPA 4WK2A 3V4PA 4Z7NA 4Z7OA 3K72A 3ZDYA 4WJKA 2VDLA 3NIDA 4WK4A 3T3PA 4UM8A 3FCSA 3NIFA 2VDKA 1TYEA 5E6RA 3NIGA 3FCUA 2VDRA 4UM9A 4MMXA 3ZE2A 4G1MA 3V4VA 3VI4A 3ZDZA 2VDNA 4NENA 3ZE0A 4IRZA 4MMYA 2VDMA 4O02A
chains in the Genus database with same CATH superfamily
5E6UA 2P9SC 3V5WB 4GGAA 5FFGA 2PM9A 5GMKn 3UR4A 2AGWA 4L9OA 1JV2A 4A2LA 4FAND 4K3ID 4GZ8A 5FLXg 4DNWA 3RSEC 1PI6A 1YFQA 3K72A 4WJKA 4CI8A 2OIZA 3I7NA 3RFHA 1JMXB 3DSMA 2J57G 3C99A 2H6NA 2HKMA 4NSXA 3EU7A 2VDNA 2HXCA 2PM6B 3I89A 3C9CA 1SQ9A 2HU5A 1U2VC 3BG0A 4JSXC 4WK2A 1H2WA 4D0KA 3SLED 3SHFA 1XHMA 1SHYB 1N6EA 3IUMA 4ZOVA 4J82A 2AGYA 1YR2A 3IULA 2EIEA 5AMSA 5HE3B 1ERJA 1JOFA 5EMKB 2J56H 3ULEC 4IA9A 3GD1I 4CY2A 3DWLC 3E0CA 3KCIA 5GSAA 2HKRA 5IGQA 2Z2PA 3SBQA 4Z7NA 2CNXA 3O4JA 3IJ1A 2BBKH 5I5MA 2VDRA 4FA9D 5HYNB 2H9LA 2Z2OA 1UOPA 2P9PC 5AJAA 1N6DA 5TEEA 4MMYA 3I8CA 2XE4A 2AH0A 3EQ8A 4DNUA 3ZDXA 4GQ1A 4J8GA 2I3SA 4U1EI 2QXVA 1E8MA 4A08A 1H2ZA 4BCCA 5TDHB 2EIBA 1QFMA 3FCSA 1GP2B 4GQ2P 5SXMA 3MVDK 3MUNA 2YMUA 4A0AB 3IIYA 3JRPA 3U4YA 4O02A 3MKSB 4K3JB 4O2WA 2IUVA 2BKLA 3A0FA 5H14A 1MG3A 5M5SA 2P9NC 2CE8A 1VE6A 3IUNA 1GOHA 4YVDA 2VZ3A 4JSVC 5IGOA 3RRMC 5CYKA 2XZGA 4XYIA 5EAPA 2IUQA 3I7KA 4X63B 1XIPA 3ZDZA 3PE7A 3NVQA 5FFOA 4JHNA 4PSWB 2AGLA 5HQGA 4FWWA 4A11B 5CXBB 3W15A 3EI2A 2Q7QA 3OF7A 1I2MB 1M1XA 2YNNA 4LG9A 3ZE1A 2CN3A 3O4GA 1C9IA 4UM8A 4CI1A 2IAAA 4Y7RA 4BCDA 4D9SA 1JMZB 1VE7A 1OLZA 2XL3A 3F3PA 3I8EA 4L3GD 3V4VA 4FA1D 1OMWB 4PNKB 4A11A 4IRZA 4FA5D 3FGBA 3UVMA 2EBSA 3FRXA 3N0EA 1FWXA 3PSLA 4A7JA 3GFCA 4BP9A 1UTCA 4CY5A 4Z7QA 4MMZA 1K32A 1NR0A 4ESGA 5B4WA 2CO0A 4RE5A 2EICA 3AL9A 4PBZA 2I0TA 4JHPC 4FAVD 3EI4A 4U7AA 3C75H 4LG8A 4QQEA 3L4MD 2PBIB 3T3PA 4J79A 4E54B 5CXCB 3SXTD 1VZ3A 3CFVA 3QI0A 4R7AB 4BP8A 3VA6A 2CN2A 4X61B 1P22A 3PVWB 3N0DA 4QL1A 3KRWB 3ZE0A 3NVNA 5TEFA 3VI3A 3SVWD 1N6FA 1UOQA 5M5RA 2BCJB 4ZN4A 1VYHC 3JZHA 4A08B 5IJ8E 4O3TB 3MZKA 4EWRA 3EI3B 1A12A 4QRJA 3MZLA 5I5JA 3RN1D 3JZGA 2OK4A 3ODTA 4O45A 3J80g 3RN0D 1L0QA 4UM9A 1RI6A 3AFCA 5FQDA 4D6VA 2OVQB 4HDJA 5K1CC 4BUJC 4AMYA 3PSCB 4AN1A 5E6SA 4O9DA 3QHYB 4GM8A 5HE1B 2TRCB 3OTTA 5H17A 1QNIA 4Y5RD 1U8CA 3PXTD 2IWKA 4L1QD 4CC9A 4JSPC 2JKXA 4TZ4A 2MTAH 3MKQA 3V9FA 1UOOA 3NIFA 5HE2B 3BWSA 4GGCA 5IT9g 4OZUA 1GG2B 1PEVA 2Z2NA 3SN6B 4QT8A 5HDBA 5CXBA 3EG6A 3T3MA 3CIKB 4E5ZA 4A0AA 5CXCA 2XYIA 2B5LA 5FKQA 4L1MA 1K3IA 3K26A 4O1QD 3AL8A 3O4IA 2IUPA 2P9LC 3PVUB 3C5MA 4GQBB 3OL2A 2IWFA 4J78A 1JJUB 2H9MA 3IUJA 2QR5A 4H5IA 3I7HA 5I5IA 4J0WA 2HESX 5H1MA 4FB1D 1GXRA 1O6FA 1GOGA 5C92A 2PM9B 3IURA 2I0SA 2I3TA 5THAA 3OW8A 4CZVA 4NAAA 3EQ7A 5CYKB 1R5MA 2P9IC 2O9KA 2W18A 3OKWA 4Z8LA 3EMHA 3AL8B 5HE0B 2OVRB 2VDQA 4AN0A 3VGZA 3K71A 4O3UB 1BPOA 4G1EA 4H5JA 5AFU3 3IJEA 3JROA 4E54A 3DDUA 5EAMA 2CO0C 4JT5C 4X60B 3F3GA 3MUOA 2YNOA 3GREA 5C86A 4MK0B 1VZ2A 2WQ8A 4RE6A 4AEZA 2G9AA 4XYHA 2QZPA 4G1MA 3VH0A 4NC4A 3UKRC 5EARA 5EMLB 2GC4A 3EWEA 3V7DB 3KRXB 3I7OA 4QAMA 3SWSD 4PXWA 4G55A 4A2MA 2H9NA 3EI1A 1GOFA 4CZXA 2H47A 1L5GA 4J77A 3UKUC 5FXYA 3SCYA 3CFSB 1MG2A 3ZDYA 4E5ZB 3B7FA 3NIDA 2HU8A 4L3HD 2H6QA 2P9KC 2VDKA 1NEXB 4FHLA 2AGXA 3IVMA 4J87A 5FA5B 3UVLA 3RFGA 4ZOXA 3IUQA 3SFZA 4BL0A 3EI1B 3HFQA 4DNVA 3EI4B 1B9XA 5GXHA 2AQ5A 2EIDA 2H6KA 2HYEA 3OKYB 2H13A 3SMRA 1C9LA 2HU7A 3UVKA 1PGUA 5C2VB 2QC5A 4NBMA 3O4HA 4WK4A 3JB9L 3EI2B 2H3XA 2IURA 3OKTA 5JWZA 4JD2C 3DXKC 3NVXA 4ERYA 3I7PA 2GNQA 5FKSA 3SBRA 5C2WB 5IJ7E 1SQJA 5FKTA 3IKOA 4A0BB 4G56B 1PBYB 5TF2A 2B4EA 2YBAA 3I2NA 3SBPA 4A09A 4CI2A 1S4UX 4Z7OA 3PXSD 3K27A 4KFMB 1H2YA 3J81g 3NIGA 4PBYA 4UI9R 4J0XA 4A0BA 4GGDA 5GXIA 3MXXA 4AMZA 2CE9A 1U4CA 5EMMB 5C9ZB 2VC2A 3K6SA 3F3FA 2GC7A 2XL2A 3FM0A 5EM2B 2H68A 3ORVD 2P9UC 3PXWD 4XEIC 2YB8B 3IIWA 3IJ0A 3RMZD 2OK6A 4CZYA 2VDPA 4GM3A 4ERQA 3MMYA 2VDLA 4IMMA 2J55H 2XU7A 1TYEA 3FCUA 3OKYA 2VZ1A 4ZOYA 4JT6C 4LGNA 3ZE2A 1H2XA 5FKRA 3OL2B 2YNPA 5EM2A 2I0RA 1K8KC 4J8BA 1T2XA 1A0RB 4CY3A 2PM7B 3L4OD 4PSXB 3JPXA 4X3EA 3AH8B 4J86A 3RLMD 2B5NA 3SJLD 4WK0A 3V4PA 2OJYA 5K19A 3I7LA 1XKSA 4PC0A 5M5VA 5E6RA 4CI3A 4J84A 1GOTB 4A09B 5EMJB 4CY1A 2AGZA 3GC3B 3JZNA 4MMXA 1JTDB 3EQ9A 3ZWLB 2UZXB 5KDOB 1B9YA 4BH6A 2VDMA 2B5MA 3VI4A 3DXMC 4AOWA 1Q47A 4JSNC 2VDOA 2OVPB 5A2Qg 2HJ4A 4GMBA 1O6GA 2XDWA 3EI3A 2H9PA 4AX4A 2HJBA 3UVOA 2G99A 2H14A 4ES0A 4J81A 4JXMA 5M5TA 1TBGA 2UZYB 5M61A 5M5UA 1QFSA 4ERZA 3BG1A 3P4FA 4N14A 4ZOZA 3DM0A 3JAMg 1MDAH 2AH1A 1TYQC 1E8NA 3UVNA 5IC7A 4FA4D 4I79A 3IJCA 4J73A 5EALA 1E5TA 4BCBA 4GM9A 4OWRA 4NENA
chains in the Genus database with same CATH topology
5E6UA 3VI3A 5HDBA 5FFOA 2VC2A 5E6SA 3K6SA 2VDOA 5FFGA 2VDQA 3T3MA 4Z7QA 4MMZA 1JV2A 3K71A 4G1EA 3ZDXA 1U8CA 1L5GA 3IJEA 3ZE1A 1M1XA 4WK0A 2VDPA 4WK2A 3V4PA 4Z7NA 4Z7OA 3K72A 3ZDYA 4WJKA 2VDLA 3NIDA 4WK4A 3T3PA 4UM8A 3FCSA 3NIFA 2VDKA 1TYEA 5E6RA 3NIGA 3FCUA 2VDRA 4UM9A 4MMXA 3ZE2A 4G1MA 3V4VA 3VI4A 3ZDZA 2VDNA 4NENA 3ZE0A 4IRZA 4MMYA 2VDMA 4O02A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E6U A;  3VI3 A;  5HDB A;  5FFO A;  2VC2 A;  5E6S A;  3K6S A;  2VDO A;  5FFG A;  2VDQ A;  3T3M A;  4Z7Q A;  4MMZ A;  1JV2 A;  3K71 A;  4G1E A;  3ZDX A;  1U8C A;  1L5G A;  3IJE A;  3ZE1 A;  1M1X A;  4WK0 A;  2VDP A;  4WK2 A;  3V4P A;  4Z7N A;  4Z7O A;  3K72 A;  3ZDY A;  4WJK A;  2VDL A;  3NID A;  4WK4 A;  3T3P A;  4UM8 A;  3FCS A;  3NIF A;  2VDK A;  1TYE A;  5E6R A;  3NIG A;  3FCU A;  2VDR A;  4UM9 A;  4MMX A;  3ZE2 A;  4G1M A;  3V4V A;  3VI4 A;  3ZDZ A;  2VDN A;  4NEN A;  3ZE0 A;  4IRZ A;  4MMY A;  2VDM A;  4O02 A; 
#chains in the Genus database with same CATH topology
 5E6U A;  2P9S C;  3V5W B;  4GGA A;  5FFG A;  2PM9 A;  5GMK n;  3UR4 A;  2AGW A;  4L9O A;  1JV2 A;  4A2L A;  4FAN D;  4K3I D;  4GZ8 A;  5FLX g;  4DNW A;  3RSE C;  1PI6 A;  1YFQ A;  3K72 A;  4WJK A;  4CI8 A;  2OIZ A;  3I7N A;  3RFH A;  1JMX B;  3DSM A;  2J57 G;  3C99 A;  2H6N A;  2HKM A;  4NSX A;  3EU7 A;  2VDN A;  2HXC A;  2PM6 B;  3I89 A;  3C9C A;  1SQ9 A;  2HU5 A;  1U2V C;  3BG0 A;  4JSX C;  4WK2 A;  1H2W A;  4D0K A;  3SLE D;  3SHF A;  1XHM A;  1SHY B;  1N6E A;  3IUM A;  4ZOV A;  4J82 A;  2AGY A;  1YR2 A;  3IUL A;  2EIE A;  5AMS A;  5HE3 B;  1ERJ A;  1JOF A;  5EMK B;  2J56 H;  3ULE C;  4IA9 A;  3GD1 I;  4CY2 A;  3DWL C;  3E0C A;  3KCI A;  5GSA A;  2HKR A;  5IGQ A;  2Z2P A;  3SBQ A;  4Z7N A;  2CNX A;  3O4J A;  3IJ1 A;  2BBK H;  5I5M A;  2VDR A;  4FA9 D;  5HYN B;  2H9L A;  2Z2O A;  1UOP A;  2P9P C;  5AJA A;  1N6D A;  5TEE A;  4MMY A;  3I8C A;  2XE4 A;  2AH0 A;  3EQ8 A;  4DNU A;  3ZDX A;  4GQ1 A;  4J8G A;  2I3S A;  4U1E I;  2QXV A;  1E8M A;  4A08 A;  1H2Z A;  4BCC A;  5TDH B;  2EIB A;  1QFM A;  3FCS A;  1GP2 B;  4GQ2 P;  5SXM A;  3MVD K;  3MUN A;  2YMU A;  4A0A B;  3IIY A;  3JRP A;  3U4Y A;  4O02 A;  3MKS B;  4K3J B;  4O2W A;  2IUV A;  2BKL A;  3A0F A;  5H14 A;  1MG3 A;  5M5S A;  2P9N C;  2CE8 A;  1VE6 A;  3IUN A;  1GOH A;  4YVD A;  2VZ3 A;  4JSV C;  5IGO A;  3RRM C;  5CYK A;  2XZG A;  4XYI A;  5EAP A;  2IUQ A;  3I7K A;  4X63 B;  1XIP A;  3ZDZ A;  3PE7 A;  3NVQ A;  5FFO A;  4JHN A;  4PSW B;  2AGL A;  5HQG A;  4FWW A;  4A11 B;  5CXB B;  3W15 A;  3EI2 A;  2Q7Q A;  3OF7 A;  1I2M B;  1M1X A;  2YNN A;  4LG9 A;  3ZE1 A;  2CN3 A;  3O4G A;  1C9I A;  4UM8 A;  4CI1 A;  2IAA A;  4Y7R A;  4BCD A;  4D9S A;  1JMZ B;  1VE7 A;  1OLZ A;  2XL3 A;  3F3P A;  3I8E A;  4L3G D;  3V4V A;  4FA1 D;  1OMW B;  4PNK B;  4A11 A;  4IRZ A;  4FA5 D;  3FGB A;  3UVM A;  2EBS A;  3FRX A;  3N0E A;  1FWX A;  3PSL A;  4A7J A;  3GFC A;  4BP9 A;  1UTC A;  4CY5 A;  4Z7Q A;  4MMZ A;  1K32 A;  1NR0 A;  4ESG A;  5B4W A;  2CO0 A;  4RE5 A;  2EIC A;  3AL9 A;  4PBZ A;  2I0T A;  4JHP C;  4FAV D;  3EI4 A;  4U7A A;  3C75 H;  4LG8 A;  4QQE A;  3L4M D;  2PBI B;  3T3P A;  4J79 A;  4E54 B;  5CXC B;  3SXT D;  1VZ3 A;  3CFV A;  3QI0 A;  4R7A B;  4BP8 A;  3VA6 A;  2CN2 A;  4X61 B;  1P22 A;  3PVW B;  3N0D A;  4QL1 A;  3KRW B;  3ZE0 A;  3NVN A;  5TEF A;  3VI3 A;  3SVW D;  1N6F A;  1UOQ A;  5M5R A;  2BCJ B;  4ZN4 A;  1VYH C;  3JZH A;  4A08 B;  5IJ8 E;  4O3T B;  3MZK A;  4EWR A;  3EI3 B;  1A12 A;  4QRJ A;  3MZL A;  5I5J A;  3RN1 D;  3JZG A;  2OK4 A;  3ODT A;  4O45 A;  3J80 g;  3RN0 D;  1L0Q A;  4UM9 A;  1RI6 A;  3AFC A;  5FQD A;  4D6V A;  2OVQ B;  4HDJ A;  5K1C C;  4BUJ C;  4AMY A;  3PSC B;  4AN1 A;  5E6S A;  4O9D A;  3QHY B;  4GM8 A;  5HE1 B;  2TRC B;  3OTT A;  5H17 A;  1QNI A;  4Y5R D;  1U8C A;  3PXT D;  2IWK A;  4L1Q D;  4CC9 A;  4JSP C;  2JKX A;  4TZ4 A;  2MTA H;  3MKQ A;  3V9F A;  1UOO A;  3NIF A;  5HE2 B;  3BWS A;  4GGC A;  5IT9 g;  4OZU A;  1GG2 B;  1PEV A;  2Z2N A;  3SN6 B;  4QT8 A;  5HDB A;  5CXB A;  3EG6 A;  3T3M A;  3CIK B;  4E5Z A;  4A0A A;  5CXC A;  2XYI A;  2B5L A;  5FKQ A;  4L1M A;  1K3I A;  3K26 A;  4O1Q D;  3AL8 A;  3O4I A;  2IUP A;  2P9L C;  3PVU B;  3C5M A;  4GQB B;  3OL2 A;  2IWF A;  4J78 A;  1JJU B;  2H9M A;  3IUJ A;  2QR5 A;  4H5I A;  3I7H A;  5I5I A;  4J0W A;  2HES X;  5H1M A;  4FB1 D;  1GXR A;  1O6F A;  1GOG A;  5C92 A;  2PM9 B;  3IUR A;  2I0S A;  2I3T A;  5THA A;  3OW8 A;  4CZV A;  4NAA A;  3EQ7 A;  5CYK B;  1R5M A;  2P9I C;  2O9K A;  2W18 A;  3OKW A;  4Z8L A;  3EMH A;  3AL8 B;  5HE0 B;  2OVR B;  2VDQ A;  4AN0 A;  3VGZ A;  3K71 A;  4O3U B;  1BPO A;  4G1E A;  4H5J A;  5AFU 3;  3IJE A;  3JRO A;  4E54 A;  3DDU A;  5EAM A;  2CO0 C;  4JT5 C;  4X60 B;  3F3G A;  3MUO A;  2YNO A;  3GRE A;  5C86 A;  4MK0 B;  1VZ2 A;  2WQ8 A;  4RE6 A;  4AEZ A;  2G9A A;  4XYH A;  2QZP A;  4G1M A;  3VH0 A;  4NC4 A;  3UKR C;  5EAR A;  5EML B;  2GC4 A;  3EWE A;  3V7D B;  3KRX B;  3I7O A;  4QAM A;  3SWS D;  4PXW A;  4G55 A;  4A2M A;  2H9N A;  3EI1 A;  1GOF A;  4CZX A;  2H47 A;  1L5G A;  4J77 A;  3UKU C;  5FXY A;  3SCY A;  3CFS B;  1MG2 A;  3ZDY A;  4E5Z B;  3B7F A;  3NID A;  2HU8 A;  4L3H D;  2H6Q A;  2P9K C;  2VDK A;  1NEX B;  4FHL A;  2AGX A;  3IVM A;  4J87 A;  5FA5 B;  3UVL A;  3RFG A;  4ZOX A;  3IUQ A;  3SFZ A;  4BL0 A;  3EI1 B;  3HFQ A;  4DNV A;  3EI4 B;  1B9X A;  5GXH A;  2AQ5 A;  2EID A;  2H6K A;  2HYE A;  3OKY B;  2H13 A;  3SMR A;  1C9L A;  2HU7 A;  3UVK A;  1PGU A;  5C2V B;  2QC5 A;  4NBM A;  3O4H A;  4WK4 A;  3JB9 L;  3EI2 B;  2H3X A;  2IUR A;  3OKT A;  5JWZ A;  4JD2 C;  3DXK C;  3NVX A;  4ERY A;  3I7P A;  2GNQ A;  5FKS A;  3SBR A;  5C2W B;  5IJ7 E;  1SQJ A;  5FKT A;  3IKO A;  4A0B B;  4G56 B;  1PBY B;  5TF2 A;  2B4E A;  2YBA A;  3I2N A;  3SBP A;  4A09 A;  4CI2 A;  1S4U X;  4Z7O A;  3PXS D;  3K27 A;  4KFM B;  1H2Y A;  3J81 g;  3NIG A;  4PBY A;  4UI9 R;  4J0X A;  4A0B A;  4GGD A;  5GXI A;  3MXX A;  4AMZ A;  2CE9 A;  1U4C A;  5EMM B;  5C9Z B;  2VC2 A;  3K6S A;  3F3F A;  2GC7 A;  2XL2 A;  3FM0 A;  5EM2 B;  2H68 A;  3ORV D;  2P9U C;  3PXW D;  4XEI C;  2YB8 B;  3IIW A;  3IJ0 A;  3RMZ D;  2OK6 A;  4CZY A;  2VDP A;  4GM3 A;  4ERQ A;  3MMY A;  2VDL A;  4IMM A;  2J55 H;  2XU7 A;  1TYE A;  3FCU A;  3OKY A;  2VZ1 A;  4ZOY A;  4JT6 C;  4LGN A;  3ZE2 A;  1H2X A;  5FKR A;  3OL2 B;  2YNP A;  5EM2 A;  2I0R A;  1K8K C;  4J8B A;  1T2X A;  1A0R B;  4CY3 A;  2PM7 B;  3L4O D;  4PSX B;  3JPX A;  4X3E A;  3AH8 B;  4J86 A;  3RLM D;  2B5N A;  3SJL D;  4WK0 A;  3V4P A;  2OJY A;  5K19 A;  3I7L A;  1XKS A;  4PC0 A;  5M5V A;  5E6R A;  4CI3 A;  4J84 A;  1GOT B;  4A09 B;  5EMJ B;  4CY1 A;  2AGZ A;  3GC3 B;  3JZN A;  4MMX A;  1JTD B;  3EQ9 A;  3ZWL B;  2UZX B;  5KDO B;  1B9Y A;  4BH6 A;  2VDM A;  2B5M A;  3VI4 A;  3DXM C;  4AOW A;  1Q47 A;  4JSN C;  2VDO A;  2OVP B;  5A2Q g;  2HJ4 A;  4GMB A;  1O6G A;  2XDW A;  3EI3 A;  2H9P A;  4AX4 A;  2HJB A;  3UVO A;  2G99 A;  2H14 A;  4ES0 A;  4J81 A;  4JXM A;  5M5T A;  1TBG A;  2UZY B;  5M61 A;  5M5U A;  1QFS A;  4ERZ A;  3BG1 A;  3P4F A;  4N14 A;  4ZOZ A;  3DM0 A;  3JAM g;  1MDA H;  2AH1 A;  1TYQ C;  1E8N A;  3UVN A;  5IC7 A;  4FA4 D;  4I79 A;  3IJC A;  4J73 A;  5EAL A;  1E5T A;  4BCB A;  4GM9 A;  4OWR A;  4NEN A; 
#chains in the Genus database with same CATH homology
 5E6U A;  3VI3 A;  5HDB A;  5FFO A;  2VC2 A;  5E6S A;  3K6S A;  2VDO A;  5FFG A;  2VDQ A;  3T3M A;  4Z7Q A;  4MMZ A;  1JV2 A;  3K71 A;  4G1E A;  3ZDX A;  1U8C A;  1L5G A;  3IJE A;  3ZE1 A;  1M1X A;  4WK0 A;  2VDP A;  4WK2 A;  3V4P A;  4Z7N A;  4Z7O A;  3K72 A;  3ZDY A;  4WJK A;  2VDL A;  3NID A;  4WK4 A;  3T3P A;  4UM8 A;  3FCS A;  3NIF A;  2VDK A;  1TYE A;  5E6R A;  3NIG A;  3FCU A;  2VDR A;  4UM9 A;  4MMX A;  3ZE2 A;  4G1M A;  3V4V A;  3VI4 A;  3ZDZ A;  2VDN A;  4NEN A;  3ZE0 A;  4IRZ A;  4MMY A;  2VDM A;  4O02 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...